HHsearch alignment for GI: 254780414 and conserved domain: PRK13173

>PRK13173 consensus.
Probab=99.87  E-value=1.1e-20  Score=168.01  Aligned_cols=173  Identities=25%  Similarity=0.386  Sum_probs=117.0

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHH--HCCCCE
Q ss_conf             869999889705788998888659406985289898899723997999985-388-9999-99975376898--089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEIL--ESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~--~~~iPI   82 (520)
T Consensus         2 ~kI~IiDyg~gNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lILPGVGsF~~~m~~L~~~~l~~~i~~~~~~kpi   76 (211)
T PRK13173          2 TKIALLDYGMGNLHSASKALSAVGAEVSIT---NDPKVIA--AADKIVFPGVGAMRDCMAGMHEAGIDEVVRQAIFNKPV   76 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHCCCCE
T ss_conf             879999689449999999999869988996---7999984--38968975778689999998862979999988629998


Q ss_pred             EEECHHHHHHHHH---------CC---CEEEECC------------CCCCCEEEEEEC-CCCCCCCCCCCCCCCEEEEEE
Q ss_conf             9977899998997---------09---6999869------------866103667523-886222787266553368600
Q gi|254780414|r   83 LGICYGQQIMCQS---------LG---GKTKNSQ------------SREFGRAFIEIK-KNCSLLKGMWEKGSKQQVWMS  137 (520)
Q Consensus        83 LGICyG~QlLa~~---------~G---G~V~~~~------------~~EyG~~~I~i~-~~~~lf~gl~~~~~~~~VwmS  137 (520)
T Consensus        77 LGICLGMQlLf~~s~E~g~~~GLgli~G~V~~l~~~~~~~~~~~~kvPhiGWn~v~~~~~~~~l~~~i~~~~~---fYFv  153 (211)
T PRK13173         77 MAICVGMQALFEQSAENGGTPCLSILDGTVKAFDPSWKDPKGVQIKVPHMGWNTISGMDFEHPLWNGIDDKAH---FYFV  153 (211)
T ss_pred             EEEEHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHCCCCCCCE---EEEE
T ss_conf             9981888985068988999671306600698767444675555434660003454335765364449987860---7998


Q ss_pred             CCCHHHCCCCC-CCEEECCCC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             22011012444-211232398--317889863500112465212221520257799875
Q gi|254780414|r  138 HGDQVEHIPEG-FEVIASSDS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       138 H~D~V~~lP~g-f~viA~S~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       154 HSY~~~--~~~~~~~~~~~~yg~~f~a~v~--k~Ni~G~QFHPEKS~-~~Gl~lLknFl  207 (211)
T PRK13173        154 HSYYCE--PADSSQVAAICDYGQPFCASIL--KDNLFATQFHPEKSH-TAGLQLLKNFV  207 (211)
T ss_pred             EEEEEE--CCCCCEEEEEEECCCEEEEEEE--ECCEEEEECCHHHCC-HHHHHHHHHHH
T ss_conf             667870--3782507899838988999999--699999908801245-86899999997