HHsearch alignment for GI: 254780414 and conserved domain: TIGR01855

>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139 Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis. IGPS consists of two different subunits: HisH, a glutamine amidotransferase (glutaminase), and HisF, a synthase (cyclase). HisH functions to provide a source of nitrogen, which is required for the synthesis of histidine and purines. In the HisH glutaminase reaction, the hydrolysis of glutamine yields ammonia, which is then used by HisF in the subsequent synthase reaction. The X-ray structure of the HisH/HisF heterodimer of IGPS reveals a putative tunnel for the transfer of ammonia from HisH to HisF via a (beta-alpha)8 barrel fold within HisF that abuts HisH . Ammonia tunnels connect the glutaminase and synthase active sites. HisH belongs to a large group of enzymes found in diverse and fundamental anabolic pathways. These enzymes share a common domain, referred to as the type-I glutamine amidotransferase (GATase) domain, which can occur either as single polypeptides (as with HisH) or as domains of large multifunctional proteins.; GO: 0016763 transferase activity transferring pentosyl groups, 0000105 histidine biosynthetic process, 0005737 cytoplasm.
Probab=99.87  E-value=2.1e-21  Score=173.23  Aligned_cols=173  Identities=24%  Similarity=0.367  Sum_probs=126.9

Q ss_pred             EEEEECCCCHHHH----HHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-C----CCCCCCCCCHHHHHCC
Q ss_conf             9999889705788----998888659406985289898899723997999985-3889-9----9999975376898089
Q gi|254780414|r   10 VLIIDFGSQFTQL----IARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-S----LDIDSPQIPKEILESN   79 (520)
Q Consensus        10 IlIlDfGSQytqL----IaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V----~d~~ap~~~~~I~~~~   79 (520)
T Consensus         1 i~viDYG~GNL~SlyrGV~~Al~~~G~~~~v~~~~--y~~~~--~aD~l~LPGVG~F~~aM~~l~~~~~~~~~~~~~~~~   76 (211)
T TIGR01855         1 IVVIDYGVGNLRSLYRGVKRALKRVGAEPVVVKDS--YKELE--KADKLILPGVGAFKAAMARLRELGLLDLLELVVKKK   76 (211)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHCCCEEEEECCC--CHHHH--CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             97874371656889999999998449817996286--03431--068678578588899999988500587889999618


Q ss_pred             CCEEEECHHHHHHHHH-------------CCCEEEEC---------CCCCCCEEEEEECCCC-CCCCCCCCCCCCEEEEE
Q ss_conf             9889977899998997-------------09699986---------9866103667523886-22278726655336860
Q gi|254780414|r   80 IPLLGICYGQQIMCQS-------------LGGKTKNS---------QSREFGRAFIEIKKNC-SLLKGMWEKGSKQQVWM  136 (520)
Q Consensus        80 iPILGICyG~QlLa~~-------------~GG~V~~~---------~~~EyG~~~I~i~~~~-~lf~gl~~~~~~~~Vwm  136 (520)
T Consensus        77 ~P~lGiCLGMQLLfe~SeE~g~~~~GLG~i~G~V~k~~~~~~~~~lk~PHmGWN~v~~~~~~C~ll~g~~~~~~~YFV--  154 (211)
T TIGR01855        77 KPVLGICLGMQLLFERSEEGGGEVPGLGLIKGKVVKLEARVSLSKLKVPHMGWNEVEPVKESCPLLKGIDKGAYFYFV--  154 (211)
T ss_pred             CCEEEEEHHHHHHHCCCCCCCCCCCCCEECCCEEEEECCCCCCCCCCCCCCCCCEEEEHHHCCCHHCCCCCCCCEEEE--
T ss_conf             968999802343001562437886653112761342056778872545756564231231155113077667815568--


Q ss_pred             ECCCHHHCCCCC-CCEEECCCCC-C-EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             022011012444-2112323983-1-7889863500112465212221520257799875
Q gi|254780414|r  137 SHGDQVEHIPEG-FEVIASSDST-P-FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       137 SH~D~V~~lP~g-f~viA~S~~~-~-iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       155 -HSY~~~-~~~~S~~v~a~~~YG~~F~AaV~--~~n~~G~QFHPEKS~-~~G~~lL~nf~  209 (211)
T TIGR01855       155 -HSYYAV-CEEESEAVLAKADYGEKFTAAVQ--KDNIFGTQFHPEKSG-KTGLKLLKNFL  209 (211)
T ss_pred             -EEEEEE-CCCCHHHEEEEHHCCCCEEEEEE--CCCEEEEEECCHHHH-HHHHHHHHHHH
T ss_conf             -866776-16881150112001863044665--487899972856888-89999999985