HHsearch alignment for GI: 254780414 and conserved domain: PRK13146

>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional.
Probab=99.94  E-value=9.3e-27  Score=211.46  Aligned_cols=177  Identities=23%  Similarity=0.391  Sum_probs=129.2

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CC-CCCCCCCCCHHH---HHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-99-999997537689---808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SS-LDIDSPQIPKEI---LESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV-~d~~ap~~~~~I---~~~~iP   81 (520)
T Consensus         2 ~kI~IiDyg~gNi~Sv~~al~~~~~~~~i~i~-~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~~~~~i~~~~~~~kp   78 (208)
T PRK13146          2 MSVAIIDYGSGNLRSAARALERAAPGADVTVT-ADPDAVR--AADRLVLPGVGAFADCMRGLRAVGGLREAVEEAAAGRP   78 (208)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHCCCCEEEEE-CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             88999937955899999999985799739996-9999984--28878983889779999987640768999999983998


Q ss_pred             EEEECHHHHHHHHH------------CCCEEEECCC-------CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH
Q ss_conf             89977899998997------------0969998698-------6610366752388622278726655336860022011
Q gi|254780414|r   82 LLGICYGQQIMCQS------------LGGKTKNSQS-------REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV  142 (520)
Q Consensus        82 ILGICyG~QlLa~~------------~GG~V~~~~~-------~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V  142 (520)
T Consensus        79 iLGICLGmQlL~~~s~E~g~~~GLgli~G~V~kl~~~~~~~kiPhiGWn~i~~~~~~~l~~~i~~---~~~fYFvHSY~~  155 (208)
T PRK13146         79 FLGICVGMQLLFERGEEHGDTPGLGWIPGDVVRLQPDGPALKVPHMGWNTVDQPRDHPLFDGIPD---GARFYFVHSYAA  155 (208)
T ss_pred             EEEEEEEEEEEECCCEECCCCCCCEEECCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCCC---CCEEEEEEEEEE
T ss_conf             79888546412112400686570118741899998788666574425277885689820047887---887999731375


Q ss_pred             HCCCCCCCEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             012444211232398-317889863500112465212221520257799875
Q gi|254780414|r  143 EHIPEGFEVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       143 ~~lP~gf~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       156 ~~-~~~~~~~a~t~yg~~~~a~v~-~~ni~G~QFHPEKS~-~~Gl~llknFl  204 (208)
T PRK13146        156 AP-ANPADVLAWTDYGGPFTAAVA-RGNLFATQFHPEKSG-DAGLRLLRNFL  204 (208)
T ss_pred             EC-CCCHHEEEEEECCCEEEEEEE-CCCEEEEECCCCCCC-HHHHHHHHHHH
T ss_conf             31-882100899638987999998-399999989930056-83899999986