>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.

Probab=93.51 E-value=0.052 Score=34.57 Aligned_cols=57 Identities=23% Similarity=0.384 Sum_probs=40.1 Q ss_pred CCCCHHHHHHCCCCEEEECCCCCCCCCCCCC---CCCHHHHHCCCCEEEECHHHHHHHHH Q ss_conf 8989889972399799998538899999997---53768980899889977899998997 Q gi|254780414|r 39 FKNALDYFKEQNPQAIILSGSPASSLDIDSP---QIPKEILESNIPLLGICYGQQIMCQS 95 (520) Q Consensus 39 ~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap---~~~~~I~~~~iPILGICyG~QlLa~~ 95 (520) T Consensus 65 ~~~~~~dv~~~~yDai~iPGG~g~~~l~~d~~~~~li~~~~~~gK~iaaIChgp~~L~~a 124 (180) T cd03169 65 VTADFDEVDPDDYDALVIPGGRAPEYLRLDEKVLAIVRHFAEANKPVAAICHGPQILAAA 124 (180) T ss_pred CCCCHHHCCHHHCCEEEECCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHC T ss_conf 678767898610999998998228777119799999999998199699778168999876

HHsearch alignment for GI: 254780414 and conserved domain: cd03169