HHsearch alignment for GI: 254780414 and conserved domain: cd03140

>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=93.35  E-value=0.11  Score=32.15  Aligned_cols=57  Identities=18%  Similarity=0.357  Sum_probs=40.5

Q ss_pred             CCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCC---HHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             28989889972399799998538899999997537---68980899889977899998997
Q gi|254780414|r   38 AFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIP---KEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        38 P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~---~~I~~~~iPILGICyG~QlLa~~   95 (520)
T Consensus        48 ~~D~~l~~v~~~~~D~lvlPGG~~~~~-~~~~~l~~~l~~~~~~gk~iaaIC~g~~vLa~a  107 (170)
T cd03140          48 VPDYSLDDLPPEDYDLLILPGGDSWDN-PEAPDLAGLVRQALKQGKPVAAICGATLALARA  107 (170)
T ss_pred             ECCCCHHHCCCCCCCEEEECCCCCCCC-CCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHC
T ss_conf             567586888902177899868875100-249999999999987499099986558999985