HHsearch alignment for GI: 254780414 and conserved domain: COG0518

>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=419.54  Aligned_cols=191  Identities=39%  Similarity=0.701  Sum_probs=179.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC--CCCCCHHHHHCCCC--
Q ss_conf             8869999889705788998888659-406985289898899723997999985388999999--97537689808998--
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESK-VYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID--SPQIPKEILESNIP--   81 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelg-VyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~--ap~~~~~I~~~~iP--   81 (520)
T Consensus         1 ~~~ilIld~g~q~~~li~r~~re~g~v~~e~~~~~~~~~~~~~~~~~giIlsGgp~sv~~~~~w~~~~~~~i~~~~~p~~   80 (198)
T COG0518           1 MRKILILDFGGQYLGLIARRLRELGYVYSEIVPYTGDAEELPLDSPDGIIISGGPMSVYDEDPWLPREKDLIKDAGVPGK   80 (198)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             95799995797076799999987398269998578880115666888899858988776443330557899997188888


Q ss_pred             -EEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEEC-CCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCC
Q ss_conf             -89977899998997096999869866103667523-8862227872665533686002201101244421123239831
Q gi|254780414|r   82 -LLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTP  159 (520)
Q Consensus        82 -ILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~-~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~  159 (520)
T Consensus        81 pvLGIC~G~Ql~A~~lGg~V~~~~~~E~G~~~v~~~~~~~~l~~gl~~~~~--~v~~sH~D~v~~lP~g~~vlA~s~~cp  158 (198)
T COG0518          81 PVLGICLGHQLLAKALGGKVERGPKREIGWTPVELTEGDDPLFAGLPDLFT--TVFMSHGDTVVELPEGAVVLASSETCP  158 (198)
T ss_pred             CEEEECHHHHHHHHHHCCEEECCCCCCCCEEEEEEECCCCCCCCCCCCCCC--CCCCCHHCCCCCCCCCCEEEECCCCCH
T ss_conf             789987618999998498896468876515999972586500048854337--106613074434899989986589980


Q ss_pred             EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             788986350011246521222152025779987550106441
Q gi|254780414|r  160 FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQD  201 (520)
Q Consensus       160 iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~  201 (520)
T Consensus       159 ~qa~~~~-~~~~gvQFHpEv~~-~~~~~~l~nf~~~i~~~~~  198 (198)
T COG0518         159 NQAFRYG-KRAYGVQFHPEVTH-EYGEALLENFAHEICGEEP  198 (198)
T ss_pred             HHHEECC-CCEEEEEEEEEEEH-HHHHHHHHHHHHHHCCCCC
T ss_conf             4205667-85799942018738-9999999986566405698