HHsearch alignment for GI: 254780414 and conserved domain: PRK00074

>PRK00074 guaA GMP synthase; Reviewed.
Probab=100.00  E-value=0  Score=1750.15  Aligned_cols=512  Identities=59%  Similarity=1.006  Sum_probs=505.0

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEE
Q ss_conf             44886999988970578899888865940698528989889972399799998538899999997537689808998899
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLG   84 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILG   84 (520)
T Consensus         2 ~~~~~IlIlDFGSQytqLIaRRvRElgVysEI~p~~~~~~~i~~~~pkgIILSGGP~SV~~~~aP~~d~~if~l~IPILG   81 (513)
T PRK00074          2 IHHDKILILDFGSQYTQLIARRVRELGVYSEIVPYDISAEEIRAFNPKGIILSGGPASVYEEGAPRADPEIFELGVPVLG   81 (513)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEE
T ss_conf             87686999988964999999999823835999669999899850499789988999636899998899899826998699


Q ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEE
Q ss_conf             77899998997096999869866103667523886222787266553368600220110124442112323983178898
Q gi|254780414|r   85 ICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIA  164 (520)
Q Consensus        85 ICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~  164 (520)
T Consensus        82 ICYG~Qlia~~~GG~V~~s~~rEyG~a~l~i~~~s~Lf~gl---~~~~~VWMSHgD~V~~lP~gF~viA~s~n~~iAai~  158 (513)
T PRK00074         82 ICYGMQLMAHQLGGKVERAGKREYGRAELEVDGDSALFKGI---PEEQDVWMSHGDKVTELPEGFKVIASTENCPIAAIA  158 (513)
T ss_pred             ECHHHHHHHHHHCCEEEECCCCEECCEEEEEECCCCCCCCC---CCCCEEEEECCCCEEECCCCCEEEEECCCCCEEEEE
T ss_conf             75889999998599998569601121489991587333689---986368875243014379984799954997367898


Q ss_pred             ECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             63500112465212221520257799875501064411140678999999997650444036640564047799999986
Q gi|254780414|r  165 DEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE  244 (520)
Q Consensus       165 ~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~k  244 (520)
T Consensus       159 ~~~~~iyGvQFHPEV~HT~~G~~iL~NFl~~Ic~~~~~Wt~~~~i~~~i~~Ik~~Vg~~kVi~~lSGGVDStV~A~Ll~k  238 (513)
T PRK00074        159 NEERKFYGVQFHPEVTHTEQGKKLLENFVFDICGCKGDWTMENFIEEAIEEIREQVGDKKVILGLSGGVDSSVAAVLLHK  238 (513)
T ss_pred             ECCCCEEEEECCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             06786788702863453177579999999998788977637899999999999983876289972388308999999999


Q ss_pred             HCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             22365699997389551562789999886236985799758899999966898889999887565899999999743997
Q gi|254780414|r  245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGA  324 (520)
Q Consensus       245 Aig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~  324 (520)
T Consensus       239 AIGd~l~cvfVD~GllRknE~~~V~~~~~~~lgl~~~~vdA~~~Fl~~L~gv~DPE~KRKIIG~~FI~vfe~~a~~~~~~  318 (513)
T PRK00074        239 AIGDQLTCVFVDHGLLRKNEAEQVMEMFREHFGLNLIHVDASDRFLSALAGVTDPEEKRKIIGREFIEVFEEEAKKLGGV  318 (513)
T ss_pred             HHHHCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             85112489995377111672999999998861996799224899999737998979967887789999999999757998


Q ss_pred             EEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCE
Q ss_conf             09986462202454202467776303443023201132032022378987389999999981999889426888983111
Q gi|254780414|r  325 QFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLA  404 (520)
Q Consensus       325 ~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLa  404 (520)
T Consensus       319 ~~L~QGTlYPDvIES~~~-~~~a~~IKsHHNVgglp~~~~~~lvEPlr~lfKDEVR~lg~~Lglp~~~~~RhPFPGPGLa  397 (513)
T PRK00074        319 KFLAQGTLYPDVIESASG-TGKAATIKSHHNVGGLPEDMKLKLVEPLRELFKDEVRKLGLELGLPEEIVYRHPFPGPGLA  397 (513)
T ss_pred             CEEECCCCCCCEEEECCC-CCCCCCCCCCCCCCCCHHHCCCEEEEEHHHHCCHHHHHHHHHHCCCHHHHCCCCCCCCCHH
T ss_conf             399646765506884798-9998860487758788566487545031756158999999996897776024899997444


Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCC
Q ss_conf             22100036789999999999999999864653332201045568632421599854144799963216877558710189
Q gi|254780414|r  405 IRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD  484 (520)
Q Consensus       405 iRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~  484 (520)
T Consensus       398 iRi~Gevt~e~~~ilr~ad~I~~~~l~~~~ly~~i~Q~favllpvksvGV~Gd~R~y~~~~~lR~v~s~D~MTa~~~~~p  477 (513)
T PRK00074        398 IRILGEVTKEKLDILREADAIFIEELRKAGLYDKIWQAFAVLLPVRSVGVMGDGRTYDYVVALRAVTSIDGMTADWARLP  477 (513)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCEEEEECCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCC
T ss_conf             30334357889999998889999999875760105451079717632564899755577589997864776504754499


Q ss_pred