HHsearch alignment for GI: 254780414 and conserved domain: TIGR00566

>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221 This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase. In at least one case, a single polypeptide from Bacillus subtilis was shown to have both functions. ; GO: 0004049 anthranilate synthase activity, 0008152 metabolic process.
Probab=99.96  E-value=2.5e-28  Score=222.62  Aligned_cols=186  Identities=26%  Similarity=0.387  Sum_probs=146.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCC-----CEEE-EECCC-CCHHHHHHCCC-----CEEEECCCCCCCCCCCCC-CCCHHH
Q ss_conf             69999889705788998888659-----4069-85289-89889972399-----799998538899999997-537689
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESK-----VYCE-VIAFK-NALDYFKEQNP-----QAIILSGSPASSLDIDSP-QIPKEI   75 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelg-----Vyse-I~P~~-~~~e~i~~~~p-----~GIILSGGP~SV~d~~ap-~~~~~I   75 (520)
T Consensus         1 ~vL~IDnYDSFTYNlv~~~~~~gdisPGv~~V~Vkrnd~~~~~~ie~L~P~~~lfdaivisPGPC~P~eAa~~~Gii~~~   80 (212)
T TIGR00566         1 MVLLIDNYDSFTYNLVQYFEELGDISPGVAEVVVKRNDSLTLQEIEALLPLLPLFDAIVISPGPCTPNEAAISMGIILEA   80 (212)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHCCCCCCCCEEEECCCCCCCCHHHCCHHHHHHH
T ss_conf             92456567423789999864217767361057772067310345876311356334567658656832122041179999


Q ss_pred             H---HCCC---CEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCC--CCCCEEEEEECCCHH--HCC
Q ss_conf             8---0899---88997789999899709699986986610366752388622278726--655336860022011--012
Q gi|254780414|r   76 L---ESNI---PLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE--KGSKQQVWMSHGDQV--EHI  145 (520)
Q Consensus        76 ~---~~~i---PILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~--~~~~~~VwmSH~D~V--~~l  145 (520)
T Consensus        81 i~h~aGkldevPILGvCLG~QA~~qA~Gg~V~~a~~~~HGk~s~i~hng~~~f~GL~~GyPP~~L~~TRYHSL~V~p~~l  160 (212)
T TIGR00566        81 IRHFAGKLDEVPILGVCLGHQALAQAFGGDVVRANTVMHGKTSEIEHNGAGIFRGLFNGYPPDTLTATRYHSLVVEPETL  160 (212)
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCEEECCCEEECCCCCCCCCCCCCCCCEEEEEECCCCC
T ss_conf             87423762267602010556878874287225421136873001247771012465577686644357505566744577


Q ss_pred             CCCCCEEECCCCC--CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             4442112323983--178898635001124652122215202577998755
Q gi|254780414|r  146 PEGFEVIASSDST--PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       146 P~gf~viA~S~~~--~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
T Consensus       161 ~~~~~~~~~~~~~G~eiM~irh~~~p~eGVQFHPESilSe~G~~ll~Nfl~  211 (212)
T TIGR00566       161 PTCFQVTALEEENGIEIMAIRHRDLPLEGVQFHPESILSELGHQLLANFLH  211 (212)
T ss_pred             CCCCCEEEEECCCCCEEEHHHHCCCCCCCEEECCHHHHHHHHHHHHHHHHC
T ss_conf             622010100016870131013347850220107135534227899998723