HHsearch alignment for GI: 254780414 and conserved domain: COG0519

>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=1110.14  Aligned_cols=315  Identities=63%  Similarity=1.042  Sum_probs=311.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             11406789999999976504440366405640477999999862236569999738955156278999988623698579
Q gi|254780414|r  202 NWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       202 ~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
T Consensus         1 ~w~~~~~ie~~i~~ir~~vg~~kvi~alSGGVDSsv~a~L~~~AiGd~l~cvfVD~GLlR~~E~e~V~~~f~~~~~~nl~   80 (315)
T COG0519           1 MWTMENFIEEAIEEIREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQLTCVFVDHGLLRKGEAEQVVEMFREHLGLNLI   80 (315)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             98878989999999999728853999833878089999999997405248999637743478569999998753298459


Q ss_pred             EEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHH
Q ss_conf             97588999999668988899998875658999999997439970998646220245420246777630344302320113
Q gi|254780414|r  282 VVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE  361 (520)
Q Consensus       282 ~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~  361 (520)
T Consensus        81 ~VdA~~~Fl~~L~GvtDPE~KRKiIG~~Fi~VFe~ea~k~~-~~~LaQGTiYpDvIES~---~g~~~~IKSHHNVGGLP~  156 (315)
T COG0519          81 VVDAKDRFLSALKGVTDPEEKRKIIGREFIEVFEEEAKKLG-AEFLAQGTIYPDVIESG---TGKAGTIKSHHNVGGLPE  156 (315)
T ss_pred             EECHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCEEEEC---CCCCCCCCCCCCCCCCCC
T ss_conf             97549889988439998899899987999999999998578-60687044345046506---888886213562688950


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             20320223789873899999999819998894268889831112210003678999999999999999986465333220
Q gi|254780414|r  362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQ  441 (520)
Q Consensus       362 ~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q  441 (520)
T Consensus       157 ~m~lkLvEPLr~LfKDEVR~lg~~LGlp~~iv~RhPFPGPGLaiRilGevt~Ekl~ilR~Ad~I~~eEl~~agly~~~wQ  236 (315)
T COG0519         157 DMKLKLVEPLRELFKDEVRELGRELGLPEEIVYRHPFPGPGLAVRILGEVTREKLEILREADAIVEEELRKAGLYDKIWQ  236 (315)
T ss_pred             CCCEEEEHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             14222307789886899999999859988884048999998678962544799999998876999999986475201467


Q ss_pred             HHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             1045568632421599854144799963216877558710189899998755750487981257860894179766689
Q gi|254780414|r  442 AFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       442 ~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
T Consensus       237 aFavll~vksvGV~GD~RtY~~~valRaV~s~D~MTa~~~~lp~~~L~~is~RI~nEv~~V~RVvYDItsKPPaTIEwE  315 (315)
T COG0519         237 AFAVLLPVKSVGVMGDGRTYGYVVALRAVESIDGMTADWARLPYDVLEKISNRITNEVPGVNRVVYDITSKPPATIEWE  315 (315)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             7762015411112477755574489998842444314665388999999987763217886368854799899785579