HHsearch alignment for GI: 254780414 and conserved domain: TIGR03104

>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase. Members of this protein family are closely related to several isoforms of asparagine synthetase (glutamine amidotransferase) and typically have been given this name in genome annotation to date. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and a member of the GNAT family of acetyltransferases.
Probab=97.47  E-value=0.0014  Score=45.89  Aligned_cols=90  Identities=19%  Similarity=0.176  Sum_probs=55.1

Q ss_pred             HHHHHHHHHHHH-CCCCEEEEECCCCHHHHHHHHHHHHCCCCE---EEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             999999997650-444036640564047799999986223656---9999738955156278999988623698579975
Q gi|254780414|r  209 HKEIVSRIKEQV-GNERVICAVSGGVDSTVAAFLIYEAIGINL---TCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD  284 (520)
Q Consensus       209 ~~~~i~~Ir~~v-g~~kVi~~lSGGVDStV~A~Ll~kAig~~l---~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vd  284 (520)
T Consensus       246 ~~~l~~sV~~rl~sDvpvg~~LSGGlDSS~i~a~~~~~~~~~i~tfs~~f~~~~~~~~dE~~~a~~va~-~~~~~h~~~~  324 (589)
T TIGR03104       246 LEALRLAVKRRLVADVPVGVLLSGGLDSSLIVGLLAEAGVDGLRTFSIGFEDVGGEKGDEFEYSDIIAE-RFHTRHHKIR  324 (589)
T ss_pred             HHHHHHHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHH-HHCCCCEEEE
T ss_conf             999999999997446763000178754389999999956999852788724688776667999999999-7387857999


Q ss_pred             H-HHHHHHH----HCCCCCH
Q ss_conf             8-8999999----6689888
Q gi|254780414|r  285 A-SERFIRK----LKNIVDP  299 (520)
Q Consensus       285 a-~~~Fl~~----L~gv~DP  299 (520)
T Consensus       325 ~~~~~~~~~l~~~~~~~deP  344 (589)
T TIGR03104       325 IPNHRVLPALPEAVAAMSEP  344 (589)
T ss_pred             ECCHHHHHHHHHHHHCCCCC
T ss_conf             57178999889988526898