HHsearch alignment for GI: 254780414 and conserved domain: PRK05253

>PRK05253 sulfate adenylyltransferase subunit 2; Provisional.
Probab=96.31  E-value=0.026  Score=36.72  Aligned_cols=141  Identities=20%  Similarity=0.111  Sum_probs=82.1

Q ss_pred             HHHHHHHHHHHHHHHCC-CCEEEEECCCCHHHHHHHHHHHHCC--C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             67899999999765044-4036640564047799999986223--6-569999738955156278999988623698579
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGN-ERVICAVSGGVDSTVAAFLIYEAIG--I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~-~kVi~~lSGGVDStV~A~Ll~kAig--~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
T Consensus         9 ~~LEaesI~I~RE~~a~f~~pvmL~S~GKDS~VmLhLarKAF~p~~iPfPllHIDTg~k-F~Emi~fRD~~a~e~gl~Li   87 (300)
T PRK05253          9 DQLEAESIHIIREVAAEFENPVMLYSIGKDSSVMLHLARKAFYPGKLPFPLLHVDTGWK-FPEMIEFRDRRAKELGLELI   87 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCC-HHHHHHHHHHHHHHHCCCEE
T ss_conf             99998889999999997369679871672599999999998578899963488307998-18999999999998499789


Q ss_pred             EEEHHHHHHHHHCCCCCHHHHHHHHHHHHHH--HHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCC
Q ss_conf             9758899999966898889999887565899--9999997439970998646220245420246777630344302320
Q gi|254780414|r  282 VVDASERFIRKLKNIVDPETKRKVIGQLFIE--VFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG  358 (520)
Q Consensus       282 ~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~--vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgg  358 (520)
T Consensus        88 V~~n~e----~i~~g~~p~~~g~~~~~~~lKT~~L~~al~~-~~fda~~g-GaRRD--Ee~sR---AKERiFS~R~~~~  155 (300)
T PRK05253         88 VHSNPE----GIARGINPFTHGSAKHTNIMKTEGLKQALEK-YGFDAAFG-GARRD--EEKSR---AKERIFSFRDEFG  155 (300)
T ss_pred             EEECHH----HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH-CCCCEEEE-CCCCC--CCCCC---CCCCCCCCCCCCC
T ss_conf             975767----7756999566882223157878999999996-48765651-01234--43212---1254247756468