HHsearch alignment for GI: 254780414 and conserved domain: cd01742

>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP. GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=100.00  E-value=0  Score=367.34  Aligned_cols=181  Identities=52%  Similarity=0.935  Sum_probs=175.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH
Q ss_conf             99998897057889988886594069852898988997239979999853889999999753768980899889977899
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ   89 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~   89 (520)
T Consensus         1 I~iiD~g~~~~~si~~~l~~~G~~~~vv~~~~~~~~~~~~~~dgvils~GP~~~~~~~~~~~~~~i~~~~~PilGIClG~   80 (181)
T cd01742           1 ILILDFGSQYTHLIARRVRELGVYSEILPNTTPLEEIKLKNPKGIILSGGPSSVYEEDAPRVDPEIFELGVPVLGICYGM   80 (181)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEEHHHH
T ss_conf             79999986389999999997799499996999989997349898998999998555798333099984799999985999


Q ss_pred             HHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCCC
Q ss_conf             99899709699986986610366752388622278726655336860022011012444211232398317889863500
Q gi|254780414|r   90 QIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRK  169 (520)
Q Consensus        90 QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~~  169 (520)
T Consensus        81 Qll~~a~Gg~v~~~~~~~~G~~~~~~~~~~~l~~~~---~~~~~~~~~H~~~v~~~p~~~~~~a~s~~~~v~~~~~~~~~  157 (181)
T cd01742          81 QLIAKALGGKVERGDKREYGKAEIEIDDSSPLFEGL---PDEQTVWMSHGDEVVKLPEGFKVIASSDNCPVAAIANEEKK  157 (181)
T ss_pred             HHHHHHCCCCEEECCCCEECCEEEEEECCCCCCCCC---CCCEEEEEECCEEEEECCCCEEEEEECCCCEEEEEEECCCC
T ss_conf             999987597602189855364478981262100588---98567885636299845873079999599409999989999


Q ss_pred             EEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             112465212221520257799875
Q gi|254780414|r  170 YYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       170 iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
T Consensus       158 i~gvQfHPEs~~s~~G~~il~NFl  181 (181)
T cd01742         158 IYGVQFHPEVTHTEKGKEILKNFL  181 (181)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHC
T ss_conf             899995788899847379998429