HHsearch alignment for GI: 254780414 and conserved domain: TIGR00364

>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome. In Sinorhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA , . In Arthrobacter viscosus, the homologous gene is designated alu1 and is associated with an aluminum tolerance phenotype. When expressed in Escherichia coli, it conferred aliminium tolerance . The entry also contains the gene queC, which is responsible for the conversion of GTP to 7-cyano-7-deazaguanine (preQ0). The biosynthesis of hypermodified tRNA nucleoside queuosine only occurs in eubacteria. It occupies the wobble position for all known tRNAs that are specific for Asp, Asn, His or Tyr ..
Probab=96.28  E-value=0.0077  Score=40.52  Aligned_cols=160  Identities=22%  Similarity=0.257  Sum_probs=101.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCC-CCCCHHHHHHHHHHCCCCCEE-EEEHH---HHHH-HHHCCCC
Q ss_conf             36640564047799999986223-6569999738955-156278999988623698579-97588---9999-9966898
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFM-RKNEVENIISLFKGYPNFPLR-VVDAS---ERFI-RKLKNIV  297 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~Gll-RknE~~~v~~~~~~~~~~~l~-~vda~---~~Fl-~~L~gv~  297 (520)
T Consensus         1 Av~~lSGG~DStT~~~~a~~~~GkyeV~a~TF~YGQR~H~~Ele~A~~-ia~~Lgi~~~~~~Dl~~l~~l~~YsaLt~~~   79 (227)
T TIGR00364         1 AVVVLSGGQDSTTVLLIALDEGGKYEVHAITFDYGQRAHSRELESARK-IAEALGIRHHFVIDLSLLKQLGKYSALTDEQ   79 (227)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH-HHHHHCCCCEEEECHHHHHHHHCCCCCCCCC
T ss_conf             968743734689999999961795079985465013789999999999-9998089707861779998554045235787


Q ss_pred             -CH-----H----HHHHHHHHHHH----HHHH----HHHHHCCC-----CEEEEECCCCCHHHHHHCCCCCCCCEEEEEE
Q ss_conf             -88-----9----99988756589----9999----99974399-----7099864622024542024677763034430
Q gi|254780414|r  298 -DP-----E----TKRKVIGQLFI----EVFE----EEAKKIGG-----AQFLGQGTLYPDVIESISFFGGPSSIIKSHH  354 (520)
Q Consensus       298 -DP-----E----~KRkiIG~~Fi----~vf~----~~a~~~~~-----~~~L~QGTlypDvIES~~~~~~~~~~IKsHH  354 (520)
T Consensus        80 ~~~~~~~~e~d~~~~~E~~p~tfVPgRN~~fl~~a~~yA~~~gA~~v~~G~~~~DfSgYPDCr~E---------Fvka~n  150 (227)
T TIGR00364        80 EIPEQKSNEEDKEKALETLPNTFVPGRNLIFLSLAASYAEALGAEAVITGVCETDFSGYPDCRDE---------FVKALN  150 (227)
T ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCCCCCCCCHH---------HHHHHH
T ss_conf             56766665320235653113333780479999999998886184252200100036579888688---------999999


Q ss_pred             CCCCHH-HHHCCCH-----HHHHHHHHHHHHHHHHHHHC-----CCHHHHC
Q ss_conf             232011-3203202-----23789873899999999819-----9988942
Q gi|254780414|r  355 NVGGLP-EHMDMKL-----VEPLKELFKDEVRLLGKELR-----LPDSFVE  394 (520)
Q Consensus       355 Nvgglp-~~~~~~l-----iEPl~~l~KdEVR~lg~~Lg-----lp~~~~~  394 (520)
T Consensus       151 ~~l~Lgn~~~~v~i~Piql~aPL~~ltKaeiv~la~elGkk~l~lv~~~T~  201 (227)
T TIGR00364       151 HALNLGNMLTPVEIRPIQLEAPLMDLTKAEIVKLADELGKKLLDLVIKETY  201 (227)
T ss_pred             HHHHHHCCCCCCEEEEEEEECCEEECCHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             999974126881120246666701269899999988735112311000111