HHsearch alignment for GI: 254780414 and conserved domain: TIGR03573

>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an
Probab=98.61  E-value=3.5e-06  Score=64.42  Aligned_cols=127  Identities=27%  Similarity=0.352  Sum_probs=93.0

Q ss_pred             CCCCCC-HHHHHHHHHHHHHHHCCC-CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCC
Q ss_conf             411140-678999999997650444-036640564047799999986223656999973895515627899998862369
Q gi|254780414|r  200 QDNWVM-SSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPN  277 (520)
Q Consensus       200 ~~~W~~-~~~~~~~i~~Ir~~vg~~-kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~  277 (520)
T Consensus        35 ~i~w~~r~~~l~~l~~~~r~~~~~~YDCiv~vSGGkDS~y~~~~l~~~~gl~pL~vt~d~~~~t~~g~~Ni~~l~~~-lg  113 (343)
T TIGR03573        35 KIDWDEREKELEELVDKIKKKGGGRYDCIIGVSGGKDSTYQAHVLKKKLGLNPLLVTVDPGWNTELGVKNLNNLIKK-LG  113 (343)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHH-CC
T ss_conf             89868899999999999971489988689868877289999999999829925999835987798999999999983-69


Q ss_pred             CCEEEEEH-----HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             85799758-----8999999668988899998875658999999997439970998646
Q gi|254780414|r  278 FPLRVVDA-----SERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       278 ~~l~~vda-----~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
T Consensus       114 vD~i~~~~n~~~~k~l~k~~~~~~gd~~~~~~~---~i~~~~~~iA~k~-~IplIi~Ge  168 (343)
T TIGR03573       114 FDLHTITINPETFRKLQRAYFKKVGDPEWPQDH---AIFASVYQVALKF-NIPLIIWGE  168 (343)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHCCCHHHHHHH---HHHHHHHHHHHHC-CCCEEEECC
T ss_conf             985874699999999999999866894699999---9999999999981-999899756