HHsearch alignment for GI: 254780414 and conserved domain: COG0311

>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism].
Probab=98.28  E-value=5e-05  Score=56.18  Aligned_cols=169  Identities=16%  Similarity=0.333  Sum_probs=90.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHCCCCEEEECCCCCCCC-----CCCCCCCCHHHHHCCCCE
Q ss_conf             69999889705788998888659-406985289898899723997999985388999-----999975376898089988
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESK-VYCEVIAFKNALDYFKEQNPQAIILSGSPASSL-----DIDSPQIPKEILESNIPL   82 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelg-VyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~-----d~~ap~~~~~I~~~~iPI   82 (520)
T Consensus         2 ~IGVLalQG~v~EH-~~~l~~~~~~e--~~~V-k~~~dL~--~~d~LIiPGGESTTi~rL~~~~gl~e~l~~~~~~G~Pv   75 (194)
T COG0311           2 KIGVLALQGAVEEH-LEALEKAGGAE--VVEV-KRPEDLE--GVDGLIIPGGESTTIGRLLKRYGLLEPLREFIADGLPV   75 (194)
T ss_pred             EEEEEEECCCHHHH-HHHHHHHCCCC--EEEE-CCHHHHC--CCCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCCCE
T ss_conf             47999850468999-99998605873--5997-1778855--37678954950789999998738489999999769964


Q ss_pred             EEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCC-----------CCCCCCCCCCCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             9977899998997096999869866103667523886-----------22278726655336860022011012444211
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNC-----------SLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~-----------~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
T Consensus        76 ~GTCAGlIlLakei~~~---~~~~~Lg~mdi~V~RNAfGRQ~dSFe~~~di~~~~~~~~~~avFI-RAP~I~~vg~~V~v  151 (194)
T COG0311          76 FGTCAGLILLAKEILDG---PEQPLLGLLDVTVRRNAFGRQVDSFETELDIEGFGLPFPFPAVFI-RAPVIEEVGDGVEV  151 (194)
T ss_pred             EEECHHHHHHHHHHCCC---CCCCCCCEEEEEEECCCCCCCCCCCEEEEEEECCCCCCCCEEEEE-ECCEEEHHCCCCEE
T ss_conf             77514256534655089---877521227899981365543123010678641367776239999-86402000676067


Q ss_pred             EECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             232398317889863500112465212221520257799875
Q gi|254780414|r  152 IASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       152 iA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       152 La~l~~~iVav~---qgn~LatsFHPELT~D~---r~Heyf~  187 (194)
T COG0311         152 LATLDGRIVAVK---QGNILATSFHPELTDDT---RLHEYFL  187 (194)
T ss_pred             EEECCCEEEEEE---ECCEEEEECCCCCCCCC---CHHHHHH
T ss_conf             666088799998---67889985175435874---0999999