HHsearch alignment for GI: 254780414 and conserved domain: PRK13142

>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional.
Probab=99.77  E-value=5.1e-18  Score=149.02  Aligned_cols=166  Identities=22%  Similarity=0.375  Sum_probs=106.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHHH-CCCCEEE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-9999-999753768980-8998899
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEILE-SNIPLLG   84 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~~-~~iPILG   84 (520)
T Consensus         1 MI~IIDyG~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lILPGVGsF~~am~~L~~~~l~~~i~~~~~kpiLG   75 (192)
T PRK13142          1 MIVIVDYGLGNISNVKRAIEHLGYEVVVS---NTSKIID--QAETIILPGVGHFKDAMSEIKRLNLNAILAKNTDKKMIG   75 (192)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHCCCCEEE
T ss_conf             98999769458999999999859987996---8999984--379589757687899999988758599999862898589


Q ss_pred             ECHHHHHHHHH-----------CCCEEEECCC----CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCC
Q ss_conf             77899998997-----------0969998698----66103667523886222787266553368600220110124442
Q gi|254780414|r   85 ICYGQQIMCQS-----------LGGKTKNSQS----REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGF  149 (520)
Q Consensus        85 ICyG~QlLa~~-----------~GG~V~~~~~----~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf  149 (520)
T Consensus        76 ICLGMQlL~~~SeEg~~~GLgli~G~V~kl~~~~~vPhmGWn~v~~--~~~~~~--------~~fYFvHSY~~~---~~~  142 (192)
T PRK13142         76 ICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVS--KHPMLN--------QDVYFVHSYQAP---MSE  142 (192)
T ss_pred             EECCEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCCEECCHHHCC--CCCCCC--------CCEEEEEEEECC---CCC
T ss_conf             6501014311455567677577868999836899786658156253--385423--------644799876527---875


Q ss_pred             CEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             11232398-3178898635001124652122215202577998755
Q gi|254780414|r  150 EVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       150 ~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
T Consensus       143 ~~~a~t~yg~~f~s~v~-~~Ni~G~QFHPEKS-~~~Gl~lLknFl~  186 (192)
T PRK13142        143 NVIAYAQYGADIPAIVQ-FNNYIGIQFHPEKS-GTYGLQILRQAIQ  186 (192)
T ss_pred             CEEEEEECCCEEEEEEE-ECCEEEEECCHHHC-CHHHHHHHHHHHC
T ss_conf             78999988996999999-59999995881235-5858999999963