HHsearch alignment for GI: 254780414 and conserved domain: PRK13181

>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional.
Probab=100.00  E-value=5.4e-37  Score=284.60  Aligned_cols=175  Identities=28%  Similarity=0.476  Sum_probs=135.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-----CCCCCCCCCCCHHHHHCCCCE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-----999999975376898089988
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-----SSLDIDSPQIPKEILESNIPL   82 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-----SV~d~~ap~~~~~I~~~~iPI   82 (520)
T Consensus         1 mI~IiD~G~~n~~si~r~l~~lg~~~~i~~---~~~~l~--~~d~lIlPGvG~~~~~~~~l~~~~~~~~i~~~~~~~~Pi   75 (199)
T PRK13181          1 MIAIIDYGAGNLRSVANALKRLGVEAVVSS---DPEEIE--GADKVILPGVGAFGQAMAALRESGLDEAIKEHVEKKQPV   75 (199)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEC---CHHHHH--HHHCEECCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCE
T ss_conf             999998896099999999998698099979---999974--211004579865330256665638679999999769988


Q ss_pred             EEECHHHHHHHHH-----------CCCEEEECCCC-----CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCC
Q ss_conf             9977899998997-----------09699986986-----6103667523886222787266553368600220110124
Q gi|254780414|r   83 LGICYGQQIMCQS-----------LGGKTKNSQSR-----EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIP  146 (520)
Q Consensus        83 LGICyG~QlLa~~-----------~GG~V~~~~~~-----EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP  146 (520)
T Consensus        76 LGIClGmQlL~~~~~eg~~~GLgl~~g~v~~~~~~~~~~phiGw~~i~~~~~~~lf~~~~---~~~~~yf~Hs~~v~~~~  152 (199)
T PRK13181         76 LGICLGMQLLCESSEEGNVKGLGLIPGDVKRFRSGKDKVPQMGWNSVKPLKESPLFKGIE---ENSRFYFVHSYYVPPED  152 (199)
T ss_pred             EEEEEEEEEEEECCCCCCCCCCCEECCEEEECCCCCCCCCCCCCEEEEEECCCHHHCCCC---CCCEEEEEEEEEEECCC
T ss_conf             998042676541000365466666212899827765555777745887621684453765---55604888503786178


Q ss_pred             CCCCEEECCCCC-CE-EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             442112323983-17-889863500112465212221520257799875501
Q gi|254780414|r  147 EGFEVIASSDST-PF-AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       147 ~gf~viA~S~~~-~i-aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
T Consensus       153 ~~-~~~a~~~~g~~~~~~v~--~~ni~GvQFHPE~s~-~~G~~il~nFl-~i  199 (199)
T PRK13181        153 PE-DVLATTNYGVPFCSAVE--KDNIYAVQFHPEKSG-KAGLKLLKNFA-EL  199 (199)
T ss_pred             CC-CEEEEECCCCEEEEEEE--CCCEEEEECCCCCCC-HHHHHHHHHHH-CC
T ss_conf             76-32799638984999998--999999908978178-60999999986-69