HHsearch alignment for GI: 254780414 and conserved domain: PRK13151

>PRK13151 consensus.
Probab=99.85  E-value=2e-20  Score=166.13  Aligned_cols=172  Identities=24%  Similarity=0.400  Sum_probs=117.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHHHCCCCEEEE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-9999-99975376898089988997
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~~~~iPILGI   85 (520)
T Consensus         2 kI~IiDyg~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~l~~~i~~~~kpiLGI   76 (195)
T PRK13151          2 KIIIIDTACANLASLKFCLDRLGFNATIS---RDLKELE--SADKLFLPGVGTAKEAMKNLEQFNLIDFIQNTKKPLLGI   76 (195)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHCCCCEEEE
T ss_conf             89999479609999999999859987996---7999994--489699888899999999998747788898639966887


Q ss_pred             CHHHHHHHHH-----------CCCEEEECCC------CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCC
Q ss_conf             7899998997-----------0969998698------6610366752388622278726655336860022011012444
Q gi|254780414|r   86 CYGQQIMCQS-----------LGGKTKNSQS------REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEG  148 (520)
Q Consensus        86 CyG~QlLa~~-----------~GG~V~~~~~------~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~g  148 (520)
T Consensus        77 CLGMQlL~~~seE~~~~gLgli~g~v~k~~~~~~~~vPhiGWn~v~--~~~~l~~~i~-~~---~fYFvHSY~~~--~~~  148 (195)
T PRK13151         77 CLGMQILGNFSEELNQETLKLIDFTTQKFKAKEGFTFPHMGWNQVH--SSHALFKGLE-GA---YFYFVHSYCVG--LGE  148 (195)
T ss_pred             EEEEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCCCCEEEHHHCC--CCCHHHCCCC-CC---EEEEEEEEECC--CCC
T ss_conf             7647876514757675762642026888646557888674112256--6770121666-76---27887304526--765


Q ss_pred             CCEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             211232398-317889863500112465212221520257799875501
Q gi|254780414|r  149 FEVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       149 f~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
T Consensus       149 ~-~ia~~~y~~~f~a~v~-k~Ni~G~QFHPEKS-~~~Gl~lL~nFlk~i  194 (195)
T PRK13151        149 Y-TIADCEYSQKFSASVM-KDNFYGVQFHPERS-SEAGEILISNFIKDI  194 (195)
T ss_pred             C-EEEEEECCCEEEEEEE-ECCEEEEECCCHHC-CHHHHHHHHHHHHHC
T ss_conf             6-3789737988999999-19999992880030-587999999998752