HHsearch alignment for GI: 254780414 and conserved domain: PRK08250

>PRK08250 glutamine amidotransferase; Provisional.
Probab=99.96  E-value=2e-28  Score=223.36  Aligned_cols=174  Identities=21%  Similarity=0.327  Sum_probs=132.3

Q ss_pred             EEEEEECCC-CHHHHHHHHHHHCCCEEEEE-CCCCC-HHHHHHCCCCEEEECCCCCCCCC--CCCCCCC--------HHH
Q ss_conf             699998897-05788998888659406985-28989-88997239979999853889999--9997537--------689
Q gi|254780414|r    9 KVLIIDFGS-QFTQLIARRVRESKVYCEVI-AFKNA-LDYFKEQNPQAIILSGSPASSLD--IDSPQIP--------KEI   75 (520)
Q Consensus         9 ~IlIlDfGS-QytqLIaRriRelgVyseI~-P~~~~-~e~i~~~~p~GIILSGGP~SV~d--~~ap~~~--------~~I   75 (520)
T Consensus         2 rilviqH~~~E~pG~i~~~l~~~G~~~~~~~~~~g~~lP~-~~~~~d~liVlGGpms~~~~~e~~p~l~l~~E~~lir~a   80 (235)
T PRK08250          2 RVHFIIHESFESPGAYLKWAEDRGYTISWSRVYAGEALPE-NADGFDMLIVLGGPQSPRTTREECPYFDSKAEQHLINQA   80 (235)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHCCCEEEEEECCCCCCCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             7999981899897078999997899699996689998999-810258899978998777732127874709999999999


Q ss_pred             HHCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECC---CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEE
Q ss_conf             808998899778999989970969998698661036675238---86222787266553368600220110124442112
Q gi|254780414|r   76 LESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVI  152 (520)
Q Consensus        76 ~~~~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~vi  152 (520)
T Consensus        81 ~~~~~PvlGIClG~QliA~AlGg~V~~~~~~EiG~~~i~~t~~~~~d~~~~~~---~~~~~v~~wH~d-~~~LP~gA~lL  156 (235)
T PRK08250         81 ITARKAVVGVCLGSQLIGEALGAKYCQSPEKEIGHFPITLTEAGLRDPLLKHF---GSTLTVGHWHND-MPGLTDQATVL  156 (235)
T ss_pred             HHCCCCEEEEEHHHHHHHHHCCCEEECCCCCEEEEEEEEEECCCCCCHHHHCC---CCCCEEEEEEEE-EEECCCCCEEE
T ss_conf             98699889981677999998098775489982448971630144458466528---987657898523-62069996799


Q ss_pred             ECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             32398317889863500112465212221520257799875
Q gi|254780414|r  153 ASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       153 A~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       157 Ass~~c~~Qaf~~g~-~~~g~QfHpE~t~-----~~v~~wi  191 (235)
T PRK08250        157 ATSEGCPRQIVQYGN-LVYGFQCHMEFTV-----EAVEGLI  191 (235)
T ss_pred             ECCCCCHHHHEEECC-CEEEEECCEECCH-----HHHHHHH
T ss_conf             739998489588269-5899971037899-----9999999