HHsearch alignment for GI: 254780414 and conserved domain: KOG1224

>KOG1224 consensus.
Probab=99.87  E-value=3.6e-21  Score=171.50  Aligned_cols=195  Identities=23%  Similarity=0.275  Sum_probs=141.6

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHH-CCCEEEEECCC-CCHH----HHHH-CCCCEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             8634488699998897057889988886-59406985289-8988----9972-39979999853889999999753768
Q gi|254780414|r    2 HKRERSSKVLIIDFGSQFTQLIARRVRE-SKVYCEVIAFK-NALD----YFKE-QNPQAIILSGSPASSLDIDSPQIPKE   74 (520)
Q Consensus         2 ~~~~~~~~IlIlDfGSQytqLIaRriRe-lgVyseI~P~~-~~~e----~i~~-~~p~GIILSGGP~SV~d~~ap~~~~~   74 (520)
T Consensus         9 k~~~~rl~~LlID~YDSyTfNiy~ll~~~~~vp~V~~vh~~~~~~d~~~~l~q~~~FDaIVVgPGPG~P~~a~d~gI~~r   88 (767)
T KOG1224           9 KKSLPRLRTLLIDNYDSYTFNIYQLLSTINGVPPVVIVHDEWTWEDAYHYLYQDVAFDAIVVGPGPGSPMCAADIGICLR   88 (767)
T ss_pred             HHHHHHEEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHH
T ss_conf             86631202888712454121399999874179967998343237789998864002244896689979874788789999


Q ss_pred             HHHC--CCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCC-CCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             9808--99889977899998997096999869866103667523886222787266-55336860022011012444211
Q gi|254780414|r   75 ILES--NIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK-GSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        75 I~~~--~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~-~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
T Consensus        89 l~~~~~~iPilGICLGfQal~l~hGA~v~~~n~p~HGrvs~i~~~~~~~f~gi~sg~~~~fK~~RYHSL~in~~pid~l~  168 (767)
T KOG1224          89 LLLECRDIPILGICLGFQALGLVHGAHVVHANEPVHGRVSGIEHDGNILFSGIPSGRNSDFKVVRYHSLIINSLPIDLLP  168 (767)
T ss_pred             HHHHCCCCCEEEEEHHHHHHHHHCCCCEECCCCCCCCEEEEEEECCCEEECCCCCCCCCCCEEEEEEEEEECCCCHHHHC
T ss_conf             99865788646543214767653166110378764324666772684787157778866440477677872577611212


Q ss_pred             -EECCC--CC-CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             -23239--83-178898635001124652122215202577998755010
Q gi|254780414|r  152 -IASSD--ST-PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       152 -iA~S~--~~-~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
T Consensus       169 il~t~~ddng~ilMsi~~~~fPhfG~qyHPES~~s~~g~~lfkNFl-~lt  217 (767)
T KOG1224         169 ILWTIYDDNGHILMSIMHSSFPHFGLQYHPESIASTYGSQLFKNFL-DLT  217 (767)
T ss_pred             CEEEEECCCCEEEEEEECCCCCCCCEEECHHHHHHHHHHHHHHHHH-HHH
T ss_conf             0137606886289875315788534233707753134579998777-763