HHsearch alignment for GI: 254780414 and conserved domain: PRK13981

>PRK13981 NAD synthetase; Provisional.
Probab=98.95  E-value=1.7e-08  Score=80.97  Aligned_cols=161  Identities=19%  Similarity=0.251  Sum_probs=93.1

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH---HHHHHHH
Q ss_conf             650444036640564047799999986223-656999973895515627899998862369857997588---9999996
Q gi|254780414|r  218 EQVGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS---ERFIRKL  293 (520)
Q Consensus       218 ~~vg~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~---~~Fl~~L  293 (520)
T Consensus       277 ~k~gf~~vviGLSGGiDSaL~aaiA~dALG~~nV~~v~MPs~~-tS~~s~~dA~~La~~LGi~~~~i~I~~~~~~~~~~l  355 (543)
T PRK13981        277 RKNGFPGVVLGLSGGIDSALVAAIAVDALGAENVRAVMMPSRY-TSDESLDDAAALARNLGVRYDIIPIEPAFEAFEAAL  355 (543)
T ss_pred             HHHCCCEEEEECCCCHHHHHHHHHHHHHHCHHHEEEEECCCCC-CCHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHH
T ss_conf             8608974999767883599999999985383437886458777-866569999999999599748751499999999974


Q ss_pred             CCCCCHHHHHHHHHHHHHH------HHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCH
Q ss_conf             6898889999887565899------9999997439970998646220245420246777630344302320113203202
Q gi|254780414|r  294 KNIVDPETKRKVIGQLFIE------VFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL  367 (520)
Q Consensus       294 ~gv~DPE~KRkiIG~~Fi~------vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~l  367 (520)
T Consensus       356 ~~~f~~~~~--dvt~ENiQAR~R~~iLm~laN~~---g~lvl~T--gnkSE~avGy----~T---------lyGD~~g-~  414 (543)
T PRK13981        356 APLFAGTEP--DITEENLQSRIRGTLLMALSNKF---GSLVLTT--GNKSEMAVGY----AT---------LYGDMAG-G  414 (543)
T ss_pred             HHHHCCCCC--CCCHHHHHHHHHHHHHHHHHHCC---CCEEECC--CCHHHHHHCH----HH---------HCCCCCC-C
T ss_conf             044168766--65223454888999999987338---9679647--8672787474----65---------3376556-7


Q ss_pred             HHHHHHHHHHHHHHHHHHHC-----------CCHHHHCCCCCCC
Q ss_conf             23789873899999999819-----------9988942688898
Q gi|254780414|r  368 VEPLKELFKDEVRLLGKELR-----------LPDSFVERHPCPG  400 (520)
Q Consensus       368 iEPl~~l~KdEVR~lg~~Lg-----------lp~~~~~RhPFPG  400 (520)
T Consensus       415 ~avi~dv~KT~V~~L~r~~n~~~~~~~~~~vip~~ii~k~pSaE  458 (543)
T PRK13981        415 FAPIKDVYKTLVYRLCRWRNTNHPGGPDGEVIPERIITKPPSAE  458 (543)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCC
T ss_conf             43036865999999999986536456666756187668898977