HHsearch alignment for GI: 254780414 and conserved domain: KOG0026

>KOG0026 consensus.
Probab=99.93  E-value=2.1e-24  Score=194.56  Aligned_cols=194  Identities=24%  Similarity=0.415  Sum_probs=151.4

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHH-HHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH--HHCC
Q ss_conf             344886999988970578899888-8659406985289-89889972399799998538899999997537689--8089
Q gi|254780414|r    4 RERSSKVLIIDFGSQFTQLIARRV-RESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEI--LESN   79 (520)
Q Consensus         4 ~~~~~~IlIlDfGSQytqLIaRri-RelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I--~~~~   79 (520)
T Consensus        15 ~~~n~piv~IDNYDSFT~Nv~qYL~~e~g~~~~VyRNDeiTV~El~~~NP~~LliSPGPG~P~DsGI--s~~~i~~f~~~   92 (223)
T KOG0026          15 SKQNGPIIVIDNYDSFTYNLCQYLMGELGCHFEVYRNDELTVEELKRKNPRGLLISPGPGTPQDSGI--SLQTVLELGPL   92 (223)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHCCCCCEEECCCCCCCCCCCC--HHHHHHHHCCC
T ss_conf             6566878998455513489999863125871799846731178886259880785699989764542--48999985787


Q ss_pred             CCEEEECHHHHHHHHHCCCEEEECC-CCCCCEEE-EEECC--CCCCCCCCCCCCCCEEEEEECCCHH--HCCC-CCCCEE
Q ss_conf             9889977899998997096999869-86610366-75238--8622278726655336860022011--0124-442112
Q gi|254780414|r   80 IPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAF-IEIKK--NCSLLKGMWEKGSKQQVWMSHGDQV--EHIP-EGFEVI  152 (520)
Q Consensus        80 iPILGICyG~QlLa~~~GG~V~~~~-~~EyG~~~-I~i~~--~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP-~gf~vi  152 (520)
T Consensus        93 iP~fGvCMGlQCi~e~fGGkv~~a~~~i~HGK~S~i~~D~~~~~G~f~g~~---q~~~V~RYHSLa~~~sSlP~d~L~VT  169 (223)
T KOG0026          93 VPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSMVHYDEKGEEGLFSGLS---NPFIVGRYHSLVIEKDSFPSDELEVT  169 (223)
T ss_pred             CCEEEEEECHHHHHHHHCCEEECCCCCEEECCCCCCCCCCCCCCCCCCCCC---CCEEEEEEEEEEECCCCCCHHHEEEE
T ss_conf             855656400344456528576305752462453332237754332102799---87277765440001356871030456


Q ss_pred             ECCCCCCEEEEEECCCC-EEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             32398317889863500-112465212221520257799875501064411140
Q gi|254780414|r  153 ASSDSTPFAFIADEKRK-YYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVM  205 (520)
Q Consensus       153 A~S~~~~iaai~~~~~~-iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~  205 (520)
T Consensus       170 awTEnG~iMgaRHkKY~~ieGVQfHPESIlteeGk~~irNfl-ni~--~~tWeE  220 (223)
T KOG0026         170 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFI-KIV--EKKWSE  220 (223)
T ss_pred             EECCCCEEEEEECCCCEECCCEEECCHHHHHHHHHHHHHHHH-HHC--CCCCCC
T ss_conf             641385788741233100232232607764466589999998-753--361102