HHsearch alignment for GI: 254780414 and conserved domain: TIGR00420

>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2.1.1.61 from EC) catalyses the addition of 5-methylaminomethyl-2-thiouridylate to tRNAs using S-adenosyl-L-methionine as a substrate and releasing S-adenosyl-L-homocysteine. The enzyme is cytoplasmic and is involved in tRNA processing.; GO: 0004808 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=99.47  E-value=4.3e-13  Score=113.78  Aligned_cols=162  Identities=28%  Similarity=0.409  Sum_probs=114.2

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC----------CCH-------HHHH--HHHHHCCCCCEEEE
Q ss_conf             4036640564047799999986223656999973895515----------627-------8999--98862369857997
Q gi|254780414|r  223 ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRK----------NEV-------ENII--SLFKGYPNFPLRVV  283 (520)
Q Consensus       223 ~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRk----------nE~-------~~v~--~~~~~~~~~~l~~v  283 (520)
T Consensus         1 ~kv~VglSGGVDSSVsA~lL~~q-g~~v~G~ylk~W~~~~~~d~~GH~~~N~~K~~C~~~~dl~~a~~ic~~LGi~l~~~   79 (394)
T TIGR00420         1 KKVIVGLSGGVDSSVSAYLLKQQ-GYEVVGVYLKNWDEDEKNDILGHKKINENKSGCSSAEDLRDAQAICEKLGIPLEKV   79 (394)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEEEEEEECCCCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             94899806854789999999714-96589998776512466664431656246778836887999999998559818985


Q ss_pred             EHHHHHHHH---------HCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCC--CCEEEEECCCCCH---HHHHHCC--CC
Q ss_conf             588999999---------66898-8899998875658999--999997439--9709986462202---4542024--67
Q gi|254780414|r  284 DASERFIRK---------LKNIV-DPETKRKVIGQLFIEV--FEEEAKKIG--GAQFLGQGTLYPD---VIESISF--FG  344 (520)
Q Consensus       284 da~~~Fl~~---------L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~--~~~~L~QGTlypD---vIES~~~--~~  344 (520)
T Consensus        80 nf~~~Y~~~Vf~~~i~~y~~G~TPnPD----i~CN~~iKFG~~~e~~~~~~Gtg~~~~aTGH-YAr~~q~~~~~~~~~L~  154 (394)
T TIGR00420        80 NFQKEYWNKVFEPFIQEYKEGLTPNPD----ILCNKLIKFGLLLEYAKQLLGTGNDKIATGH-YARIAQEIENKSLFELL  154 (394)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCC----CCCCCCCCHHHHHHHHHHHCCCCCCEEECCH-HHHHHHHHCCCCHHHHH
T ss_conf             507887888889999987367777862----0047120037899999985289954344244-76544342131014443


Q ss_pred             CCCCEEEEEECC-CCH-HHHHCCCHHHHHHHHHHHHHHHHHHHHC--CCHH
Q ss_conf             776303443023-201-1320320223789873899999999819--9988
Q gi|254780414|r  345 GPSSIIKSHHNV-GGL-PEHMDMKLVEPLKELFKDEVRLLGKELR--LPDS  391 (520)
Q Consensus       345 ~~~~~IKsHHNv-ggl-p~~~~~~liEPl~~l~KdEVR~lg~~Lg--lp~~  391 (520)
T Consensus       155 ~~~D~~KDQSYFL~~l~~~~~~-~~~FPlG~L~K~~vR~iA~~~~PfL~ta  204 (394)
T TIGR00420       155 RALDKNKDQSYFLYHLSQEQLA-KLLFPLGELLKPEVRQIAKNAGPFLSTA  204 (394)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHH-HHCCCCCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             0467888611737640189888-7505301036778999998648632344