>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Catalase catalyzes the dismutation of hydrogen peroxide (H2O2) to water and oxygen. This group includes the large catalases: Neurospora crassa Catalase-1 and Catalase-3 and, Escherichia coli HP-II. This GATase1-like domain has an essential role in HP-II catalase activity. However, it lacks enzymatic activity and the catalytic triad typical of GATase1 domains. Catalase-1 and -3 are homotetrameric, HP-II is homohexameric. It has been proposed that this domain may facilitate the folding and oligomerization process. The interface between this GATase1-like domain of HP-II and the core of the subunit forms part of a channel which provides access to the deeply buried catalase active sites of HPII. Catalase-1 is associated with non-growing cells; C

Probab=92.20 E-value=0.28 Score=29.36 Aligned_cols=88 Identities=14% Similarity=0.160 Sum_probs=58.3 Q ss_pred EEEEE-ECCCCHHHH--HHHHHHHCCCEEEEECCCC---------------CHHHHHHCCCCEEEECCCCCCCC----CC Q ss_conf 69999-889705788--9988886594069852898---------------98899723997999985388999----99 Q gi|254780414|r 9 KVLII-DFGSQFTQL--IARRVRESKVYCEVIAFKN---------------ALDYFKEQNPQAIILSGSPASSL----DI 66 (520) Q Consensus 9 ~IlIl-DfGSQytqL--IaRriRelgVyseI~P~~~---------------~~e~i~~~~p~GIILSGGP~SV~----d~ 66 (520) T Consensus 3 kVaiLv~dg~~~~e~~~~~~al~~aG~~v~via~~~g~v~~~~g~~~~vd~t~~~~~s~~fDAvvipgG~~~~~~L~~~~ 82 (142) T cd03132 3 KVGILVADGVDAAELSALKAALKAAGANVKVVAPTLGGVVDSDGKTLEVDQTYAGAPSVLFDAVVVPGGAEAAFALAPSG 82 (142) T ss_pred EEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCEECCCCCEEECCEEECCCCHHHCCEEEECCCCCCHHHHCCCH T ss_conf 89999669988899999999999889989999579870775899888054435368964713688438877988864486 Q ss_pred CCCCCCHHHHHCCCCEEEECHHHHHHHHHC Q ss_conf 997537689808998899778999989970 Q gi|254780414|r 67 DSPQIPKEILESNIPLLGICYGQQIMCQSL 96 (520) Q Consensus 67 ~ap~~~~~I~~~~iPILGICyG~QlLa~~~ 96 (520) T Consensus 83 ~~~~fv~eay~h~KpI~a~~~~~~lL~~ag 112 (142) T cd03132 83 RALHFVTEAFKHGKPIGAVGEGSDLLEAAG 112 (142) T ss_pred HHHHHHHHHHHCCCEEEEECCHHHHHHHCC T ss_conf 799999999976997999377299999769

HHsearch alignment for GI: 254780414 and conserved domain: cd03132