HHsearch alignment for GI: 254780414 and conserved domain: cd01995

>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=98.53  E-value=4.7e-07  Score=70.66  Aligned_cols=144  Identities=23%  Similarity=0.283  Sum_probs=87.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             03664056404779999998622365699997389551562789999886236985799758899999966898889999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
T Consensus         1 kavvllSGGlDSt~~l~~~~~~-g~~v~~l~~dYGQr~~~E~~~a~~-i~~~l~~~-~~VP~-----------------R   60 (169)
T cd01995           1 KAVVLLSGGLDSTTCLAWAKKE-GYEVHALSFDYGQRHAKEEEAAKL-IAEKLGPS-TYVPA-----------------R   60 (169)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCHHHHHHHHHH-HHHHHCCC-CEECC-----------------C
T ss_conf             9899907878899999999984-996999997569854999999999-99996899-46528-----------------3


Q ss_pred             HHHHHHHHHHHHHHHHHCC--CCEE-EEEC--CCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHH
Q ss_conf             8875658999999997439--9709-9864--622024542024677763034430232011320320223789873899
Q gi|254780414|r  304 KVIGQLFIEVFEEEAKKIG--GAQF-LGQG--TLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDE  378 (520)
Q Consensus       304 kiIG~~Fi~vf~~~a~~~~--~~~~-L~QG--TlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdE  378 (520)
T Consensus        61 N---~ifls~A~~~A~~~g~~~v~~G~~~~d~~~ypDc~~~---------F~~a~~~~~~~~~~~~v~i~aP~~~~~K~e  128 (169)
T cd01995          61 N---LIFLSIAAAYAEALGAEAIIIGVNAEDYSGYPDCRPE---------FIEAMNKALNLGTENGIKIHAPLIDLSKAE  128 (169)
T ss_pred             H---HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHH---------HHHHHHHHHHHCCCCCCEEEECCCCCCHHH
T ss_conf             8---9999999999998299968999824775689998699---------999999999830879858984333598999


Q ss_pred             HHHHHHHHCCCHHHHCCCCCC
Q ss_conf             999999819998894268889
Q gi|254780414|r  379 VRLLGKELRLPDSFVERHPCP  399 (520)
Q Consensus       379 VR~lg~~Lglp~~~~~RhPFP  399 (520)
T Consensus       129 iv~~g~~lgv~~~~T~SCy~g  149 (169)
T cd01995         129 IVRLGGELGVPLELTWSCYNG  149 (169)
T ss_pred             HHHHHHHCCCCHHHCCCCCCC
T ss_conf             999998849979982157799