HHsearch alignment for GI: 254780414 and conserved domain: cd01653

>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-depende
Probab=97.24  E-value=0.00029  Score=50.66  Aligned_cols=72  Identities=22%  Similarity=0.401  Sum_probs=47.8

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCHHH--HHHCCCCEEEECCCCCCCCCCC-CCC---CCHHHHHCCCCEEEECHHHHHH
Q ss_conf             8899888865940698528989889--9723997999985388999999-975---3768980899889977899998
Q gi|254780414|r   21 QLIARRVRESKVYCEVIAFKNALDY--FKEQNPQAIILSGSPASSLDID-SPQ---IPKEILESNIPLLGICYGQQIM   92 (520)
Q Consensus        21 qLIaRriRelgVyseI~P~~~~~e~--i~~~~p~GIILSGGP~SV~d~~-ap~---~~~~I~~~~iPILGICyG~QlL   92 (520)
T Consensus        15 ~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~~d~liipgg~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~c~g~~~l   92 (115)
T cd01653          15 ASPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPDDLARDEALLALLREAAAAGKPILGICLGAQLL   92 (115)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCHHCCCEEEECCCCCCHHHHHHCHHHHHHHHHHHHCCCEEEEECHHHHHH
T ss_conf             999999997799799996589986665762008999989986329998639999999999998699899988588999