HHsearch alignment for GI: 254780414 and conserved domain: TIGR01857

>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP..
Probab=96.41  E-value=0.038  Score=35.61  Aligned_cols=179  Identities=24%  Similarity=0.396  Sum_probs=103.9

Q ss_pred             CCCCCEEEEEECC---CCHHHHHHHHHHHCCCEEEEECCCC-C-------HHHHH-HC-CCCEEEECCCCCCCCCC--CC
Q ss_conf             3448869999889---7057889988886594069852898-9-------88997-23-99799998538899999--99
Q gi|254780414|r    4 RERSSKVLIIDFG---SQFTQLIARRVRESKVYCEVIAFKN-A-------LDYFK-EQ-NPQAIILSGSPASSLDI--DS   68 (520)
Q Consensus         4 ~~~~~~IlIlDfG---SQytqLIaRriRelgVyseI~P~~~-~-------~e~i~-~~-~p~GIILSGGP~SV~d~--~a   68 (520)
T Consensus      1013 ~v~KP~VvIpvFPGtNsEYD--~~~aFe~~GAev~~~~~~nL~~~a~~~Sv~~l~~~i~ksqI~~lpGG-FSAgDEPDGS 1089 (1279)
T TIGR01857      1013 KVEKPRVVIPVFPGTNSEYD--SAKAFEKEGAEVKLVILRNLTEEALVESVEELVDEIDKSQILMLPGG-FSAGDEPDGS 1089 (1279)
T ss_pred             EEECCEEEEECCCCCCCHHH--HHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCC
T ss_conf             54078679813588984888--88898545895899600038888999999999874046408995587-8777788852


Q ss_pred             ----------CCCCHH---HHH-CCCCEEEECHHHHHHHHHCC----CEEEE----CCCCCC---CEE-----EEEE-CC
Q ss_conf             ----------753768---980-89988997789999899709----69998----698661---036-----6752-38
Q gi|254780414|r   69 ----------PQIPKE---ILE-SNIPLLGICYGQQIMCQSLG----GKTKN----SQSREF---GRA-----FIEI-KK  117 (520)
Q Consensus        69 ----------p~~~~~---I~~-~~iPILGICyG~QlLa~~~G----G~V~~----~~~~Ey---G~~-----~I~i-~~  117 (520)
T Consensus      1090 AKFi~~~l~npkv~~~v~~lL~~RDGLiLGiCNGFQALvK~-GLlPYG~i~~~~~~~pTLtyN~inrH~s~~V~Tki~~~ 1168 (1279)
T TIGR01857      1090 AKFIAAILRNPKVKEAVKKLLKERDGLILGICNGFQALVKL-GLLPYGEIVDVEEDSPTLTYNKINRHVSKIVRTKIASK 1168 (1279)
T ss_pred             HHHHHHHHHCHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHH-CCCCCCCEEECCCCCCCCCCCCHHHHHEEEEEEEECCC
T ss_conf             89999976081479999999960798498620056788882-47888642400457863120201012010123565047


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCC-------HH-HCCCCC---------CCE-----EECCCCCC---EEEEEECCCCEEE
Q ss_conf             86222787266553368600220-------11-012444---------211-----23239831---7889863500112
Q gi|254780414|r  118 NCSLLKGMWEKGSKQQVWMSHGD-------QV-EHIPEG---------FEV-----IASSDSTP---FAFIADEKRKYYA  172 (520)
Q Consensus       118 ~~~lf~gl~~~~~~~~VwmSH~D-------~V-~~lP~g---------f~v-----iA~S~~~~---iaai~~~~~~iyG  172 (520)
T Consensus      1169 ~SPWL~~~-~vGdih~ipvSHGEGrFva~~~~l~~L~~NGQIatQYVD~~G~~~m~~~yNPNGS~~AIEGI~S~dG~i~G 1247 (1279)
T TIGR01857      1169 NSPWLSEV-SVGDIHAIPVSHGEGRFVASDEVLKELRENGQIATQYVDFEGKPAMDLKYNPNGSSLAIEGIISPDGRIFG 1247 (1279)
T ss_pred             CCCCCCCE-EECCEEEEEEECCCCCEECCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCEECCCCEEEE
T ss_conf             78840210-32427753344489832307789989863796378987267863578866978530246344568972752


Q ss_pred             EEEEEHHHCCCHHHHHHHH
Q ss_conf             4652122215202577998
Q gi|254780414|r  173 VQFHPEVVHTVGGSQLIDN  191 (520)
Q Consensus       173 VQFHPEV~hT~~G~~iL~N  191 (520)
T Consensus      1248 KMGHSE----R~~~~lf~N 1262 (1279)
T TIGR01857      1248 KMGHSE----RYGDGLFKN 1262 (1279)
T ss_pred             ECCCEE----ECCCCCEEC
T ss_conf             045202----447885460