Query         gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 520
No_of_seqs    307 out of 3937
Neff          5.0 
Searched_HMMs 39220
Date          Sun May 29 19:18:05 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780414.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00074 guaA GMP synthase; Re 100.0       0       0 1750.1  51.3  512    5-520     2-513 (513)
  2 KOG1622 consensus              100.0       0       0 1348.7  33.7  515    4-520    13-552 (552)
  3 TIGR00884 guaA_Cterm GMP synth 100.0       0       0 1271.2  24.9  314  207-520     1-319 (319)
  4 COG0519 GuaA GMP synthase, PP- 100.0       0       0 1110.1  30.9  315  202-520     1-315 (315)
  5 PRK00919 GMP synthase subunit  100.0       0       0 1079.5  30.2  305  204-520     2-306 (306)
  6 cd01997 GMP_synthase_C The C-t 100.0       0       0 1060.1  29.7  295  224-519     1-295 (295)
  7 TIGR00888 guaA_Nterm GMP synth 100.0       0       0  622.9  13.3  191   10-200     1-195 (195)
  8 PRK07765 para-aminobenzoate sy 100.0       0       0  436.9  21.4  211    9-223     2-219 (221)
  9 COG0518 GuaA GMP synthase - Gl 100.0       0       0  419.5  16.2  191    7-201     1-198 (198)
 10 CHL00101 trpG anthranilate syn 100.0       0       0  405.3  19.1  186    9-198     1-190 (190)
 11 PRK05670 anthranilate synthase 100.0       0       0  386.0  18.9  188    9-200     1-191 (192)
 12 PRK08857 para-aminobenzoate sy 100.0       0       0  385.3  18.6  183    9-194     1-191 (192)
 13 PRK06895 para-aminobenzoate sy 100.0       0       0  384.5  18.3  182    7-196     2-189 (191)
 14 cd01743 GATase1_Anthranilate_S 100.0       0       0  378.5  17.9  181   10-193     1-184 (184)
 15 PRK07649 para-aminobenzoate/an 100.0       0       0  375.8  19.1  190    9-201     1-193 (195)
 16 PRK00758 GMP synthase subunit  100.0       0       0  376.6  17.7  182    9-198     1-182 (184)
 17 PRK08007 para-aminobenzoate sy 100.0       0       0  368.7  18.6  183    9-194     1-186 (187)
 18 cd01742 GATase1_GMP_Synthase T 100.0       0       0  367.3  18.9  181   10-193     1-181 (181)
 19 PRK06774 para-aminobenzoate sy 100.0       0       0  358.7  17.9  184    9-195     1-191 (191)
 20 cd01744 GATase1_CPSase Small c 100.0       0       0  361.9  14.7  173   10-193     1-178 (178)
 21 PRK09522 bifunctional anthrani 100.0 6.4E-43       0  326.9  20.3  352    8-421     2-403 (531)
 22 pfam00117 GATase Glutamine ami 100.0 1.1E-43       0  332.4  15.1  182   11-196     1-187 (187)
 23 PRK05637 anthranilate synthase 100.0 7.7E-40   2E-44  304.9  18.2  186    8-196     2-205 (208)
 24 pfam00958 GMP_synt_C GMP synth 100.0 7.5E-41 1.4E-45  312.2   8.2   93  427-519     1-93  (93)
 25 cd01990 Alpha_ANH_like_I This  100.0 1.5E-37 3.9E-42  288.5  17.0  180  225-428     1-184 (202)
 26 PRK13143 hisH imidazole glycer 100.0 2.1E-37 5.2E-42  287.6  14.9  179    8-198     2-201 (201)
 27 PRK13181 hisH imidazole glycer 100.0 5.4E-37 1.4E-41  284.6  11.3  175    9-196     1-199 (199)
 28 COG0512 PabA Anthranilate/para 100.0 3.1E-34   8E-39  264.9  17.4  181    8-193     2-188 (191)
 29 PRK13566 anthranilate synthase 100.0   7E-34 1.8E-38  262.4  18.7  191    4-197   520-716 (724)
 30 cd01748 GATase1_IGP_Synthase T 100.0 6.5E-35 1.6E-39  269.8  11.6  172   10-193     1-198 (198)
 31 TIGR01368 CPSaseIIsmall carbam 100.0 2.7E-33   7E-38  258.1  12.1  172    8-196   197-381 (383)
 32 PRK13175 consensus             100.0 3.8E-32 9.6E-37  250.0  15.7  178    8-197     2-204 (206)
 33 PRK09065 glutamine amidotransf 100.0 3.3E-32 8.4E-37  250.4  14.8  168    7-181     3-192 (238)
 34 PRK12564 carbamoyl phosphate s 100.0 2.4E-31   6E-36  244.3  14.1  176    5-194   169-352 (355)
 35 cd01741 GATase1_1 Subgroup of  100.0 3.9E-31 9.9E-36  242.7  14.5  174    9-193     1-188 (188)
 36 PRK13141 hisH imidazole glycer 100.0 1.1E-30 2.8E-35  239.5  16.0  177    8-197     1-203 (204)
 37 CHL00197 carA carbamoyl-phosph 100.0 9.6E-31 2.4E-35  239.9  12.7  174    7-197   194-378 (383)
 38 PRK07053 glutamine amidotransf 100.0 3.8E-30 9.7E-35  235.7  15.0  177    7-193     2-190 (235)
 39 PRK05665 amidotransferase; Pro 100.0 1.8E-30 4.5E-35  238.1  13.2  209    9-246     4-233 (240)
 40 PRK12838 carbamoyl phosphate s 100.0 2.6E-30 6.7E-35  236.8  13.9  179    5-198   165-352 (356)
 41 PRK07567 glutamine amidotransf 100.0 3.6E-29 9.1E-34  228.7  11.4  160   47-217    48-223 (242)
 42 PRK06490 glutamine amidotransf 100.0 3.4E-28 8.6E-33  221.8  15.1  176    5-194     9-195 (243)
 43 PRK08250 glutamine amidotransf 100.0   2E-28 5.1E-33  223.4  13.0  174    9-193     2-191 (235)
 44 COG0505 CarA Carbamoylphosphat 100.0 5.7E-28 1.4E-32  220.1  14.2  181    5-196   177-362 (368)
 45 TIGR00566 trpG_papA glutamine  100.0 2.5E-28 6.5E-33  222.6  11.2  186    9-194     1-211 (212)
 46 TIGR01815 TrpE-clade3 anthrani  99.9 8.3E-27 2.1E-31  211.8  15.3  196    3-201   520-722 (726)
 47 PRK13180 consensus              99.9 6.9E-27 1.8E-31  212.4  12.9  176    8-194     2-207 (209)
 48 PRK13146 hisH imidazole glycer  99.9 9.3E-27 2.4E-31  211.5  12.5  177    8-193     2-204 (208)
 49 PRK13152 hisH imidazole glycer  99.9 2.2E-26 5.5E-31  208.8  12.3  171   10-193     2-199 (201)
 50 PRK13153 consensus              99.9 8.8E-26 2.2E-30  204.5  12.7  171   10-193     2-201 (203)
 51 PRK13176 consensus              99.9 6.9E-26 1.8E-30  205.2  11.5  179    9-193     2-212 (216)
 52 PRK13178 consensus              99.9 2.7E-25 6.9E-30  201.0  13.5  175   10-198     2-207 (213)
 53 PRK13174 consensus              99.9 5.7E-25 1.4E-29  198.7  14.7  176    8-193     2-206 (212)
 54 KOG0026 consensus               99.9 2.1E-24 5.5E-29  194.6  15.0  194    4-205    15-220 (223)
 55 PRK13177 consensus              99.9 3.1E-24   8E-29  193.4  14.8  173    7-193     2-203 (207)
 56 PRK13171 consensus              99.9   6E-24 1.5E-28  191.4  13.4  175    8-196     2-197 (200)
 57 KOG0370 consensus               99.9 2.7E-24 6.9E-29  193.9  11.5  231    5-257   170-419 (1435)
 58 PRK13170 hisH imidazole glycer  99.9 4.2E-24 1.1E-28  192.4  11.5  169    9-193     2-194 (196)
 59 PRK11366 puuD gamma-glutamyl-g  99.9 1.3E-22 3.4E-27  181.8  18.4  196    1-198     1-245 (254)
 60 pfam07722 Peptidase_C26 Peptid  99.9 5.4E-23 1.4E-27  184.6  13.7  153   24-178    30-219 (219)
 61 PRK13148 consensus              99.9 2.7E-22   7E-27  179.5  14.3  180    8-205     2-225 (225)
 62 COG0118 HisH Glutamine amidotr  99.9 9.8E-22 2.5E-26  175.6  15.1  175    8-193     2-200 (204)
 63 COG2071 Predicted glutamine am  99.9 1.2E-21 3.1E-26  174.9  15.0  172   24-199    32-240 (243)
 64 cd01745 GATase1_2 Subgroup of   99.9 1.4E-21 3.7E-26  174.4  14.0  145   21-193    22-189 (189)
 65 PRK13179 consensus              99.9 7.7E-21   2E-25  169.2  15.0  174   10-196     2-206 (207)
 66 PRK13173 consensus              99.9 1.1E-20 2.8E-25  168.0  15.8  173    8-193     2-207 (211)
 67 KOG1224 consensus               99.9 3.6E-21 9.2E-26  171.5  12.8  195    2-197     9-217 (767)
 68 CHL00188 hisH imidazole glycer  99.9 3.8E-21 9.7E-26  171.3  12.8  175    8-195     2-209 (210)
 69 TIGR01855 IMP_synth_hisH imida  99.9 2.1E-21 5.3E-26  173.2  11.4  173   10-193     1-209 (211)
 70 PRK13147 consensus              99.9 1.1E-20 2.8E-25  168.1  15.1  175    9-193     2-207 (211)
 71 TIGR01823 PabB-fungal para-ami  99.9 8.1E-21 2.1E-25  169.0  13.0  193    6-199     4-244 (851)
 72 PRK13172 consensus              99.9   2E-20 5.2E-25  166.1  14.7  175    8-193     2-211 (213)
 73 pfam02540 NAD_synthase NAD syn  99.9 4.2E-20 1.1E-24  163.9  14.9  173  209-400     2-180 (243)
 74 PRK13151 consensus              99.8   2E-20 5.2E-25  166.1  12.2  172    9-196     2-194 (195)
 75 PRK13144 consensus              99.8 1.5E-20 3.7E-25  167.2  11.2  166    9-194     2-186 (190)
 76 PRK13527 glutamine amidotransf  99.8 1.1E-18 2.9E-23  153.7  13.4  173    9-197     2-194 (196)
 77 PRK13525 glutamine amidotransf  99.8 8.7E-19 2.2E-23  154.5  11.4  170    8-197     2-187 (191)
 78 PRK13142 hisH imidazole glycer  99.8 5.1E-18 1.3E-22  149.0  11.0  166    9-194     1-186 (192)
 79 KOG3179 consensus               99.8 4.6E-18 1.2E-22  149.3   9.9  159   15-180    23-195 (245)
 80 pfam01174 SNO SNO glutamine am  99.7 2.7E-17 6.8E-22  143.8   9.4  157   21-193     9-183 (188)
 81 cd00553 NAD_synthase NAD+ synt  99.7 8.3E-16 2.1E-20  133.2  14.1  187  205-416     3-200 (248)
 82 cd01749 GATase1_PB Glutamine A  99.7 3.2E-16   8E-21  136.2  10.8  164   12-193     3-183 (183)
 83 PRK00143 trmU tRNA (5-methylam  99.7 1.5E-15 3.8E-20  131.3  11.2  162  221-390     3-187 (355)
 84 PRK00876 nadE NAD synthetase;   99.7 3.8E-15 9.6E-20  128.5  12.8  177  203-400    10-248 (325)
 85 cd01998 tRNA_Me_trans tRNA met  99.6 1.2E-15 3.2E-20  132.0   8.6  158  224-389     1-182 (349)
 86 PRK13980 NAD synthetase; Provi  99.6 1.9E-14 4.8E-19  123.5  14.0  175  204-400     7-189 (264)
 87 pfam03054 tRNA_Me_trans tRNA m  99.6 2.4E-15 6.2E-20  129.8   8.2  160  224-390     2-185 (354)
 88 PRK00768 nadE NAD synthetase;   99.6 2.7E-14 6.9E-19  122.4  13.1  187  186-400     6-213 (274)
 89 cd01747 GATase1_Glutamyl_Hydro  99.5 4.1E-14   1E-18  121.1   8.3  186   15-200    16-249 (273)
 90 COG0482 TrmU Predicted tRNA(5-  99.5 3.4E-13 8.6E-18  114.6  12.5  161  222-391     3-186 (356)
 91 COG1606 ATP-utilizing enzymes   99.5 5.6E-12 1.4E-16  105.8  16.4  188  210-428     4-202 (269)
 92 TIGR00420 trmU tRNA (5-methyla  99.5 4.3E-13 1.1E-17  113.8  10.1  162  223-391     1-204 (394)
 93 PTZ00323 NAD+ synthase; Provis  99.4 1.2E-11 3.2E-16  103.4  15.6  183  186-400    12-222 (294)
 94 COG0171 NadE NAD synthase [Coe  99.4 2.8E-11   7E-16  100.9  14.2  174  205-400     5-196 (268)
 95 PRK06186 hypothetical protein;  99.4 7.9E-13   2E-17  111.9   5.9  145   48-197    51-226 (229)
 96 cd01746 GATase1_CTP_Synthase T  99.4   6E-13 1.5E-17  112.8   4.9  141   49-193    54-235 (235)
 97 KOG0623 consensus               99.3 1.2E-11   3E-16  103.5   9.8  172    8-195     2-207 (541)
 98 TIGR00337 PyrG CTP synthase; I  99.3 3.6E-12 9.1E-17  107.2   7.0  140   50-193   373-569 (571)
 99 KOG2805 consensus               99.3 1.7E-11 4.3E-16  102.4  10.2  164  222-395     5-196 (377)
100 PRK05380 pyrG CTP synthetase;   99.3 4.6E-12 1.2E-16  106.4   5.5  144   49-195   342-526 (534)
101 cd01712 ThiI ThiI is required   99.3 1.7E-11 4.3E-16  102.4   7.8  153  224-391     1-159 (177)
102 COG0504 PyrG CTP synthase (UTP  99.3 1.4E-11 3.6E-16  103.0   7.0  141   51-195   344-525 (533)
103 TIGR00268 TIGR00268 conserved   99.2 1.9E-09 4.8E-14   87.8  17.2  224  211-494     4-234 (263)
104 pfam02568 ThiI Thiamine biosyn  99.2 1.5E-10 3.8E-15   95.7  11.5  156  222-393     3-166 (197)
105 COG0037 MesJ tRNA(Ile)-lysidin  99.2   5E-10 1.3E-14   91.9  13.9  158  222-390    21-188 (298)
106 pfam01171 ATP_bind_3 PP-loop f  99.2 2.3E-10   6E-15   94.3  10.9  152  224-390     1-163 (182)
107 cd01993 Alpha_ANH_like_II This  99.2 3.8E-10 9.8E-15   92.7  10.0  155  224-390     1-174 (185)
108 PRK01175 phosphoribosylformylg  99.2 1.5E-09 3.8E-14   88.5  12.9  189    6-196     2-252 (255)
109 PRK03619 phosphoribosylformylg  99.1 2.4E-09 6.2E-14   87.0  13.3  180    9-193     2-217 (223)
110 cd01992 PP-ATPase N-terminal d  99.1 6.1E-10 1.5E-14   91.3   8.3  150  224-389     1-162 (185)
111 cd01740 GATase1_FGAR_AT Type 1  99.0 1.3E-08 3.2E-13   81.9  13.8  180   10-191     1-236 (238)
112 COG0047 PurL Phosphoribosylfor  99.0 4.4E-08 1.1E-12   78.0  14.4  184    7-193     2-227 (231)
113 PRK13981 NAD synthetase; Provi  99.0 1.7E-08 4.3E-13   81.0  11.5  161  218-400   277-458 (543)
114 TIGR00552 nadE NAD+ synthetase  99.0 2.7E-08 6.9E-13   79.5  12.4  170  212-398    16-203 (286)
115 PRK08349 hypothetical protein;  98.9 7.9E-09   2E-13   83.3   7.9  178  224-421     2-187 (198)
116 PRK10660 tilS tRNA(Ile)-lysidi  98.9 6.7E-08 1.7E-12   76.7  11.8  153  220-390    11-175 (433)
117 TIGR01737 FGAM_synth_I phospho  98.8 3.3E-08 8.4E-13   78.9   9.6  182    9-193     2-261 (264)
118 PRK13794 hypothetical protein;  98.8 2.7E-08 6.9E-13   79.5   8.7  178  203-399   224-411 (473)
119 PRK13795 hypothetical protein;  98.8 4.7E-08 1.2E-12   77.8   9.2   99  203-303   224-324 (630)
120 KOG2387 consensus               98.7 8.8E-09 2.3E-13   83.0   4.3  133   50-182   363-532 (585)
121 PRK01565 thiamine biosynthesis  98.6 5.2E-07 1.3E-11   70.3  10.1  156  220-391   173-335 (399)
122 TIGR03573 WbuX N-acetyl sugar   98.6 3.5E-06 8.9E-11   64.4  14.1  127  200-331    35-168 (343)
123 PRK08557 hypothetical protein;  98.6 4.5E-07 1.2E-11   70.8   9.4  185  204-402   160-352 (420)
124 PRK13526 glutamine amidotransf  98.6 7.7E-07   2E-11   69.1   9.8  165    8-193     3-177 (179)
125 TIGR02432 lysidine_TilS_N tRNA  98.6 1.3E-06 3.4E-11   67.4  10.7  156  224-390     1-182 (204)
126 cd01986 Alpha_ANH_like Adenine  98.6 1.4E-07 3.5E-12   74.5   5.7  102  225-372     1-103 (103)
127 PRK01269 thiamine biosynthesis  98.5 7.5E-07 1.9E-11   69.2   9.1  158  222-397   177-341 (483)
128 cd01995 ExsB ExsB is a transcr  98.5 4.7E-07 1.2E-11   70.7   7.9  144  224-399     1-149 (169)
129 COG0301 ThiI Thiamine biosynth  98.5 6.3E-06 1.6E-10   62.6  13.1  167  220-403   172-345 (383)
130 pfam04204 HTS Homoserine O-suc  98.5 3.9E-06 9.8E-11   64.1  11.4  160   42-208    90-262 (298)
131 pfam06508 ExsB ExsB. This fami  98.5 8.7E-07 2.2E-11   68.7   7.9  107  224-336     1-131 (137)
132 PRK05368 homoserine O-succinyl  98.4 4.6E-06 1.2E-10   63.6  10.2  149   42-198    91-253 (302)
133 PRK08576 hypothetical protein;  98.4 2.7E-06   7E-11   65.2   8.8  177  206-398   220-396 (439)
134 PRK11106 queuosine biosynthesi  98.3 1.3E-06 3.2E-11   67.6   5.4  157  223-396     2-188 (231)
135 cd01713 PAPS_reductase This do  98.3 2.3E-05 5.9E-10   58.6  11.7  164  224-400     1-171 (173)
136 pfam01507 PAPS_reduct Phosphoa  98.3 1.7E-05 4.4E-10   59.5  11.0  165  224-402     1-167 (174)
137 COG0311 PDX2 Predicted glutami  98.3   5E-05 1.3E-09   56.2  13.2  169    9-193     2-187 (194)
138 PRK00509 argininosuccinate syn  98.3 1.9E-05 4.9E-10   59.2  10.7  103  222-331     2-117 (398)
139 PRK10696 C32 tRNA thiolase; Pr  98.2 4.4E-05 1.1E-09   56.6  11.7  166  209-389    26-206 (311)
140 KOG1559 consensus               98.2 3.3E-06 8.3E-11   64.6   5.7  187    2-195    60-299 (340)
141 cd01996 Alpha_ANH_like_III Thi  98.2   9E-06 2.3E-10   61.5   8.0  103  225-331     4-110 (154)
142 PRK01077 cobyrinic acid a,c-di  98.1   1E-04 2.5E-09   54.0  12.2   18   78-95    322-339 (451)
143 PRK04527 argininosuccinate syn  98.1 8.7E-05 2.2E-09   54.4  11.9  157  221-401     2-170 (397)
144 PRK13820 argininosuccinate syn  98.1   2E-05   5E-10   59.1   8.4  148  222-391     3-165 (395)
145 TIGR00342 TIGR00342 thiamine b  98.0 6.2E-06 1.6E-10   62.6   4.4  155  221-390   184-347 (391)
146 COG0603 Predicted PP-loop supe  98.0 1.7E-05 4.4E-10   59.4   6.7  169  222-408     2-199 (222)
147 pfam00733 Asn_synthase Asparag  98.0 5.9E-05 1.5E-09   55.7   9.1   84  210-294     4-89  (195)
148 pfam00764 Arginosuc_synth Argi  97.9 0.00015 3.9E-09   52.7   9.9   98  226-330     1-111 (389)
149 PRK05297 phosphoribosylformylg  97.9  0.0002 5.2E-09   51.8  10.4   10   52-61    433-442 (1294)
150 PRK05370 argininosuccinate syn  97.9 8.5E-05 2.2E-09   54.5   8.3  148  222-389    11-182 (447)
151 TIGR03108 eps_aminotran_1 exos  97.8  0.0004   1E-08   49.7  10.7  124  140-287   198-324 (628)
152 COG0175 CysH 3'-phosphoadenosi  97.8 0.00014 3.6E-09   52.9   8.3  172  212-402    30-208 (261)
153 cd01750 GATase1_CobQ Type 1 gl  97.8 0.00016 4.1E-09   52.5   7.8   81   10-96      1-89  (194)
154 cd01991 Asn_Synthase_B_C The C  97.8 0.00024 6.2E-09   51.3   8.6   74  219-293    12-86  (269)
155 PRK02628 nadE NAD synthetase;   97.7 0.00023   6E-09   51.4   8.0  162  219-399   359-546 (678)
156 PRK08384 thiamine biosynthesis  97.7 0.00033 8.5E-09   50.3   8.1  131  220-388   176-308 (310)
157 cd01999 Argininosuccinate_Synt  97.6  0.0014 3.5E-08   45.8  11.0  101  225-331     1-114 (385)
158 pfam07685 GATase_3 CobB/CobQ-l  97.6 0.00018 4.7E-09   52.1   6.5   48   49-96      6-59  (158)
159 cd01984 AANH_like Adenine nucl  97.6 0.00019 4.8E-09   52.0   6.4   84  225-370     1-86  (86)
160 cd03130 GATase1_CobB Type 1 gl  97.6  0.0013 3.2E-08   46.1  10.3  162   18-193    12-198 (198)
161 TIGR03104 trio_amidotrans aspa  97.5  0.0014 3.5E-08   45.9   9.2   90  209-299   246-344 (589)
162 PRK06278 cobyrinic acid a,c-di  97.5  0.0025 6.3E-08   44.1  10.3  194   14-238    18-259 (482)
163 COG0137 ArgG Argininosuccinate  97.4  0.0032 8.1E-08   43.3  10.7  154  221-393     3-171 (403)
164 TIGR01001 metA homoserine O-su  97.4  0.0008   2E-08   47.5   7.5  146   42-196    91-254 (305)
165 cd03131 GATase1_HTS Type 1 glu  97.4 0.00076 1.9E-08   47.7   7.4   86   42-127    54-147 (175)
166 TIGR00032 argG argininosuccina  97.3  0.0013 3.3E-08   46.1   7.3  157  224-398     1-182 (420)
167 COG1365 Predicted ATPase (PP-l  97.3  0.0019 4.9E-08   44.8   7.9  151  217-398    55-212 (255)
168 cd01653 GATase1 Type 1 glutami  97.2 0.00029 7.5E-09   50.7   3.5   72   21-92     15-92  (115)
169 COG1492 CobQ Cobyric acid synt  97.2  0.0073 1.9E-07   40.7  10.3  193    9-220   253-471 (486)
170 COG0367 AsnB Asparagine syntha  97.1  0.0054 1.4E-07   41.6   9.1  108  220-331   228-342 (542)
171 PRK09431 asnB asparagine synth  97.1  0.0056 1.4E-07   41.5   8.8  101  206-309   210-331 (555)
172 PRK02090 phosphoadenosine phos  97.1   0.029 7.3E-07   36.5  12.3  175  201-402    25-207 (243)
173 PRK00784 cobyric acid synthase  97.1    0.01 2.6E-07   39.7   9.9   81    9-96    255-344 (492)
174 TIGR00313 cobQ cobyric acid sy  97.0 0.00025 6.4E-09   51.1   1.5   82    8-96    249-339 (502)
175 cd03128 GAT_1 Type 1 glutamine  97.0  0.0013 3.2E-08   46.1   4.9   72   21-92     15-92  (92)
176 TIGR01382 PfpI intracellular p  97.0 0.00012   3E-09   53.5  -0.7   83   11-104    45-131 (189)
177 TIGR01536 asn_synth_AEB aspara  96.9  0.0098 2.5E-07   39.8   8.6   97  221-321   310-430 (646)
178 COG1897 MetA Homoserine trans-  96.8  0.0059 1.5E-07   41.4   6.9  178    5-187    33-246 (307)
179 PTZ00077 asparagine synthetase  96.8   0.018 4.6E-07   37.9   9.3   36  212-247   226-262 (610)
180 KOG3210 consensus               96.5    0.01 2.5E-07   39.7   6.6   87    9-98     13-110 (226)
181 TIGR01735 FGAM_synt phosphorib  96.5   0.044 1.1E-06   35.1   9.8  189    3-210  1123-1382(1401)
182 PRK12563 sulfate adenylyltrans  96.4    0.02   5E-07   37.6   7.6  194  206-436    20-219 (312)
183 TIGR01857 FGAM-synthase phosph  96.4   0.038 9.6E-07   35.6   8.9  179    4-191  1013-1262(1279)
184 PRK05253 sulfate adenylyltrans  96.3   0.026 6.7E-07   36.7   7.6  141  206-358     9-155 (300)
185 TIGR00364 TIGR00364 exsB prote  96.3  0.0077   2E-07   40.5   4.8  160  225-394     1-201 (227)
186 KOG0573 consensus               96.1   0.013 3.3E-07   38.9   5.3   72  185-259   200-287 (520)
187 KOG1907 consensus               95.7   0.035 8.9E-07   35.8   5.9   31  377-408   956-986 (1320)
188 COG3442 Predicted glutamine am  95.6    0.06 1.5E-06   34.1   7.0  189   23-224    26-246 (250)
189 cd03135 GATase1_DJ-1 Type 1 gl  95.4   0.011 2.8E-07   39.4   2.4   59   37-95     47-109 (163)
190 COG2102 Predicted ATPases of P  94.7    0.29 7.4E-06   29.2   8.2  114  224-372     2-120 (223)
191 TIGR02039 CysD sulfate adenyly  94.6    0.32 8.1E-06   29.0   8.1  260  207-506     3-278 (295)
192 PRK06850 hypothetical protein;  94.2   0.084 2.1E-06   33.1   4.5  225  205-478     2-264 (488)
193 cd01994 Alpha_ANH_like_IV This  94.0    0.59 1.5E-05   27.1  11.0   61  224-285     1-66  (194)
194 PRK13896 cobyrinic acid a,c-di  93.9    0.62 1.6E-05   26.9  11.5   22  443-466   334-356 (432)
195 KOG2840 consensus               93.8     0.2 5.2E-06   30.4   5.9   98  217-320    46-156 (347)
196 cd03169 GATase1_PfpI_1 Type 1   93.5   0.052 1.3E-06   34.6   2.4   57   39-95     65-124 (180)
197 pfam01965 DJ-1_PfpI DJ-1/PfpI   93.4   0.052 1.3E-06   34.6   2.2   60   36-95     20-83  (141)
198 cd03140 GATase1_PfpI_3 Type 1   93.4    0.11 2.9E-06   32.1   3.9   57   38-95     48-107 (170)
199 TIGR00649 MG423 conserved hypo  92.6    0.26 6.6E-06   29.6   4.8   86    5-99     20-117 (593)
200 cd03134 GATase1_PfpI_like A ty  92.3   0.088 2.2E-06   33.0   2.1   59   37-95     49-110 (165)
201 cd03132 GATase1_catalase Type   92.2    0.28 7.2E-06   29.4   4.6   88    9-96      3-112 (142)
202 COG2117 Predicted subunit of t  91.9    0.23 5.9E-06   30.0   3.9  146  224-386     2-148 (198)
203 pfam01902 ATP_bind_4 ATP-bindi  91.3     1.3 3.4E-05   24.5   7.3  114  224-372     2-119 (219)
204 KOG1706 consensus               91.2    0.73 1.9E-05   26.4   5.9   90  222-317     5-110 (412)
205 TIGR03183 DNA_S_dndC putative   90.7     0.3 7.7E-06   29.1   3.5  217  213-478     2-256 (447)
206 COG0693 ThiJ Putative intracel  90.5    0.21 5.3E-06   30.3   2.6   56   42-97     58-117 (188)
207 cd03141 GATase1_Hsp31_like Typ  90.4    0.21 5.4E-06   30.2   2.5   57   39-95     79-139 (221)
208 COG3969 Predicted phosphoadeno  89.1     1.5 3.8E-05   24.2   6.0   42  203-244     7-49  (407)
209 KOG0571 consensus               88.5    0.69 1.8E-05   26.6   4.0  111  212-331   214-341 (543)
210 TIGR01369 CPSaseII_lrg carbamo  87.1       1 2.7E-05   25.3   4.2   73    7-87    573-681 (1089)
211 PRK11574 hypothetical protein;  86.9    0.49 1.3E-05   27.6   2.4   57   38-94     54-115 (196)
212 KOG2303 consensus               86.5    0.43 1.1E-05   28.0   2.0   29  215-244   343-371 (706)
213 COG4090 Uncharacterized protei  85.5     1.5 3.9E-05   24.1   4.4   70   18-87     40-124 (154)
214 PRK07334 threonine dehydratase  85.2     3.2 8.2E-05   21.8   6.5   90  217-307   287-387 (399)
215 COG1797 CobB Cobyrinic acid a,  82.7       4  0.0001   21.1   8.0  174    8-197   246-450 (451)
216 pfam08497 Radical_SAM_N Radica  80.9       3 7.6E-05   22.0   4.3   98  179-290    28-141 (298)
217 cd03137 GATase1_AraC_1 AraC tr  80.8     2.1 5.5E-05   23.0   3.6   55   39-95     55-112 (187)
218 cd03139 GATase1_PfpI_2 Type 1   80.7     3.2 8.2E-05   21.8   4.5   57   37-95     51-110 (183)
219 TIGR01184 ntrCD nitrate ABC tr  80.0     4.2 0.00011   21.0   4.8   55    7-63    132-195 (230)
220 KOG2764 consensus               79.1     2.3 5.8E-05   22.9   3.3   62   35-98     53-118 (247)
221 cd03147 GATase1_Ydr533c_like T  79.0     1.2 3.1E-05   24.8   1.8   57   39-95     83-143 (231)
222 cd00958 DhnA Class I fructose-  77.8     2.3 5.9E-05   22.8   3.0   10  249-258    91-100 (235)
223 PRK08198 threonine dehydratase  76.1     6.4 0.00016   19.7   6.9   90  217-308   293-394 (406)
224 cd06289 PBP1_MalI_like Ligand-  75.7     6.5 0.00017   19.6   6.8   72   10-86      4-86  (268)
225 PRK05452 anaerobic nitric oxid  75.6     6.5 0.00017   19.6   5.1   71    7-97     42-115 (479)
226 PRK11921 metallo-beta-lactamas  74.9     6.8 0.00017   19.5   5.1   72    7-98     40-114 (395)
227 PRK00955 hypothetical protein;  74.1     5.9 0.00015   19.9   4.3   48   13-60     25-76  (599)
228 COG4607 CeuA ABC-type enteroch  73.8     7.2 0.00018   19.3   5.2   55    5-65     56-133 (320)
229 cd03133 GATase1_ES1 Type 1 glu  73.6     7.3 0.00019   19.3   5.0   57   41-97     73-143 (213)
230 PRK08813 threonine dehydratase  73.2     3.7 9.4E-05   21.4   3.0   53  222-283    81-133 (349)
231 PRK05408 hypothetical protein;  72.5     2.1 5.3E-05   23.2   1.6   44  386-430    10-53  (90)
232 PRK05225 ketol-acid reductoiso  72.2     2.5 6.3E-05   22.6   2.0  105  137-244   131-256 (489)
233 COG4635 HemG Flavodoxin [Energ  72.1     4.9 0.00012   20.5   3.4   47    9-57      2-54  (175)
234 COG1628 Endonuclease V homolog  71.6     8.1 0.00021   18.9   6.9   75  231-306    50-130 (185)
235 PRK08526 threonine dehydratase  71.3     8.2 0.00021   18.9   5.7   84  221-306   294-389 (403)
236 PRK12815 carB carbamoyl phosph  71.2     8.2 0.00021   18.9   5.8   83    1-89      1-122 (1068)
237 cd03148 GATase1_EcHsp31_like T  70.8     2.8 7.1E-05   22.3   2.0   48   47-94     93-144 (232)
238 pfam03358 FMN_red NADPH-depend  70.2     8.7 0.00022   18.7   4.8   34  225-259   105-139 (147)
239 COG2247 LytB Putative cell wal  69.9     8.8 0.00022   18.7   5.4   61   21-85     41-106 (337)
240 pfam09897 DUF2124 Uncharacteri  68.5     4.6 0.00012   20.7   2.6   80    5-87     17-119 (147)
241 PRK06382 threonine dehydratase  68.1     9.5 0.00024   18.4   6.8   87  219-307   290-388 (400)
242 PRK07226 fructose-bisphosphate  67.8     7.4 0.00019   19.2   3.6   19  249-269   108-126 (266)
243 cd01491 Ube1_repeat1 Ubiquitin  66.9     5.8 0.00015   20.0   2.9   66   20-89     75-141 (286)
244 TIGR02720 pyruv_oxi_spxB pyruv  66.4     5.5 0.00014   20.1   2.7  139   51-236    63-215 (577)
245 cd01425 RPS2 Ribosomal protein  66.4      10 0.00026   18.2   6.9   26    7-32     56-81  (193)
246 PRK11780 isoprenoid biosynthes  65.0      11 0.00028   18.0   4.8   58   41-98     76-147 (217)
247 KOG2946 consensus               64.2     6.2 0.00016   19.7   2.6   54  350-406    39-96  (234)
248 PRK10717 cysteine synthase A;   63.6      11 0.00029   17.8   3.9   48  210-259   259-309 (334)
249 cd03145 GAT1_cyanophycinase Ty  62.8      12  0.0003   17.7   5.5   92    5-96     27-134 (217)
250 PRK01254 hypothetical protein;  62.8      12  0.0003   17.7   4.3   42   20-61     57-102 (742)
251 TIGR00289 TIGR00289 conserved   62.2     8.2 0.00021   18.9   3.0  113  224-372     2-123 (227)
252 cd02929 TMADH_HD_FMN Trimethyl  61.9      12 0.00031   17.6  10.3   75  141-230   144-225 (370)
253 TIGR01241 FtsH_fam ATP-depende  61.7     6.4 0.00016   19.7   2.3   47   35-85     73-123 (505)
254 PRK04885 ppnK inorganic polyph  61.1     5.3 0.00013   20.3   1.8   68    9-89      2-71  (265)
255 TIGR01163 rpe ribulose-phospha  60.3      13 0.00033   17.4   4.1   69  172-248   110-191 (216)
256 PRK11145 pflA pyruvate formate  60.0      13 0.00034   17.4   4.1   68  227-298    74-147 (246)
257 TIGR02611 TIGR02611 conserved   59.8     3.1   8E-05   21.9   0.5   14  396-409    48-61  (126)
258 pfam10288 DUF2392 Protein of u  59.7     6.1 0.00016   19.8   2.0   32  363-394    29-60  (104)
259 cd06323 PBP1_ribose_binding Pe  59.3      14 0.00035   17.3   5.0   72   10-85      4-86  (268)
260 TIGR02057 PAPS_reductase phosp  58.5      14 0.00036   17.2   3.8   71  218-289    23-105 (239)
261 COG0595 mRNA degradation ribon  57.7      14 0.00037   17.1   6.8   81    5-97     28-110 (555)
262 cd01139 TroA_f Periplasmic bin  57.3      15 0.00037   17.1   5.7   57   40-98     81-147 (342)
263 PRK03372 ppnK inorganic polyph  57.2     8.7 0.00022   18.7   2.4   77    8-89      5-103 (303)
264 PRK10693 response regulator of  56.2      15 0.00039   17.0   5.7   56    1-56      1-57  (337)
265 PRK02645 ppnK inorganic polyph  55.8     9.1 0.00023   18.6   2.3   77    7-88      3-91  (304)
266 TIGR01839 PHA_synth_II poly(R)  55.7      14 0.00035   17.3   3.2   91  197-300   259-361 (560)
267 pfam07882 Fucose_iso_N2 L-fuco  55.1      16  0.0004   16.9   4.0   38  269-306    20-57  (181)
268 TIGR01383 not_thiJ DJ-1 family  54.8     8.7 0.00022   18.7   2.1   59   37-95     53-115 (186)
269 PRK05294 carB carbamoyl phosph  54.8      16 0.00041   16.8   4.4   58    1-59      1-91  (1063)
270 cd01399 GlcN6P_deaminase GlcN6  54.8      16 0.00041   16.8   9.0  105  214-329     9-122 (232)
271 TIGR02386 rpoC_TIGR DNA-direct  54.3     3.5 8.8E-05   21.6  -0.0   31  205-235   697-727 (1552)
272 cd02020 CMPK Cytidine monophos  53.9     5.9 0.00015   19.9   1.1   44  226-274     4-47  (147)
273 PRK06608 threonine dehydratase  53.8      16  0.0004   16.9   3.2   97  222-340    73-169 (330)
274 TIGR00992 3a0901s03IAP75 chlor  53.7      11 0.00027   18.1   2.4   51  320-374   391-447 (768)
275 PRK05282 peptidase E; Validate  53.4      17 0.00043   16.7   4.2   88    6-95     30-129 (233)
276 PRK03378 ppnK inorganic polyph  52.6      13 0.00034   17.4   2.7   76    8-89      6-97  (292)
277 pfam05350 GSK-3_bind Glycogen   52.4      11 0.00027   18.1   2.2   26  372-402   135-160 (160)
278 cd01543 PBP1_XylR Ligand-bindi  52.0      18 0.00045   16.5   5.7   67   11-85      4-77  (265)
279 pfam08010 Phage_30_3 Bacteriop  51.6      18 0.00046   16.5   3.4   43  284-333    30-74  (146)
280 PRK04155 chaperone protein Hch  51.5      13 0.00033   17.5   2.5   30  331-372   212-241 (288)
281 cd03129 GAT1_Peptidase_E_like   50.7      18 0.00047   16.4   6.4   90    6-95     28-130 (210)
282 CHL00148 orf27 Ycf27; Reviewed  50.1      19 0.00048   16.3   5.7   93    3-99      2-101 (240)
283 PRK03708 ppnK inorganic polyph  50.0      17 0.00043   16.7   2.9   66   18-89     16-90  (278)
284 TIGR01819 F420_cofD LPPG:Fo 2-  49.9      18 0.00046   16.4   3.1   63  213-284   255-341 (359)
285 pfam01715 IPPT IPP transferase  48.9      15 0.00039   16.9   2.6   98  189-316    22-134 (253)
286 KOG3498 consensus               48.5      13 0.00033   17.5   2.1   20  365-384     5-24  (67)
287 cd03138 GATase1_AraC_2 AraC tr  48.0      20 0.00052   16.1   3.7   54   40-95     61-120 (195)
288 TIGR00683 nanA N-acetylneurami  47.7      19 0.00049   16.3   2.9   57  151-220   122-178 (294)
289 pfam04943 Pox_F11 Poxvirus F11  47.6      20 0.00052   16.0   3.9   85   97-181    55-165 (366)
290 TIGR02079 THD1 threonine dehyd  47.1     9.6 0.00024   18.4   1.3  110  213-376   290-412 (415)
291 TIGR02340 chap_CCT_alpha T-com  46.8      16 0.00041   16.8   2.4   86    1-103   221-326 (540)
292 cd06305 PBP1_methylthioribose_  46.6      21 0.00054   15.9   6.0   73    9-85      1-86  (273)
293 PRK02649 ppnK inorganic polyph  46.2      14 0.00035   17.3   2.0  124   51-185    69-223 (305)
294 PRK12338 hypothetical protein;  46.1      12 0.00032   17.6   1.7  117  229-373   189-309 (320)
295 PRK10710 DNA-binding transcrip  45.8      22 0.00055   15.9   5.9   96    1-99      4-105 (240)
296 cd06296 PBP1_CatR_like Ligand-  45.3      22 0.00056   15.8   5.9   62   18-85     16-84  (270)
297 PRK10991 fucI L-fucose isomera  44.3      23 0.00058   15.7   3.5   51  367-419   410-464 (588)
298 COG1609 PurR Transcriptional r  43.8      23 0.00059   15.7   7.5   75    5-85     56-143 (333)
299 cd06299 PBP1_LacI_like_13 Liga  43.7      23 0.00059   15.6   6.5   63   17-85     15-84  (265)
300 TIGR02635 RhaI_grampos L-rhamn  43.3      24  0.0006   15.6   4.1  144  148-300    82-257 (382)
301 COG0677 WecC UDP-N-acetyl-D-ma  43.3      24  0.0006   15.6   3.3   69  216-293   170-239 (436)
302 COG0045 SucC Succinyl-CoA synt  43.0      24 0.00061   15.6   5.4   10   52-61     46-55  (387)
303 cd01522 RHOD_1 Member of the R  42.5      24 0.00062   15.5   5.3   52  207-265    52-105 (117)
304 cd06273 PBP1_GntR_like_1 This   42.4      24 0.00062   15.5   6.2   63   17-85     15-84  (268)
305 pfam02142 MGS MGS-like domain.  41.3      25 0.00064   15.4   5.0   60   24-83     23-91  (92)
306 TIGR02613 mob_myst_B mobile my  41.0     8.8 0.00023   18.7   0.3   21  388-408   115-136 (189)
307 pfam01513 NAD_kinase ATP-NAD k  40.7      18 0.00045   16.5   1.8   39   46-89     31-69  (243)
308 cd01141 TroA_d Periplasmic bin  40.6      26 0.00066   15.3   4.2   42   39-86     58-99  (186)
309 KOG0912 consensus               40.6      26 0.00066   15.3   2.9  127  189-327    17-159 (375)
310 TIGR01264 tyr_amTase_E tyrosin  40.6     9.5 0.00024   18.4   0.4   92  248-381   176-280 (415)
311 TIGR02124 hypE hydrogenase exp  40.4      16 0.00042   16.8   1.6   43   75-117    99-147 (345)
312 COG0771 MurD UDP-N-acetylmuram  40.3      26 0.00067   15.3   6.3   86    2-96      2-107 (448)
313 PRK00091 miaA tRNA delta(2)-is  40.3      15 0.00037   17.1   1.3  102  191-316    61-171 (304)
314 TIGR00853 pts-lac PTS system,   40.2      26 0.00067   15.3   3.5   71    6-82     45-121 (142)
315 PRK05569 flavodoxin; Provision  40.1      26 0.00067   15.3   5.4   50    8-61      2-58  (141)
316 pfam01949 DUF99 Protein of unk  39.9      26 0.00068   15.3   6.3   74  231-305    44-123 (185)
317 TIGR01036 pyrD_sub2 dihydrooro  39.7      27 0.00068   15.2   2.9   66  205-274   284-355 (370)
318 pfam04031 Las1 Las1-like. Las1  39.6      18 0.00046   16.4   1.7   58  366-433    85-144 (149)
319 pfam01633 Choline_kinase Choli  39.5      27 0.00068   15.2   2.9   15    9-23      4-18  (208)
320 COG4468 GalT Galactose-1-phosp  39.5      27 0.00069   15.2   3.9  132  281-442   321-489 (503)
321 cd02933 OYE_like_FMN Old yello  39.4      27 0.00069   15.2  10.5   56  169-230   165-226 (338)
322 COG1513 CynS Cyanate lyase [In  39.4      24 0.00062   15.5   2.4   28  373-400    47-77  (151)
323 cd06287 PBP1_LacI_like_8 Ligan  39.3      27 0.00069   15.2   6.4   67   13-85     19-85  (269)
324 cd06310 PBP1_ABC_sugar_binding  38.9      27  0.0007   15.1   5.9   67   14-85      8-88  (273)
325 pfam04362 Iron_traffic Bacteri  38.8      16 0.00041   16.8   1.4   43  387-430    10-52  (87)
326 pfam00365 PFK Phosphofructokin  38.7     8.1 0.00021   18.9  -0.2   42   52-93      3-44  (279)
327 PRK01390 murD UDP-N-acetylmura  38.4      28 0.00071   15.1   7.4   75    4-85      6-99  (457)
328 PRK05568 flavodoxin; Provision  38.2      28 0.00072   15.1   5.3   50    8-61      2-58  (142)
329 cd01021 GEWL Goose Egg White L  38.2      27 0.00068   15.2   2.4   46  175-221    90-135 (166)
330 cd03136 GATase1_AraC_ArgR_like  38.1      28 0.00072   15.1   3.6   53   40-95     56-111 (185)
331 TIGR00693 thiE thiamine-phosph  37.9      28 0.00072   15.0   5.3   73  261-334    51-140 (210)
332 pfam04937 DUF659 Protein of un  37.7      29 0.00073   15.0   3.6   55  180-239    54-108 (153)
333 KOG4380 consensus               37.4      24 0.00061   15.5   2.1   21   77-98     66-86  (244)
334 pfam04409 DUF530 Protein of un  37.3      20 0.00051   16.1   1.7   10  250-259   198-207 (512)
335 cd06267 PBP1_LacI_sugar_bindin  37.1      29 0.00074   15.0   6.1   62   18-85     16-84  (264)
336 PRK06110 hypothetical protein;  37.0      29 0.00074   14.9   2.5   48  225-281    73-120 (321)
337 TIGR01359 UMP_CMP_kin_fam UMP-  37.0      18 0.00047   16.4   1.4   43   15-61     41-89  (189)
338 TIGR02025 BchH magnesium chela  36.6      25 0.00065   15.4   2.1   22   16-39    508-529 (1384)
339 pfam11116 DUF2624 Protein of u  36.5      25 0.00064   15.4   2.1   49  261-311    32-80  (84)
340 PRK05723 flavodoxin; Provision  36.2      30 0.00077   14.9   4.9   46    9-56      2-53  (151)
341 COG3580 Uncharacterized protei  36.0      30 0.00077   14.8   3.9   45   28-88     28-75  (351)
342 PRK02155 ppnK inorganic polyph  36.0      30 0.00077   14.8   4.3   76    8-89      6-97  (291)
343 cd06274 PBP1_FruR Ligand bindi  35.7      31 0.00078   14.8   6.9   70   10-85      4-84  (264)
344 TIGR00108 eRF peptide chain re  35.5      15 0.00037   17.1   0.7   17  180-197   398-414 (425)
345 COG0773 MurC UDP-N-acetylmuram  35.3      31 0.00079   14.8   5.4  131   23-179    44-177 (459)
346 PRK10419 nikE nickel transport  35.2      31 0.00079   14.8   3.5   33  366-398   111-150 (266)
347 cd06815 PLPDE_III_AR_like_1 Ty  35.1      31  0.0008   14.7   5.4   66  234-302    99-171 (353)
348 KOG4129 consensus               34.9      31  0.0008   14.7   7.6   70  238-322   175-248 (377)
349 TIGR00673 cynS cyanate hydrata  34.5      28  0.0007   15.1   2.0   28  367-394    46-73  (156)
350 pfam07991 IlvN Acetohydroxy ac  34.4      32 0.00082   14.7   3.5   30    6-36      3-32  (165)
351 cd02021 GntK Gluconate kinase   34.3      32 0.00082   14.7   3.2   58  225-293     3-60  (150)
352 cd02932 OYE_YqiM_FMN Old yello  34.0      33 0.00083   14.6   9.8  133  169-339   167-307 (336)
353 TIGR02378 nirD_assim_sml nitri  33.8      33 0.00084   14.6   3.2   33  142-174     8-45  (117)
354 TIGR02477 PFKA_PPi diphosphate  33.6      23 0.00058   15.7   1.5   44  209-255   157-201 (566)
355 PRK08227 aldolase; Validated    33.4      33 0.00085   14.6   2.9   61  246-322   133-198 (291)
356 KOG2707 consensus               33.4      33 0.00085   14.5   4.7  105   50-178   103-211 (405)
357 TIGR01208 rmlA_long glucose-1-  33.4      21 0.00054   16.0   1.3   77  160-258   144-226 (361)
358 smart00653 eIF2B_5 domain pres  33.2      19 0.00049   16.3   1.0   77  176-254     8-85  (110)
359 cd01545 PBP1_SalR Ligand-bindi  33.2      33 0.00085   14.5   6.8   62   19-85     17-86  (270)
360 PHA01622 CRISPR-associated Cas  32.8      34 0.00086   14.5   2.9   40   13-61     49-89  (204)
361 PRK03202 6-phosphofructokinase  32.7     9.6 0.00024   18.4  -0.6   41   52-92      5-45  (323)
362 cd00674 LysRS_core_class_I Thi  32.5      34 0.00087   14.5   4.3   29   19-47     43-71  (354)
363 KOG0303 consensus               32.4      34 0.00088   14.4   4.8   33  144-178   110-142 (472)
364 PRK13403 ketol-acid reductoiso  32.1      35 0.00089   14.4   3.7   31    5-36     14-44  (335)
365 COG1636 Uncharacterized protei  32.1      35 0.00089   14.4   7.5  102  221-323     2-111 (204)
366 PRK00561 ppnK inorganic polyph  32.1      21 0.00054   16.0   1.1   66    9-89      2-67  (259)
367 cd01391 Periplasmic_Binding_Pr  32.1      35 0.00089   14.4   4.2   62   21-87     20-90  (269)
368 cd06292 PBP1_LacI_like_10 Liga  32.0      35 0.00089   14.4   6.4   67   17-85     15-89  (273)
369 cd01400 6PGL 6PGL: 6-Phosphogl  31.9      35 0.00089   14.4   9.4  112  209-331     8-129 (219)
370 PRK00683 murD UDP-N-acetylmura  31.8      35  0.0009   14.4   6.2   70    7-84      3-88  (418)
371 cd01542 PBP1_TreR_like Ligand-  31.8      35  0.0009   14.4   6.1   71   10-86      4-85  (259)
372 PRK10037 cell division protein  31.5      36 0.00091   14.3   2.9   51  225-286     5-58  (250)
373 PRK00766 hypothetical protein;  31.5      36 0.00091   14.3   7.1   76  231-307    51-133 (194)
374 COG3828 Uncharacterized protei  31.3      36 0.00091   14.3   2.4   62   76-140    77-149 (239)
375 pfam12023 DUF3511 Domain of un  31.1      25 0.00064   15.4   1.3   10  295-304     2-11  (47)
376 cd06343 PBP1_ABC_ligand_bindin  31.0      36 0.00092   14.3   4.0   14   75-88     94-107 (362)
377 PRK03846 adenylylsulfate kinas  31.0      35  0.0009   14.4   2.1   61  202-262     5-65  (198)
378 TIGR01812 sdhA_frdA_Gneg succi  30.9      15 0.00039   16.9   0.2   49  242-293   498-546 (636)
379 PTZ00340 O-sialoglycoprotein e  30.8      21 0.00054   15.9   0.9   35   49-86     76-115 (348)
380 PRK10917 ATP-dependent DNA hel  30.8      37 0.00093   14.3   7.3   93  186-284   244-341 (677)
381 TIGR00174 miaA tRNA delta(2)-i  30.5      33 0.00085   14.5   1.9  111  180-311    45-156 (307)
382 TIGR02534 mucon_cyclo muconate  30.2      19 0.00047   16.4   0.5   63  349-421   305-368 (369)
383 pfam01606 Arteri_env Arterivir  30.0     9.5 0.00024   18.4  -1.0   70  138-239    87-156 (211)
384 PRK10558 alpha-dehydro-beta-de  30.0      38 0.00096   14.2   3.6   72  198-274   185-256 (256)
385 COG1004 Ugd Predicted UDP-gluc  29.9      38 0.00096   14.2   3.1   43  391-435   301-344 (414)
386 pfam09075 STb_secrete Heat-sta  29.9      13 0.00034   17.4  -0.2   16   82-97     32-47  (48)
387 cd05294 LDH-like_MDH_nadp A la  29.7      38 0.00097   14.1   4.5   25  225-249     4-28  (309)
388 cd06275 PBP1_PurR Ligand-bindi  29.7      38 0.00097   14.1   6.8   64   17-85     15-85  (269)
389 PRK08639 threonine dehydratase  29.6      38 0.00097   14.1   7.3   27  220-246   301-328 (418)
390 PRK06756 flavodoxin; Provision  29.5      38 0.00098   14.1   4.1   46   20-69      9-56  (138)
391 cd05719 Ig2_PVR_like Second im  29.4      25 0.00064   15.4   1.1   13  166-178    70-82  (95)
392 PRK02231 ppnK inorganic polyph  29.4      38 0.00098   14.1   2.7   41   42-88     35-75  (272)
393 TIGR03239 GarL 2-dehydro-3-deo  29.2      39 0.00099   14.1   3.8   73  197-274   177-249 (249)
394 cd06285 PBP1_LacI_like_7 Ligan  29.2      39 0.00099   14.1   6.8   70   10-85      4-84  (265)
395 cd06346 PBP1_ABC_ligand_bindin  29.0      39 0.00099   14.1   4.3   33  308-341   257-293 (312)
396 pfam06611 DUF1145 Protein of u  29.0      20 0.00051   16.1   0.5   14  396-409    23-37  (61)
397 cd01467 vWA_BatA_type VWA BatA  28.8      39   0.001   14.0   3.6   72  186-257    64-142 (180)
398 pfam06414 Zeta_toxin Zeta toxi  28.7      31  0.0008   14.7   1.5   14   49-62     10-23  (191)
399 PRK02006 murD UDP-N-acetylmura  28.5      40   0.001   14.0   8.3   88    1-93      1-112 (501)
400 cd01537 PBP1_Repressors_Sugar_  28.5      40   0.001   14.0   6.7   67   14-85      8-85  (264)
401 cd06281 PBP1_LacI_like_5 Ligan  28.2      40   0.001   14.0   6.8   70   10-84      4-84  (269)
402 pfam03530 SK_channel Calcium-a  28.1      22 0.00055   15.9   0.6   12  392-403   105-116 (120)
403 cd06278 PBP1_LacI_like_2 Ligan  28.0      40   0.001   13.9   5.9   70   10-85      4-83  (266)
404 KOG3395 consensus               27.9      30 0.00077   14.8   1.3   22  288-311    29-50  (246)
405 PRK04759 consensus              27.8      41   0.001   13.9   3.4   91    1-99      1-121 (294)
406 COG1232 HemY Protoporphyrinoge  27.7      17 0.00043   16.7  -0.1   34  369-402   359-393 (444)
407 TIGR01265 tyr_nico_aTase tyros  27.5      41  0.0011   13.9   2.7   28   51-83    226-253 (424)
408 cd03334 Fab1_TCP TCP-1 like do  27.5      41  0.0011   13.9   6.8   31  206-239   116-146 (261)
409 PRK11761 cysM cysteine synthas  27.4      41  0.0011   13.9   4.1   83  195-286    32-118 (296)
410 KOG0628 consensus               27.4      41  0.0011   13.9   5.1  111  160-287   154-274 (511)
411 PRK11248 tauB taurine transpor  27.3      42  0.0011   13.8   6.0   32  207-238   103-138 (255)
412 pfam11186 DUF2972 Protein of u  27.3      42  0.0011   13.8   2.5   50  284-341   121-184 (197)
413 PRK04804 minC septum formation  27.2      42  0.0011   13.8   2.6  110   71-185    63-187 (220)
414 cd00363 PFK Phosphofructokinas  26.9      14 0.00037   17.1  -0.5   41   53-93      4-44  (338)
415 cd06303 PBP1_LuxPQ_Quorum_Sens  26.8      42  0.0011   13.8   5.0   52    9-60      1-70  (280)
416 cd01541 PBP1_AraR Ligand-bindi  26.8      42  0.0011   13.8   7.0   76   10-86      4-90  (273)
417 cd06277 PBP1_LacI_like_1 Ligan  26.7      43  0.0011   13.8   6.0   62   17-85     18-86  (268)
418 cd01528 RHOD_2 Member of the R  26.5      43  0.0011   13.8   5.6   46  212-260    48-94  (101)
419 cd02930 DCR_FMN 2,4-dienoyl-Co  26.4      43  0.0011   13.7   9.0  135  169-341   150-295 (353)
420 PRK05479 ketol-acid reductoiso  26.4      43  0.0011   13.7   3.6   31    5-36     15-45  (336)
421 COG0426 FpaA Uncharacterized f  26.1      44  0.0011   13.7   6.2   44   51-99     73-118 (388)
422 pfam03575 Peptidase_S51 Peptid  25.9      44  0.0011   13.7   3.9   75   19-93      1-83  (154)
423 PRK10116 universal stress prot  25.8      44  0.0011   13.7   3.6   34  223-256     4-40  (142)
424 cd06544 GH18_narbonin Narbonin  25.6      44  0.0011   13.6   2.0   34  199-232    47-80  (253)
425 PRK01911 ppnK inorganic polyph  25.5      45  0.0011   13.6   2.9  124   50-184    62-215 (290)
426 PRK04011 peptide chain release  25.5      25 0.00064   15.4   0.5   34  225-259   219-253 (409)
427 TIGR01919 hisA-trpF bifunction  25.4      45  0.0011   13.6   3.1  104  171-286    31-139 (246)
428 pfam00056 Ldh_1_N lactate/mala  25.3      45  0.0011   13.6   2.6   46  225-271     4-49  (142)
429 COG4126 Hydantoin racemase [Am  25.3      45  0.0011   13.6   4.0   44   50-100    69-112 (230)
430 TIGR01428 HAD_type_II haloacid  25.3      45  0.0011   13.6   2.1   41   18-61     86-126 (207)
431 pfam08665 PglZ PglZ domain. Th  25.2      45  0.0012   13.6   4.5   48  182-235    77-124 (176)
432 KOG2316 consensus               25.2      45  0.0012   13.6   3.5  165  224-421     2-187 (277)
433 cd02187 beta_tubulin The tubul  25.1      45  0.0012   13.6   3.5   63  171-245    80-154 (425)
434 PRK11914 diacylglycerol kinase  24.9      46  0.0012   13.6   5.7   77    3-85      2-91  (304)
435 COG0563 Adk Adenylate kinase a  24.8      46  0.0012   13.5   2.2   35  225-264     4-38  (178)
436 pfam00091 Tubulin Tubulin/FtsZ  24.8      46  0.0012   13.5   3.5   52  194-245    82-144 (210)
437 pfam07085 DRTGG DRTGG domain.   24.8      46  0.0012   13.5   2.2   74    8-91     22-97  (105)
438 cd06312 PBP1_ABC_sugar_binding  24.8      46  0.0012   13.5   6.1   81  234-319   166-255 (271)
439 smart00732 YqgFc Likely ribonu  24.7      17 0.00042   16.7  -0.5   25   46-71     47-71  (99)
440 COG0287 TyrA Prephenate dehydr  24.7      46  0.0012   13.5   4.8   52    6-58      2-53  (279)
441 TIGR02198 rfaE_dom_I rfaE bifu  24.7      16  0.0004   16.9  -0.6  153    7-196   113-282 (321)
442 PRK10411 DNA-binding transcrip  24.6      46  0.0012   13.5   4.2   27  171-197   141-169 (240)
443 TIGR01811 sdhA_Bsu succinate d  24.6      46  0.0012   13.5   1.8   49  374-423   456-504 (620)
444 pfam08929 DUF1911 Domain of un  24.4      47  0.0012   13.5   2.9   26  375-400    83-109 (111)
445 cd07186 CofD_like LPPG:FO 2-ph  24.4      47  0.0012   13.5   5.2   55  169-224   159-215 (303)
446 TIGR01016 sucCoAbeta succinyl-  24.3      27 0.00069   15.2   0.5   48  227-274   287-338 (389)
447 cd06557 KPHMT-like Ketopantoat  24.1      47  0.0012   13.5   3.9   13   73-85    121-133 (254)
448 cd01536 PBP1_ABC_sugar_binding  24.1      47  0.0012   13.5   7.2   72   10-85      4-86  (267)
449 pfam03613 EIID-AGA PTS system   24.1      39 0.00099   14.1   1.3   16  290-307    40-55  (264)
450 TIGR02653 Lon_rel_chp conserve  24.1      47  0.0012   13.4   2.0   90   21-115   206-316 (677)
451 TIGR02055 APS_reductase adenyl  24.1      47  0.0012   13.4   5.1  143  232-400     3-167 (200)
452 cd01518 RHOD_YceA Member of th  24.0      47  0.0012   13.4   4.7   44  216-262    55-99  (101)
453 cd02197 HypE HypE (Hydrogenase  24.0      32 0.00082   14.6   0.9   35  375-417   238-272 (293)
454 PRK01231 ppnK inorganic polyph  24.0      48  0.0012   13.4   3.8   76    8-89      5-96  (296)
455 PRK11303 DNA-binding transcrip  23.9      48  0.0012   13.4   8.3   77    4-85     58-147 (330)
456 KOG0174 consensus               23.9      29 0.00075   14.9   0.6   44  192-237   153-196 (224)
457 pfam09656 PGPGW Putative trans  23.8      21 0.00054   16.0  -0.1   14  396-409    19-32  (53)
458 pfam08190 PIH1 pre-RNA process  23.7      46  0.0012   13.5   1.6   29  169-197    98-126 (325)
459 TIGR02080 O_succ_thio_ly O-suc  23.7      17 0.00044   16.6  -0.6   32  231-262   328-362 (383)
460 cd06320 PBP1_allose_binding Pe  23.6      48  0.0012   13.4   6.8   97  221-318   152-253 (275)
461 TIGR03676 aRF1/eRF1 peptide ch  23.6      38 0.00097   14.1   1.2   35  225-260   212-247 (403)
462 pfam06483 ChiC Chitinase C. Th  23.6      48  0.0012   13.4   1.8   18   16-33      5-22  (179)
463 cd06333 PBP1_ABC-type_HAAT_lik  23.4      49  0.0012   13.4   6.2   14  307-320   262-275 (312)
464 cd00717 URO-D Uroporphyrinogen  23.4      49  0.0012   13.4   3.0  123  206-339   111-250 (335)
465 cd06282 PBP1_GntR_like_2 Ligan  23.3      49  0.0012   13.3   6.8   69   11-84      5-84  (266)
466 pfam03421 YopJ YopJ Serine/Thr  23.3      46  0.0012   13.5   1.5   22  273-294    42-63  (178)
467 COG3048 DsdA D-serine dehydrat  23.3      49  0.0012   13.3   2.4   58  216-291   161-218 (443)
468 COG5552 Uncharacterized conser  23.1      49  0.0013   13.3   1.7   48  267-321     4-52  (88)
469 pfam06490 FleQ Flagellar regul  22.9      50  0.0013   13.3   4.3   73    9-85      1-75  (109)
470 PTZ00285 glucosamine-6-phospha  22.8      50  0.0013   13.3   8.4  105  211-330    19-137 (253)
471 KOG2275 consensus               22.8      45  0.0012   13.6   1.4  255   85-396    49-324 (420)
472 cd06268 PBP1_ABC_transporter_L  22.8      50  0.0013   13.3   3.7   16   75-90     86-101 (298)
473 PRK08558 adenine phosphoribosy  22.5      51  0.0013   13.2   2.1   28  163-191   199-226 (238)
474 KOG4328 consensus               22.5      51  0.0013   13.2   1.8   31  162-192   181-217 (498)
475 pfam07796 DUF1638 Protein of u  22.5      51  0.0013   13.2   4.4   48  246-293   115-162 (166)
476 cd03556 L-fucose_isomerase L-f  22.5      51  0.0013   13.2   4.2   51  367-419   406-460 (584)
477 TIGR03174 cas_Csc3 CRISPR-asso  22.3      36 0.00093   14.3   0.8   62  228-300   395-460 (953)
478 COG4047 Uncharacterized protei  22.2      24 0.00061   15.6  -0.1   39  214-252    16-57  (243)
479 PRK11083 DNA-binding response   22.2      51  0.0013   13.2   5.6   89    7-99      3-99  (229)
480 PRK13777 transcriptional regul  22.2      51  0.0013   13.2   1.8   21  302-322   152-172 (190)
481 COG1647 Esterase/lipase [Gener  22.2      51  0.0013   13.2   2.1  163  132-331    16-190 (243)
482 cd06950 NR_LBD_Tlx_PNR_like Th  22.2      18 0.00045   16.5  -0.8   43  175-220    26-68  (206)
483 PRK12305 thrS threonyl-tRNA sy  22.1      51  0.0013   13.2   4.1   21   65-85     50-73  (576)
484 pfam01380 SIS SIS domain. SIS   22.1      52  0.0013   13.2   4.4   86    6-94      4-96  (131)
485 pfam09949 DUF2183 Uncharacteri  22.0      52  0.0013   13.2   5.5   70  183-256    26-98  (100)
486 pfam02614 UxaC Glucuronate iso  22.0      52  0.0013   13.2   1.8  204  147-394   133-344 (465)
487 PRK12933 secD preprotein trans  21.9      50  0.0013   13.3   1.5   47  208-256   231-290 (604)
488 cd01575 PBP1_GntR Ligand-bindi  21.8      52  0.0013   13.1   7.1   68   10-83      4-82  (268)
489 pfam02548 Pantoate_transf Keto  21.8      52  0.0013   13.1   3.7   29    5-36     13-41  (261)
490 cd06271 PBP1_AglR_RafR_like Li  21.8      52  0.0013   13.1   6.9   63   17-85     19-88  (268)
491 cd01085 APP X-Prolyl Aminopept  21.8      50  0.0013   13.3   1.5   18    2-19     76-93  (224)
492 cd06315 PBP1_ABC_sugar_binding  21.8      52  0.0013   13.1   2.6   38   43-84     49-86  (280)
493 KOG2011 consensus               21.7      41   0.001   13.9   1.0   28  189-216   116-143 (1048)
494 cd01423 MGS_CPS_I_III Methylgl  21.6      53  0.0013   13.1   4.5   60   24-83     36-105 (116)
495 smart00427 H2B Histone H2B.     21.6      44  0.0011   13.7   1.1   23  174-196    13-35  (89)
496 cd05296 GH4_P_beta_glucosidase  21.6      51  0.0013   13.2   1.5   58   23-96    114-176 (419)
497 COG4077 Uncharacterized protei  21.4      45  0.0011   13.6   1.2   27  307-335    75-101 (156)
498 KOG1975 consensus               21.3      27 0.00069   15.2   0.0   18  379-398   301-318 (389)
499 TIGR00434 cysH phosophoadenyly  21.2      54  0.0014   13.1   4.4   61  223-285    14-81  (226)
500 PRK01438 murD UDP-N-acetylmura  21.2      54  0.0014   13.1   6.8   77    2-84      9-106 (481)

No 1  
>PRK00074 guaA GMP synthase; Reviewed
Probab=100.00  E-value=0  Score=1750.15  Aligned_cols=512  Identities=59%  Similarity=1.006  Sum_probs=505.0

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEE
Q ss_conf             44886999988970578899888865940698528989889972399799998538899999997537689808998899
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLG   84 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILG   84 (520)
                      .++++|+||||||||||||||||||+||||||+|+++++++++..+|+||||||||+|||++++|++++++|++++||||
T Consensus         2 ~~~~~IlIlDFGSQytqLIaRRvRElgVysEI~p~~~~~~~i~~~~pkgIILSGGP~SV~~~~aP~~d~~if~l~IPILG   81 (513)
T PRK00074          2 IHHDKILILDFGSQYTQLIARRVRELGVYSEIVPYDISAEEIRAFNPKGIILSGGPASVYEEGAPRADPEIFELGVPVLG   81 (513)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEE
T ss_conf             87686999988964999999999823835999669999899850499789988999636899998899899826998699


Q ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEE
Q ss_conf             77899998997096999869866103667523886222787266553368600220110124442112323983178898
Q gi|254780414|r   85 ICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIA  164 (520)
Q Consensus        85 ICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~  164 (520)
                      ||||||+||+.|||+|++++.+|||++.+.+.++++||+|+   +..++|||||+|+|+++|+||+++|+|+|+++|||+
T Consensus        82 ICYG~Qlia~~~GG~V~~s~~rEyG~a~l~i~~~s~Lf~gl---~~~~~VWMSHgD~V~~lP~gF~viA~s~n~~iAai~  158 (513)
T PRK00074         82 ICYGMQLMAHQLGGKVERAGKREYGRAELEVDGDSALFKGI---PEEQDVWMSHGDKVTELPEGFKVIASTENCPIAAIA  158 (513)
T ss_pred             ECHHHHHHHHHHCCEEEECCCCEECCEEEEEECCCCCCCCC---CCCCEEEEECCCCEEECCCCCEEEEECCCCCEEEEE
T ss_conf             75889999998599998569601121489991587333689---986368875243014379984799954997367898


Q ss_pred             ECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             63500112465212221520257799875501064411140678999999997650444036640564047799999986
Q gi|254780414|r  165 DEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE  244 (520)
Q Consensus       165 ~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~k  244 (520)
                      |.++++||+||||||+||++|++||+||+|+||+|++||+|++|+++++++||++||++||||||||||||||||+|+||
T Consensus       159 ~~~~~iyGvQFHPEV~HT~~G~~iL~NFl~~Ic~~~~~Wt~~~~i~~~i~~Ik~~Vg~~kVi~~lSGGVDStV~A~Ll~k  238 (513)
T PRK00074        159 NEERKFYGVQFHPEVTHTEQGKKLLENFVFDICGCKGDWTMENFIEEAIEEIREQVGDKKVILGLSGGVDSSVAAVLLHK  238 (513)
T ss_pred             ECCCCEEEEECCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             06786788702863453177579999999998788977637899999999999983876289972388308999999999


Q ss_pred             HCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             22365699997389551562789999886236985799758899999966898889999887565899999999743997
Q gi|254780414|r  245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGA  324 (520)
Q Consensus       245 Aig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~  324 (520)
                      |||+||+|||||||||||||+++|++.|++++|+|+++|||+++||++|+||+|||+||||||++||+||+++|++++++
T Consensus       239 AIGd~l~cvfVD~GllRknE~~~V~~~~~~~lgl~~~~vdA~~~Fl~~L~gv~DPE~KRKIIG~~FI~vfe~~a~~~~~~  318 (513)
T PRK00074        239 AIGDQLTCVFVDHGLLRKNEAEQVMEMFREHFGLNLIHVDASDRFLSALAGVTDPEEKRKIIGREFIEVFEEEAKKLGGV  318 (513)
T ss_pred             HHHHCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             85112489995377111672999999998861996799224899999737998979967887789999999999757998


Q ss_pred             EEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCE
Q ss_conf             09986462202454202467776303443023201132032022378987389999999981999889426888983111
Q gi|254780414|r  325 QFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLA  404 (520)
Q Consensus       325 ~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLa  404 (520)
                      +||||||||||||||++. +++|++|||||||||||++|++||+||||+|||||||+||++||||+++++||||||||||
T Consensus       319 ~~L~QGTlYPDvIES~~~-~~~a~~IKsHHNVgglp~~~~~~lvEPlr~lfKDEVR~lg~~Lglp~~~~~RhPFPGPGLa  397 (513)
T PRK00074        319 KFLAQGTLYPDVIESASG-TGKAATIKSHHNVGGLPEDMKLKLVEPLRELFKDEVRKLGLELGLPEEIVYRHPFPGPGLA  397 (513)
T ss_pred             CEEECCCCCCCEEEECCC-CCCCCCCCCCCCCCCCHHHCCCEEEEEHHHHCCHHHHHHHHHHCCCHHHHCCCCCCCCCHH
T ss_conf             399646765506884798-9998860487758788566487545031756158999999996897776024899997444


Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCC
Q ss_conf             22100036789999999999999999864653332201045568632421599854144799963216877558710189
Q gi|254780414|r  405 IRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD  484 (520)
Q Consensus       405 iRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~  484 (520)
                      |||+||+|+||+++||+||+||+++|+++|||+++|||||||||+||||||||+|||+|+|+||+|+|.|||||+|+++|
T Consensus       398 iRi~Gevt~e~~~ilr~ad~I~~~~l~~~~ly~~i~Q~favllpvksvGV~Gd~R~y~~~~~lR~v~s~D~MTa~~~~~p  477 (513)
T PRK00074        398 IRILGEVTKEKLDILREADAIFIEELRKAGLYDKIWQAFAVLLPVRSVGVMGDGRTYDYVVALRAVTSIDGMTADWARLP  477 (513)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHCEEEEECCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCC
T ss_conf             30334357889999998889999999875760105451079717632564899755577589997864776504754499


Q ss_pred             HHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             899998755750487981257860894179766689
Q gi|254780414|r  485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       485 ~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
                      |++|+++|+||+|||+||||||||||||||||||||
T Consensus       478 ~~~L~~is~rI~nev~gv~rV~yDitsKPP~TiEwE  513 (513)
T PRK00074        478 YDFLEKISNRIINEVKGVNRVVYDITSKPPATIEWE  513 (513)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             999999999987618983269986899899786679


No 2  
>KOG1622 consensus
Probab=100.00  E-value=0  Score=1348.69  Aligned_cols=515  Identities=44%  Similarity=0.758  Sum_probs=499.2

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             34488699998897057889988886594069852898988997239979999853889999999753768980899889
Q gi|254780414|r    4 RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus         4 ~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      ....++|+||||||||+|+|+||+||++||+|++|+++++..+.+.+|+||||||||+|||+++||++|+++|++++|+|
T Consensus        13 ~~~~d~i~iLD~GaQY~~~I~RrvRel~v~se~~p~~t~~~~i~~~~~rgiIiSGGP~SVya~dAP~~dp~if~~~vpvL   92 (552)
T KOG1622          13 SSYFDTILILDFGAQYGKVIDRRVRELNVQSEILPLTTPAKTITEYGPRGIIISGGPNSVYAEDAPSFDPAIFELGVPVL   92 (552)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHCCCCCCE
T ss_conf             55576389994441243788989988754331013777156664479429998189873226768889836713277430


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEE
Q ss_conf             97789999899709699986986610366752388622278726655336860022011012444211232398317889
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFI  163 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai  163 (520)
                      |||||||+|++.+||.|.+...||||..+|.+...+.+|.++... ....|||||||++.++|+||++.|.|.+.+++++
T Consensus        93 GICYGmQ~i~~~~Gg~V~~~~~RE~G~~eI~v~~~~~lF~~~~~~-~~~~VlltHgdsl~~v~~g~kv~a~s~n~~va~i  171 (552)
T KOG1622          93 GICYGMQLINKLNGGTVVKGMVREDGEDEIEVDDSVDLFSGLHKT-EFMTVLLTHGDSLSKVPEGFKVVAFSGNKPVAGI  171 (552)
T ss_pred             EEHHHHHHHHHHHCCCCCCCCCCCCCCCEEECCCHHHHHHHHCCC-CEEEEEECCCCCHHHCCCCCEEEEEECCCCEEEE
T ss_conf             201679999998387502462357787347758615665432324-1036610056206444454246776168612211


Q ss_pred             EECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             86350011246521222152025779987550106441114067899999999765044403664056404779999998
Q gi|254780414|r  164 ADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY  243 (520)
Q Consensus       164 ~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~  243 (520)
                      .|+.+++||+||||||+||++|++||+||+|+||+|++||+|+|+.+++|.+||+.||+.+||+++||||||||||+|++
T Consensus       172 ~~e~kkiyglqfhpEV~~t~~g~~ll~nFl~~vc~~~~n~tmenre~e~I~~i~k~vG~~~Vl~~vSGgvdStV~a~Ll~  251 (552)
T KOG1622         172 LNELKKIYGLQFHPEVTLTPNGKELLKNFLFDVCGCSGNFTMENREEECINEIRKWVGDYKVLVAVSGGVDSTVCAALLR  251 (552)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
T ss_conf             01100320678888310367566899989998717766751103568899999998464455998348850899999999


Q ss_pred             HHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             6223-656999973895515627899998862369857997588999999668988899998875658999999997439
Q gi|254780414|r  244 EAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIG  322 (520)
Q Consensus       244 kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~  322 (520)
                      +|+| +|++|++||||||||+|+++|++.+.. +|++++++||+++|+++|+|++|||+||||||++||+||++++.++.
T Consensus       252 ~alg~~R~~ai~vdNG~mrk~Ea~~V~~tl~~-lgi~i~v~~as~~f~s~L~~~~dPE~KRkiIG~tfikv~~~~~~~l~  330 (552)
T KOG1622         252 RALGPDRVHAIHVDNGFMRKKEAEQVEKTLVY-LGIPITVVDASETFLSKLKGVTDPEEKRKIIGRTFIKVFDPVASELN  330 (552)
T ss_pred             HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHH-CCCCEEEEECHHHHHHHHCCCCCHHHHCEECCCCEEEECCHHHHHHH
T ss_conf             86378944899812640103677889999997-38844996215888876126688788161024200240767888752


Q ss_pred             -----CCEEEEECCCCCHHHHHHCCCCC-CCCEEEEEECCCCHHHHH-CC-CHHHHHHHHHHHHHHHHHHHHCCCHHHHC
Q ss_conf             -----97099864622024542024677-763034430232011320-32-02237898738999999998199988942
Q gi|254780414|r  323 -----GAQFLGQGTLYPDVIESISFFGG-PSSIIKSHHNVGGLPEHM-DM-KLVEPLKELFKDEVRLLGKELRLPDSFVE  394 (520)
Q Consensus       323 -----~~~~L~QGTlypDvIES~~~~~~-~~~~IKsHHNvgglp~~~-~~-~liEPl~~l~KdEVR~lg~~Lglp~~~~~  394 (520)
                           ...||||||||||+|||++..++ +|++||||||++||+++| ++ |++|||++|||||||+||+.||+|+++++
T Consensus       331 ~k~~~~~~flaQgtL~Pd~ieS~s~~g~~~a~tIKThhn~~~L~r~lrklgK~ieplk~~~kDEvr~lgk~lGlp~~Lv~  410 (552)
T KOG1622         331 KKHGEKESFLAQGTLRPDLIESASVYGSGHAETIKTHHNDTGLIRDLRKLGKVIEPLKDFHKDEVRELGKDLGLPESLVP  410 (552)
T ss_pred             HCCCCCCEEEECCCCCCHHHHHCCCCCCCHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHC
T ss_conf             06576000443350141044313456773454420102550589999983165742678888999876665087243202


Q ss_pred             CCCCCCCCCEEEECCCCCH---HHHHHHHHHHHHHHHHHH-HCCCHHHHHHHH---EEECCCCCCCCCCCCCCCCCEEEE
Q ss_conf             6888983111221000367---899999999999999998-646533322010---455686324215998541447999
Q gi|254780414|r  395 RHPCPGPGLAIRCIGEITE---ERINILRESDAIYREEIH-KAGIYRKIWQAF---TVLLPVQTVGVMGDERTYEYVCSL  467 (520)
Q Consensus       395 RhPFPGPGLaiRi~g~vt~---e~~~i~r~ad~i~~~~l~-~~~ly~~~~q~~---avllp~~svGv~GD~R~y~~~~~l  467 (520)
                      ||||||||||||+||+++.   ..++++|++|.+|+++++ ++++|+.+||+|   |.+||+||||||||.|+|+|+|+|
T Consensus       411 rhPfpGPgLaIRvL~~~~~~~~~~~~ii~~~~~~f~~~i~~~~glye~i~q~f~~~A~llpirtvGVqgDkrsys~vial  490 (552)
T KOG1622         411 RHPFPGPGLAIRVLCAVTARDLPQLEIIRKVDRIFIKSIRKDHGLYERIIQAFQIPARLLPIRTVGVQGDKRSYSYVIAL  490 (552)
T ss_pred             CCCCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCEECCEEEEEEECCCCEECEEEEC
T ss_conf             58999987278875214555552778999999999988532401588887525676233212346642364000217843


Q ss_pred             -----EEEECCCCCCCCCCC----CCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             -----632168775587101----89899998755750487981257860894179766689
Q gi|254780414|r  468 -----RAVTSIDGMTADFYH----HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       468 -----r~v~s~d~mta~~~~----~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
                           |+++|.|||||+|+.    +|.++|.+++++|.|+|+|||||+||+|||||||+|||
T Consensus       491 PPr~~R~~~t~DFMTg~p~~pg~e~p~k~l~kmvt~I~nkv~GIsRVlyDlTSKPPgTtEWE  552 (552)
T KOG1622         491 PPRPLRAFTTSDFMTGDPATPGNEFPVKFLLKMVTEICNKVPGISRVLYDLTSKPPGTTEWE  552 (552)
T ss_pred             CCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCC
T ss_conf             78666632414432368889776163999999999998608547777763046999875789


No 3  
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674   The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme. The ammonia intermediate does not dissociate into solution during the chemical transformations . GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. The C-terminal domain is specific to the GMP synthases 6.3.5.2 from EC. In prokaryotes this domain mediates dimerisation. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains .; GO: 0003922 GMP synthase (glutamine-hydrolyzing) activity, 0005524 ATP binding, 0006164 purine nucleotide biosynthetic process, 0006177 GMP biosynthetic process.
Probab=100.00  E-value=0  Score=1271.18  Aligned_cols=314  Identities=64%  Similarity=1.029  Sum_probs=308.9

Q ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH
Q ss_conf             78999999997650444036640564047799999986223656999973895515627899998862369857997588
Q gi|254780414|r  207 SYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS  286 (520)
Q Consensus       207 ~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~  286 (520)
                      +|+++.|++||++|||+||||||||||||||||+|+|||||||||||||||||||+||.|+|+++|++.+|+|+.+|||+
T Consensus         1 ~fi~~~i~~ir~~VGD~~vi~ALSGGVDSsV~A~L~hrAIGD~L~~vFVD~GLlR~gE~E~V~~~F~~~lg~nl~~VDA~   80 (319)
T TIGR00884         1 NFIEEAIEEIREQVGDAKVIIALSGGVDSSVAAVLLHRAIGDRLTCVFVDHGLLRKGEAERVVKTFSDKLGLNLVVVDAK   80 (319)
T ss_pred             CHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEECCC
T ss_conf             93688999998522884689981088158999999986422760489822788876637899999875308982787610


Q ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC---CEEEEECCCCCHHHHHHCCCC-CCCCEEEEEECCCCHHHH
Q ss_conf             9999996689888999988756589999999974399---709986462202454202467-776303443023201132
Q gi|254780414|r  287 ERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGG---AQFLGQGTLYPDVIESISFFG-GPSSIIKSHHNVGGLPEH  362 (520)
Q Consensus       287 ~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~---~~~L~QGTlypDvIES~~~~~-~~~~~IKsHHNvgglp~~  362 (520)
                      |+||++|+||+|||+||||||++||+|||++|+++++   ++||+|||||||||||++..| +.|++|||||||||||++
T Consensus        81 e~FL~~L~GV~DPE~KRKIIG~~FI~VFE~~A~~~~~~~~a~yL~QGTlYPDvIES~~~kG~~~a~~IKsHHNVGGLP~~  160 (319)
T TIGR00884        81 ERFLSALKGVTDPEEKRKIIGRVFIEVFEREAEKIGDKKKAEYLVQGTLYPDVIESASSKGTSGAATIKSHHNVGGLPED  160 (319)
T ss_pred             HHHHHHCCCCCCCHHHCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             79887528898703413112256677788899850799779999734344746460230477647645631066888542


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
Q ss_conf             03202237898738999999998199988942688898311122100036789999999999999999864653332201
Q gi|254780414|r  363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQA  442 (520)
Q Consensus       363 ~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~  442 (520)
                      |+||||||||+|||||||+||++||||++|++|||||||||||||+||||+||++|+|+||+||+||++++|||+++|||
T Consensus       161 m~l~LvEPLR~LfKDEVR~lG~~LGlP~ei~~R~PFPGPGLAvRv~GEVt~e~l~i~R~AD~Iv~EE~~~~gL~~~~WQa  240 (319)
T TIGR00884       161 MKLKLVEPLRELFKDEVRKLGKELGLPEEIVWRHPFPGPGLAVRVLGEVTKEKLEILREADAIVREELKKAGLYDKLWQA  240 (319)
T ss_pred             CEEEEECCCHHCCHHHHHHHHHHCCCCHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCEE
T ss_conf             60258754023021789999987188679964783686962278861667799999763060488999862788885256


Q ss_pred             HEEECC-CCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             045568-632421599854144799963216877558710189899998755750487981257860894179766689
Q gi|254780414|r  443 FTVLLP-VQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       443 ~avllp-~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
                      |||||| |||||||||.|+|+|+|+||+|+|.|||||+|+++||++|++||+||||||++|||||||||||||||||||
T Consensus       241 FaVLl~~v~svGV~GD~R~Y~~~i~lR~V~S~DgMTA~~~~~Pyd~L~ris~RItnEv~~V~RVVYDITsKPPaTIEwE  319 (319)
T TIGR00884       241 FAVLLPSVKSVGVMGDVRTYGYVIALRAVESIDGMTADWARLPYDLLERISNRITNEVPGVNRVVYDITSKPPATIEWE  319 (319)
T ss_pred             EEEECCCEEEEEEECCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCC
T ss_conf             4778488017665278540177889987615266636765389889988821100122884079985167349753359


No 4  
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=1110.14  Aligned_cols=315  Identities=63%  Similarity=1.042  Sum_probs=311.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             11406789999999976504440366405640477999999862236569999738955156278999988623698579
Q gi|254780414|r  202 NWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       202 ~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
                      +|+|++|+++++++||++|||+||||||||||||||+|+|+||||||||+|||||||||||||.++|+++|..++++|++
T Consensus         1 ~w~~~~~ie~~i~~ir~~vg~~kvi~alSGGVDSsv~a~L~~~AiGd~l~cvfVD~GLlR~~E~e~V~~~f~~~~~~nl~   80 (315)
T COG0519           1 MWTMENFIEEAIEEIREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQLTCVFVDHGLLRKGEAEQVVEMFREHLGLNLI   80 (315)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             98878989999999999728853999833878089999999997405248999637743478569999998753298459


Q ss_pred             EEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHH
Q ss_conf             97588999999668988899998875658999999997439970998646220245420246777630344302320113
Q gi|254780414|r  282 VVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE  361 (520)
Q Consensus       282 ~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~  361 (520)
                      +|||+++||++|+||+|||+||||||++||+|||++|++++ ++||+|||||||||||+   +|++.+|||||||||||+
T Consensus        81 ~VdA~~~Fl~~L~GvtDPE~KRKiIG~~Fi~VFe~ea~k~~-~~~LaQGTiYpDvIES~---~g~~~~IKSHHNVGGLP~  156 (315)
T COG0519          81 VVDAKDRFLSALKGVTDPEEKRKIIGREFIEVFEEEAKKLG-AEFLAQGTIYPDVIESG---TGKAGTIKSHHNVGGLPE  156 (315)
T ss_pred             EECHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEECCCCCCEEEEC---CCCCCCCCCCCCCCCCCC
T ss_conf             97549889988439998899899987999999999998578-60687044345046506---888886213562688950


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             20320223789873899999999819998894268889831112210003678999999999999999986465333220
Q gi|254780414|r  362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQ  441 (520)
Q Consensus       362 ~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q  441 (520)
                      +|+|||+||||+|||||||+||++||||++++||||||||||||||+||||+||++|||+||+||++||.++|||+++||
T Consensus       157 ~m~lkLvEPLr~LfKDEVR~lg~~LGlp~~iv~RhPFPGPGLaiRilGevt~Ekl~ilR~Ad~I~~eEl~~agly~~~wQ  236 (315)
T COG0519         157 DMKLKLVEPLRELFKDEVRELGRELGLPEEIVYRHPFPGPGLAVRILGEVTREKLEILREADAIVEEELRKAGLYDKIWQ  236 (315)
T ss_pred             CCCEEEEHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
T ss_conf             14222307789886899999999859988884048999998678962544799999998876999999986475201467


Q ss_pred             HHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             1045568632421599854144799963216877558710189899998755750487981257860894179766689
Q gi|254780414|r  442 AFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       442 ~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
                      |||||||+||||||||.|||+|+++||||+|.|||||+|+++||++|+++|+||+|||++|||||||||||||||||||
T Consensus       237 aFavll~vksvGV~GD~RtY~~~valRaV~s~D~MTa~~~~lp~~~L~~is~RI~nEv~~V~RVvYDItsKPPaTIEwE  315 (315)
T COG0519         237 AFAVLLPVKSVGVMGDGRTYGYVVALRAVESIDGMTADWARLPYDVLEKISNRITNEVPGVNRVVYDITSKPPATIEWE  315 (315)
T ss_pred             HHHHCCCCCEEEECCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             7762015411112477755574489998842444314665388999999987763217886368854799899785579


No 5  
>PRK00919 GMP synthase subunit B; Validated
Probab=100.00  E-value=0  Score=1079.54  Aligned_cols=305  Identities=54%  Similarity=0.857  Sum_probs=299.7

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             40678999999997650444036640564047799999986223656999973895515627899998862369857997
Q gi|254780414|r  204 VMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV  283 (520)
Q Consensus       204 ~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~v  283 (520)
                      +|++|++++|++||++||++||||||||||||||||+|+|||||+||+||||||||||+||+++|++.|++  ++|+++|
T Consensus         2 n~~~fi~~~i~~Ir~~Vg~~kvi~~lSGGVDStV~A~Ll~kAig~~l~~v~VD~GllR~~E~~~V~~~~~~--~~~l~~v   79 (306)
T PRK00919          2 DPEKFIEEAIEEIREEVGDGKAIIALSGGVDSSVAAVLAHRAIGDRLLAVYVDTGLMRKGETERIREIFKD--GLNLRIV   79 (306)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHH--CCCCEEE
T ss_conf             87999999999999984898599991688479999999998864265999986898879869999999983--5892898


Q ss_pred             EHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             58899999966898889999887565899999999743997099864622024542024677763034430232011320
Q gi|254780414|r  284 DASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM  363 (520)
Q Consensus       284 da~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~  363 (520)
                      ||+++||++|+||+|||+||||||++||+||+++++++ +++||||||||||+|||++       +|||||||||||++|
T Consensus        80 da~~~Fl~~L~gv~DPE~KRKiIG~~Fi~vfe~~~~~~-~~~~LaQGTlyPDvIES~~-------~IKSHHNVggLp~~m  151 (306)
T PRK00919         80 DASDRFLEALKGVTDPEEKRKIIGETFIRVFEEVAKEI-GAEYLVQGTIAPDWIESEG-------GIKSHHNVGGLPEGM  151 (306)
T ss_pred             EHHHHHHHHHCCCCCHHHCCCHHHHHHHHHHHHHHHHH-CCCEEEECEECCCHHHCCC-------CCCCCCCCCCCHHHC
T ss_conf             34999999737998956746025799999999999982-9876851107376020467-------643416688773323


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             32022378987389999999981999889426888983111221000367899999999999999998646533322010
Q gi|254780414|r  364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAF  443 (520)
Q Consensus       364 ~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~~  443 (520)
                      ++||+||||+|||||||+||++||||+++++|||||||||||||+|++|+||++++|+||+|++++++++++  ++||||
T Consensus       152 ~~kliEPLr~LfKDEVR~lG~~LGlp~~iv~RhPFPGPGLaiRilGevt~ekl~ilr~ad~I~~~el~~~~l--~~wQ~f  229 (306)
T PRK00919        152 VLKIVEPLRDLYKDEVREVARALGLPEEISERMPFPGPGLAVRILGEVTPEKLAIVREANAIVEEEIEKAGL--KPWQYF  229 (306)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHCCC--HHHHCC
T ss_conf             563103189985599999999969788870458999963444203667615789999987999999997471--332141


Q ss_pred             EEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             45568632421599854144799963216877558710189899998755750487981257860894179766689
Q gi|254780414|r  444 TVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE  520 (520)
Q Consensus       444 avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiewE  520 (520)
                      |+|||+||||||||+|||+|+|+||||+|.|||||+|+++||++|+++|+||+|+|++|||||||||||||||||||
T Consensus       230 avllpvksVGV~GD~RtY~y~valRaV~S~D~MTA~~~~~p~~~L~~is~rI~nev~~VnRVvYDitsKPPaTIEwE  306 (306)
T PRK00919        230 AALLGVKATGVKGDIRAYGWIVAVRAVESRDGMTADAPELPWEVLQRISSRITSEIPEVARVVYDITPKPPATIEFE  306 (306)
T ss_pred             EEECCCCCCEECCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCC
T ss_conf             89707746415799555465699998606775417776799999999999961507985569887899899683479


No 6  
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.
Probab=100.00  E-value=0  Score=1060.08  Aligned_cols=295  Identities=65%  Similarity=1.034  Sum_probs=291.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             03664056404779999998622365699997389551562789999886236985799758899999966898889999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
                      ||+|||||||||||||+|+|||||+||+|||||||||||||+++|++.|++++++|++++||+++||++|+|++|||+||
T Consensus         1 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVDnGlmRk~E~e~V~~~~~~~~~~~~~~vdas~~Fl~~L~gv~DPE~KR   80 (295)
T cd01997           1 KVILALSGGVDSTVAAVLLHKAIGDRLTCVFVDNGLLRKNEAERVEELFSKLLGINLIVVDASERFLSALKGVTDPEEKR   80 (295)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCCHHHHH
T ss_conf             98999057828999999999886505699998589788882999999998706997799566999999865877925636


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             88756589999999974399709986462202454202467776303443023201132032022378987389999999
Q gi|254780414|r  304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLG  383 (520)
Q Consensus       304 kiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg  383 (520)
                      ||||++||+||+++++++++++||||||||||+|||++. .++|++|||||||||||++|+++|+||||+|||||||+||
T Consensus        81 KiIG~~Fi~vf~~~~~~~~~~~~L~QGTlyPDvIES~~~-~~~a~~IKsHHNvggLp~~~~~kliEPLr~LfKDEVR~lG  159 (295)
T cd01997          81 KIIGETFIEVFEEEAKKLGLAEYLAQGTLYPDVIESGSG-KGSADTIKSHHNVGGLPEDMKLKLIEPLRDLFKDEVRELG  159 (295)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCEEECCCC-CCCCCEEEEECCCCCCCHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             565389999999999755886189724302625750788-8887514522456777232265400167887459999999


Q ss_pred             HHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHEEECCCCCCCCCCCCCCCCC
Q ss_conf             98199988942688898311122100036789999999999999999864653332201045568632421599854144
Q gi|254780414|r  384 KELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEY  463 (520)
Q Consensus       384 ~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~~avllp~~svGv~GD~R~y~~  463 (520)
                      ++||||+++++|||||||||||||+||+|+||++++|+||+||+++++++++|+++|||||+|||+||||||||+|||+|
T Consensus       160 ~~LGlp~~iv~RhPFPGPGLaiRilgevt~ek~~ilr~ad~i~~~el~~~~ly~~~~Q~favllpvksVGV~GD~RtY~~  239 (295)
T cd01997         160 RELGLPEEIVERHPFPGPGLAVRILGEVTEEKLEILREADAIVEEELEKAGLYDKIWQAFAVLLPIKSVGVMGDQRTYGY  239 (295)
T ss_pred             HHHCCCHHHEEECCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCEEEECCCCCCCCC
T ss_conf             98689788822079999870354046688899999999999999999971044660003179837704424798655577


Q ss_pred             EEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             79996321687755871018989999875575048798125786089417976668
Q gi|254780414|r  464 VCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEW  519 (520)
Q Consensus       464 ~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~ydit~Kpp~tiew  519 (520)
                      +|+||+|+|.|||||+|+++||++|++||+||+|||+|||||+|||||||||||||
T Consensus       240 ~valR~v~s~D~MTA~~~~~p~~~L~~is~rI~nev~gI~RVvYDiTsKPPaTIEw  295 (295)
T cd01997         240 VVALRAVESSDFMTADWARLPYEVLEKISNRITNEVPGVNRVVYDITSKPPATIEW  295 (295)
T ss_pred             EEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCC
T ss_conf             48999784477732266679999999999999873898017997389988988889


No 7  
>TIGR00888 guaA_Nterm GMP synthase, N-terminal domain; InterPro: IPR004739   The N-terminal region of GMP synthase 6.3.5.2 from EC is recognised by this signature. GMP synthase catalyzes the synthesis of GMP from XMP , .  ATP + xanthosine 5'-phosphate + L-glutamine + H(2)O = AMP + diphosphate + GMP + L-glutamate ; GO: 0003922 GMP synthase (glutamine-hydrolyzing) activity, 0005524 ATP binding, 0006177 GMP biosynthetic process.
Probab=100.00  E-value=0  Score=622.92  Aligned_cols=191  Identities=46%  Similarity=0.853  Sum_probs=185.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH
Q ss_conf             99998897057889988886594069852898988997239979999853889999999753768980899889977899
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ   89 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~   89 (520)
                      ||||||||||+|||||||||+||||||+|+++++++|++.+|+||||||||+|||++|+|++++.||++|+|||||||||
T Consensus         1 ILvlDFGsQY~hLIaRRlRE~gVysE~~p~t~~~eeI~~~~P~GiILSGGP~sv~~~n~~~~~~~if~LgVPvLGICYG~   80 (195)
T TIGR00888         1 ILVLDFGSQYNHLIARRLRELGVYSEIVPNTTPLEEIKEKNPKGIILSGGPASVYAENAPEADEKIFELGVPVLGICYGM   80 (195)
T ss_pred             CEEEECCCCCEEEEEEEEEECCCEEEEEECCCCHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEHHH
T ss_conf             97883376510001122010141357840778779986129867997278876467885022488862799688762457


Q ss_pred             HHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCC---CCCCEEEEEECCCHHHCCCCCCCEEECCCC-CCEEEEEE
Q ss_conf             99899709699986986610366752388622278726---655336860022011012444211232398-31788986
Q gi|254780414|r   90 QIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE---KGSKQQVWMSHGDQVEHIPEGFEVIASSDS-TPFAFIAD  165 (520)
Q Consensus        90 QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~---~~~~~~VwmSH~D~V~~lP~gf~viA~S~~-~~iaai~~  165 (520)
                      |+||++|||+|.+++.+|||++.+++.+++.||+|+++   ....+.|||||+|.|.++|+||+++|+|++ ||+|||+|
T Consensus        81 Ql~A~~lGG~V~~~~~~EYG~a~l~i~~~~~LF~glp~~LTA~P~~~VWMSH~D~V~~lP~gF~vlA~s~~hcP~aAm~~  160 (195)
T TIGR00888        81 QLMAKQLGGEVGRAEKREYGKAELEILDEDDLFEGLPKALTAKPESTVWMSHGDKVKELPEGFKVLATSDNHCPVAAMEH  160 (195)
T ss_pred             HHHHHHHCCEEEECCCCCCCEEEEEEECCCHHHHCCCHHHCCCCCCCCCCCCCCEEEECCCCCEEEEECCCCCCCCEEEC
T ss_conf             89999829877656888731389998428812307803534688887112346242008699768875289881000004


Q ss_pred             CCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCC
Q ss_conf             35001124652122215202577998755010644
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQ  200 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~  200 (520)
                      .+|++|||||||||+||++|.+||+||+++||+|+
T Consensus       161 ~~K~~YGVQFHPEV~Ht~~G~~~L~NF~~~~C~~~  195 (195)
T TIGR00888       161 EDKPIYGVQFHPEVTHTEYGKELLKNFVKDVCGCE  195 (195)
T ss_pred             CCCCEEEEEECCCEEECHHHHHHHHHHHHHHCCCC
T ss_conf             89966666517831215345789998887631589


No 8  
>PRK07765 para-aminobenzoate synthase component II; Provisional
Probab=100.00  E-value=0  Score=436.92  Aligned_cols=211  Identities=20%  Similarity=0.319  Sum_probs=188.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCC-HHHH--HHCCCCEEEECCCCCCCCCCCC-CCCCHHHHHCCCCEEE
Q ss_conf             6999988970578899888865940698528989-8899--7239979999853889999999-7537689808998899
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNA-LDYF--KEQNPQAIILSGSPASSLDIDS-PQIPKEILESNIPLLG   84 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~-~e~i--~~~~p~GIILSGGP~SV~d~~a-p~~~~~I~~~~iPILG   84 (520)
                      |||||||++|||++|+|++|++|++++|+++|.. ..++  ...+++||||||||+|+.+.+. ..+.+.+++.++||||
T Consensus         2 rILiIDn~DSFT~ni~~~lr~lg~~v~V~~~d~~~~~~~~~~~~~~dgIILSpGPg~P~~~~~~~~~i~~~~~~~iPILG   81 (221)
T PRK07765          2 RILVVDNYDSFVFNLVQYLGQLGVEAEVWRNDDVRLADEAAVAAGFDGVLLSPGPGTPERAGASIDMVRACAAAGTPLLG   81 (221)
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCCEEEECCCCCCHHHCCCCHHHHHHHHCCCCCEEE
T ss_conf             79999388933999999998779918999899899889987634899899969999801167248899875325998898


Q ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH--HCCCCCCCEEECCCCCCEEE
Q ss_conf             7789999899709699986986610366752388622278726655336860022011--01244421123239831788
Q gi|254780414|r   85 ICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV--EHIPEGFEVIASSDSTPFAF  162 (520)
Q Consensus        85 ICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP~gf~viA~S~~~~iaa  162 (520)
                      ||||||+||++|||+|.+++.++||++.+....++.+|+|+   +..+.+||+|++.+  +.+|++|+++|+|++++++|
T Consensus        82 IClG~Q~ia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~gl---~~~~~~~ryHS~~v~~~~lP~~~~v~A~s~~~~ima  158 (221)
T PRK07765         82 VCLGHQAIGVAFGATVDRAPELLHGKTSSVHHTNVGVLQGL---PDPFTATRYHSLTILPETLPAELEVTARTDSGVIMA  158 (221)
T ss_pred             EEHHHHHHHHHHCCEEEECCCCCEEEEEEEEECCCCCCCCC---CCCEEEEEEEEEEEEECCCCCCCEEEEECCCCCEEE
T ss_conf             70999999998397898889553656879998998761589---997478874218997615899628999849986865


Q ss_pred             EEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH-HHHHHHCCC
Q ss_conf             9863500112465212221520257799875501064411140678999999-997650444
Q gi|254780414|r  163 IADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVS-RIKEQVGNE  223 (520)
Q Consensus       163 i~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~-~Ir~~vg~~  223 (520)
                      ++|+++++|||||||||.||++|.+||+||| +||||++||+|.+|++++|. .+++|||..
T Consensus       159 ~~h~~~~i~GVQFHPEs~~T~~G~~ll~NFl-~icg~~~~w~~~~~ie~~i~~~~~~~~~~~  219 (221)
T PRK07765        159 VRHRELPIHGVQFHPESILTEGGHRMLANWL-TYCGWAPDDTLVRRLENEVAAAVAPATGRT  219 (221)
T ss_pred             EEECCCCEEEEEECCCCCCCCCHHHHHHHHH-HHHCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             8707897899997885357816699999999-981999887789999999999998750757


No 9  
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=419.54  Aligned_cols=191  Identities=39%  Similarity=0.701  Sum_probs=179.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC--CCCCCHHHHHCCCC--
Q ss_conf             8869999889705788998888659-406985289898899723997999985388999999--97537689808998--
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESK-VYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID--SPQIPKEILESNIP--   81 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelg-VyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~--ap~~~~~I~~~~iP--   81 (520)
                      ..+|+|+||||||+|+|+||+||+| ||||++|++.+.+++.+.+|+||||||||+|||+++  ++..+..|++.++|  
T Consensus         1 ~~~ilIld~g~q~~~li~r~~re~g~v~~e~~~~~~~~~~~~~~~~~giIlsGgp~sv~~~~~w~~~~~~~i~~~~~p~~   80 (198)
T COG0518           1 MRKILILDFGGQYLGLIARRLRELGYVYSEIVPYTGDAEELPLDSPDGIIISGGPMSVYDEDPWLPREKDLIKDAGVPGK   80 (198)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             95799995797076799999987398269998578880115666888899858988776443330557899997188888


Q ss_pred             -EEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEEC-CCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCC
Q ss_conf             -89977899998997096999869866103667523-8862227872665533686002201101244421123239831
Q gi|254780414|r   82 -LLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTP  159 (520)
Q Consensus        82 -ILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~-~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~  159 (520)
                       |||||||||+||.++||+|+++..+|||++.+++. .++.+|+++++...  .|||||+|.|+++|+||+++|+|++|+
T Consensus        81 pvLGIC~G~Ql~A~~lGg~V~~~~~~E~G~~~v~~~~~~~~l~~gl~~~~~--~v~~sH~D~v~~lP~g~~vlA~s~~cp  158 (198)
T COG0518          81 PVLGICLGHQLLAKALGGKVERGPKREIGWTPVELTEGDDPLFAGLPDLFT--TVFMSHGDTVVELPEGAVVLASSETCP  158 (198)
T ss_pred             CEEEECHHHHHHHHHHCCEEECCCCCCCCEEEEEEECCCCCCCCCCCCCCC--CCCCCHHCCCCCCCCCCEEEECCCCCH
T ss_conf             789987618999998498896468876515999972586500048854337--106613074434899989986589980


Q ss_pred             EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             788986350011246521222152025779987550106441
Q gi|254780414|r  160 FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQD  201 (520)
Q Consensus       160 iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~  201 (520)
                      ++||++. +++||+||||||+| +.|.++|+||..++|+|++
T Consensus       159 ~qa~~~~-~~~~gvQFHpEv~~-~~~~~~l~nf~~~i~~~~~  198 (198)
T COG0518         159 NQAFRYG-KRAYGVQFHPEVTH-EYGEALLENFAHEICGEEP  198 (198)
T ss_pred             HHHEECC-CCEEEEEEEEEEEH-HHHHHHHHHHHHHHCCCCC
T ss_conf             4205667-85799942018738-9999999986566405698


No 10 
>CHL00101 trpG anthranilate synthase component 2
Probab=100.00  E-value=0  Score=405.27  Aligned_cols=186  Identities=25%  Similarity=0.347  Sum_probs=172.5

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             69999889705788998888659406985289-89889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .||||||||||||+|+||+||+|++++++|++ .+++++...+|+||||||||.|+++.+.+....+.+..++|||||||
T Consensus         1 mILiiD~~dsft~~i~r~lrelg~~~~v~~~d~~~~~~i~~~~p~gIILS~GPg~p~~~~~~~~~~~~~~~~iPILGICl   80 (190)
T CHL00101          1 MILIIDNYDSFTYNLVQSLGELNSDLLVCRNDEIDLSKIKNLNPRHIIISPGPGHPRDSGISLDVISSYAPTIPILGVCL   80 (190)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCEEEECCCCCCHHHCCCCHHHHHHHHCCCCEEEECH
T ss_conf             99999788808999999998689989998699899999970797989997999995785761689999714998789739


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH--HCCCCCCCEEECCCCCCEEEEEE
Q ss_conf             9999899709699986986610366752388622278726655336860022011--01244421123239831788986
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV--EHIPEGFEVIASSDSTPFAFIAD  165 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP~gf~viA~S~~~~iaai~~  165 (520)
                      |||+||+++||+|.+++.+|||++.+...+.+.+|+|+   +..+.+||+|++.+  .++|++|+++|+|+++.++|++|
T Consensus        81 G~Q~ia~~~Gg~v~~~~~~~~G~~~~i~~~~~~lf~g~---~~~~~~~~~hs~~v~~~~lp~~~~v~a~s~~~~i~ai~h  157 (190)
T CHL00101         81 GHQSIGYVYGGKIIKASKPMHGKTSLIYHNHDDLFQGL---PNPFIATRYHSLIIDRENLPSCLEITAWTEDGLIMACRH  157 (190)
T ss_pred             HHHHHHHHCCCEEEECCCEEECCEEEEEECCCCCCCCC---CCCCEEEECCEEEEEECCCCCCEEEEEECCCCCEEEEEE
T ss_conf             88999887586499788204362479997898754379---988489870779998045789879999979996899997


Q ss_pred             CCCC-EEEEEEEEHHHCCCHHHHHHHHHHHHHCC
Q ss_conf             3500-11246521222152025779987550106
Q gi|254780414|r  166 EKRK-YYAVQFHPEVVHTVGGSQLIDNFVHHVAG  198 (520)
Q Consensus       166 ~~~~-iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~  198 (520)
                      ++++ +|||||||||+||++|.+||+||+ ++|.
T Consensus       158 ~~~~~i~GVQFHPEs~~T~~G~~il~NFl-~la~  190 (190)
T CHL00101        158 KKYPMLRGIQFHPESILTEHGQQLLRNFL-SLSS  190 (190)
T ss_pred             CCCCCEEEEEECCCCCCCCCHHHHHHHHH-HHCC
T ss_conf             89998799997486699948699999999-8609


No 11 
>PRK05670 anthranilate synthase component II; Provisional
Probab=100.00  E-value=0  Score=386.00  Aligned_cols=188  Identities=25%  Similarity=0.370  Sum_probs=167.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCC-CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             699998897057889988886594069852898-9889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~-~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .|||+|+++||||+|+|++|++|+|++|+|++. +++++...+|+||||||||+|+++.+...-.-+.++.++|||||||
T Consensus         1 miLiiD~~dsfT~nI~~~lr~~g~~v~V~~~d~~~~~~i~~~~pdgiiLS~GPg~P~~~~~~~~~i~~~~~~iPiLGICl   80 (192)
T PRK05670          1 MILLIDNYDSFTYNLVQYLGELGAEVVVYRNDEITLEEIEALAPDAIVLSPGPGTPAEAGISLELIREFAGKVPILGVCL   80 (192)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCEEEECCCCCCHHHCCCHHHHHHHHCCCCCEEEEEH
T ss_conf             99999689868999999998689969999899899999985098989999999993660554999997346997899847


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH--HCCCCCCCEEECCCCCCEEEEEE
Q ss_conf             9999899709699986986610366752388622278726655336860022011--01244421123239831788986
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV--EHIPEGFEVIASSDSTPFAFIAD  165 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP~gf~viA~S~~~~iaai~~  165 (520)
                      |||+||.++||+|.+++.++||++.....+++.+|+++   +..+.|||+|++.+  ..+|++|+++|+|+++.++|++|
T Consensus        81 G~Qlia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~~~---~~~~~v~~~Hs~~v~~~~lp~~~~v~a~s~d~~i~a~~~  157 (192)
T PRK05670         81 GHQAIGEAFGGKVVRAKEIMHGKTSPIEHDGKGIFAGL---PNPFTVTRYHSLVVERESLPDCLEVTAWTDDGEIMGVRH  157 (192)
T ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEEECCCCCCCCC---CCCCEEEECCEEEEEECCCCCCEEEEEEECCCCEEEEEE
T ss_conf             78999987197388888636370489998999871588---887468611207999334799679999979971999998


Q ss_pred             CCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCC
Q ss_conf             35001124652122215202577998755010644
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQ  200 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~  200 (520)
                      +++++|||||||||.||++|.+||+||+ ++|...
T Consensus       158 ~~~~~~gvQFHPEs~~t~~G~~il~nFl-~~~~g~  191 (192)
T PRK05670        158 KELPIYGVQFHPESILTEHGHKLLENFL-ELALGA  191 (192)
T ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHH-HHHCCC
T ss_conf             9999899967998899817699999999-975138


No 12 
>PRK08857 para-aminobenzoate synthase component II; Provisional
Probab=100.00  E-value=0  Score=385.26  Aligned_cols=183  Identities=25%  Similarity=0.364  Sum_probs=169.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             69999889705788998888659406985289-89889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .|||+|+++|||++|+|++||+|+|++|+|++ .+++++.+.+|+||||||||.|+++.+.+....+.+..++|||||||
T Consensus         1 miLiiDn~DsfT~ni~~~l~~lg~~v~vv~~d~~~~~~i~~~~p~~IilS~GPg~p~~~~~~~~~~~~~~~~iPILGICl   80 (192)
T PRK08857          1 MLLMIDNYDSFTYNLYQYFCELGAEVKVVRNDEIDIAGIEALNPSHLVISPGPCTPNEAGISLQAIEHFAGKLPILGVCL   80 (192)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCEEEECCCCCCHHHCCCCHHHHHHHCCCCCEEEECH
T ss_conf             99999799977999999998779928999699899999984297959998999996782861466997357999899879


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCCC-----CE
Q ss_conf             99998997096999869866103667523886222787266553368600220110--124442112323983-----17
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDST-----PF  160 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~~-----~i  160 (520)
                      |||+||+++||+|.+++.++||++......++.+|+++   +..+.|||+|++.|.  ++|++|+++|.++++     .+
T Consensus        81 G~Q~ia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~~~---~~~~~v~~~Hs~~v~~~~lp~~~~v~a~t~~~~~~~~~i  157 (192)
T PRK08857         81 GHQAIAQVFGGDVVRARQVMHGKTSPIRHTGRSVFKGL---NNPLTVTRYHSLVVKNDTLPECFELTAWTELEDGSMDEI  157 (192)
T ss_pred             HHHHHHHHHCCEEEECCCCEEEEEEEEEECCCEEEECC---CCCEEEEECCCEEEECCCCCCCEEEEEEEECCCCCCCCE
T ss_conf             99999998398299888432511579998993047369---988798962552789574899829999972688997705


Q ss_pred             EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             8898635001124652122215202577998755
Q gi|254780414|r  161 AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       161 aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      +|++|+++++|||||||||.||++|.+||+|||-
T Consensus       158 ~a~~h~~~~i~GVQFHPEs~~T~~G~~il~NFl~  191 (192)
T PRK08857        158 MGFQHKTLPIEAVQFHPESIKTEQGHQLLANFLA  191 (192)
T ss_pred             EEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHC
T ss_conf             3888389998999877977998474899999726


No 13 
>PRK06895 para-aminobenzoate synthase component II; Provisional
Probab=100.00  E-value=0  Score=384.47  Aligned_cols=182  Identities=25%  Similarity=0.438  Sum_probs=159.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCC-CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH--HHHHCCCCEE
Q ss_conf             88699998897057889988886594069852898-98899723997999985388999999975376--8980899889
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDIDSPQIPK--EILESNIPLL   83 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~-~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~--~I~~~~iPIL   83 (520)
                      ..||||+|||+||||+|+|++||+|+||+|++++. +.+++  .+++||||||||+++.+.  +....  ..+..++|||
T Consensus         2 ~~kILiiD~~dsfT~ni~~~lr~lg~~~~v~~~~~~~~~~~--~~~~~IIlSpGPg~p~~~--~~~~~~i~~~~~~~PIL   77 (191)
T PRK06895          2 ATNLLIINNHDSFTFNLVDLIRKLGVPMKVVNVEDLDLDEV--ENFSHILISPGPDVPRAY--PQLFAMLERYYQQKSIL   77 (191)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHH--HCCCEEEEECCCCCCCCC--CHHHHHHHHHCCCCCEE
T ss_conf             98699996988489999999987799699984784899898--558969990899980105--22499999860689878


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEE-EEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCCCCE
Q ss_conf             97789999899709699986986610366-7523886222787266553368600220110--12444211232398317
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAF-IEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDSTPF  160 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~-I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~~~i  160 (520)
                      |||||||+||++|||+|.+++..+||.+. +...+++.+|+++   +..++|||+|++.|.  .+|++|+++|+++++.+
T Consensus        78 GIClG~Q~i~~~~Gg~v~~~~~~~hG~~~~i~~~~~~~lf~g~---~~~~~v~~yHs~~v~~~~lp~~~~v~a~~~~~~i  154 (191)
T PRK06895         78 GVCLGHQTLCEFFGGTLYNLENVRHGQQRTLKVRSNSPLFDGL---PEEFNIGLYHSWAVSQENFPTPLEITAVCDEEVV  154 (191)
T ss_pred             EECHHHHHHHHHHCCEEEECCCCEEEEEEEEEECCCCCCCCCC---CCCEEEEEEEEEEEECCCCCCCEEEEEECCCCEE
T ss_conf             9829999999982957996887455227899991898346589---9974876667778760578974699997599809


Q ss_pred             EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             889863500112465212221520257799875501
Q gi|254780414|r  161 AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       161 aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      +|++|+++++|||||||||.||++|.+||+||| +|
T Consensus       155 ~a~~h~~~~i~GvQFHPEs~~T~~G~~il~NFl-~i  189 (191)
T PRK06895        155 MAFQHKHLPIYGVQFHPESYISEFGEQILRNWL-AI  189 (191)
T ss_pred             EEEEECCCCEEEEEECCCCCCCCCHHHHHHHHH-CC
T ss_conf             988848998999982884688878599999986-56


No 14 
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase.  These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the prese
Probab=100.00  E-value=0  Score=378.48  Aligned_cols=181  Identities=28%  Similarity=0.419  Sum_probs=164.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHH
Q ss_conf             9999889705788998888659406985289-898899723997999985388999999975376898089988997789
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG   88 (520)
                      |||+|||+||||+|+|++|++|+||+|+|++ .+.+.++..+|+||||||||.|+++.+.+....+.++.++||||||||
T Consensus         1 iLiiD~~dsft~~i~r~lr~~g~~~~v~p~~~~~~~~~~~~~~~giiLS~GPg~p~~~~~~~~~~~~l~~~iPiLGIC~G   80 (184)
T cd01743           1 ILLIDNYDSFTYNLVQYLRELGAEVVVVRNDEITLEELELLNPDAIVISPGPGHPEDAGISLEIIRALAGKVPILGVCLG   80 (184)
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCEEEECCCCCCHHHCCCHHHHHHHHHCCCCEEEECHH
T ss_conf             89993798179999999986799599998999999999732979999999998925614609999998469989998099


Q ss_pred             HHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCCCCEEEEEEC
Q ss_conf             9998997096999869866103667523886222787266553368600220110--12444211232398317889863
Q gi|254780414|r   89 QQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDSTPFAFIADE  166 (520)
Q Consensus        89 ~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~~~iaai~~~  166 (520)
                      ||+||.++||+|.+.+.+++|........++.+|.++   +....|||+|++++.  .+|+++.++|+++++.++|++|+
T Consensus        81 ~Qll~~~~Gg~v~~~~~~~~G~~~~i~~~~~~~~~~~---~~~~~v~~~Hs~~~~~~~~~~~~~~~a~~~~~~i~ai~~~  157 (184)
T cd01743          81 HQAIAEAFGGKVVRAPEPMHGKTSEIHHDGSGLFKGL---PQPFTVGRYHSLVVDPDPLPDLLEVTASTEDGVIMALRHR  157 (184)
T ss_pred             HHHHHHHCCCEEEECCCCEECEEEEEEECCCCCEECC---CCCCEEEEEEEEEEECCCCCCCCEEEEECCCCCEEEEEEC
T ss_conf             9999998398487457514054589997797636427---8888898861468981357875079998899849999989


Q ss_pred             CCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             500112465212221520257799875
Q gi|254780414|r  167 KRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       167 ~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      ++++|||||||||.||++|.+||+||+
T Consensus       158 ~~~i~GvQFHPEs~~t~~G~~il~nFl  184 (184)
T cd01743         158 DLPIYGVQFHPESILTEYGLRLLENFL  184 (184)
T ss_pred             CCCEEEEEECCCCCCCCCHHHHHHHHC
T ss_conf             999899983687689827389998439


No 15 
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated
Probab=100.00  E-value=0  Score=375.81  Aligned_cols=190  Identities=21%  Similarity=0.324  Sum_probs=174.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             69999889705788998888659406985289-89889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .|||+|+++|||++|+|++|++|++++|+++| .+++++.+.+|+||||||||.++++.+.+....+.++.++|||||||
T Consensus         1 MILlIDn~DsFT~ni~~~l~~~g~~~~v~~~d~~~~~~i~~~~pd~IiLSpGPg~p~~~~~~~~~~~~~~~~iPILGICl   80 (195)
T PRK07649          1 MILMIDNYDSFTYNLVQYLGELGQELVVKRNDEVTISDIENMKPDFLMISPGPCSPNEAGISMEVIRYFAGKIPIFGVCL   80 (195)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCEEEECCCCCCHHHCCCCHHHHHHHCCCCCEEEECH
T ss_conf             99999589807999999999789979998899689999984198989988999995784761467997528997843029


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC--CCCCCCEEECCCCCCEEEEEE
Q ss_conf             999989970969998698661036675238862227872665533686002201101--244421123239831788986
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH--IPEGFEVIASSDSTPFAFIAD  165 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~--lP~gf~viA~S~~~~iaai~~  165 (520)
                      |||+||.++||+|.+++.++||++.....+.+.+|+++   +..+.|||+|++.|..  +|++|+++|+|+++.++||+|
T Consensus        81 G~Q~ia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~g~---~~~~~v~~yHs~~v~~~~lp~~~~v~a~s~~~~i~ai~h  157 (195)
T PRK07649         81 GHQSIAQVFGGEVVRAERLMHGKTSLMHHDGKTIFSDI---PNPFTATRYHSLIVKKETLPDCFEVTAWTEEGEIMAIRH  157 (195)
T ss_pred             HHHHHHHHCCCCEEECCCEEECEEEEEEECCCCCCCCC---CCCEEEEECCCEEEEECCCCCCEEEEEECCCCCEEEEEE
T ss_conf             99999987397283379607640657998897634388---887589861615896235787428999948997899993


Q ss_pred             CCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             350011246521222152025779987550106441
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQD  201 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~  201 (520)
                      +++++|||||||||.||++|.+||+|||.++++-..
T Consensus       158 ~~~pi~GVQFHPEs~~T~~G~~il~NFl~k~~~~~~  193 (195)
T PRK07649        158 KTLPIEGVQFHPESIMTSHGKELLQNFIRKYSPSVT  193 (195)
T ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             899889998689888997768999999986135756


No 16 
>PRK00758 GMP synthase subunit A; Validated
Probab=100.00  E-value=0  Score=376.59  Aligned_cols=182  Identities=35%  Similarity=0.685  Sum_probs=169.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHH
Q ss_conf             69999889705788998888659406985289898899723997999985388999999975376898089988997789
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG   88 (520)
                      ||||||||+|||++|+|++|++|++++|+|+++++++++. +|+||||||||.+..   +....+.+.+.++||||||||
T Consensus         1 kIlviD~~dsft~ni~~~l~~~g~~v~v~~~~~~~~~i~~-~~dgiilS~GP~~~~---~~~~~~~i~~~~iPiLGIClG   76 (184)
T PRK00758          1 KILVINNGGQYNHLIHRTLRYLGVDAKIIPNTTPLEEIKA-EPDGIILSGGPEIER---AGNCEEYLLELDVPILGICLG   76 (184)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHH-CCCEEEECCCCCCCC---CCCHHHHHHHCCCCEEEEEHH
T ss_conf             9999989863899999999978992899959898999963-899899889998333---220699998659988997177


Q ss_pred             HHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCC
Q ss_conf             99989970969998698661036675238862227872665533686002201101244421123239831788986350
Q gi|254780414|r   89 QQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKR  168 (520)
Q Consensus        89 ~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~  168 (520)
                      ||+||.++||+|.+++.+++|+..+.+.+.+.+|+++   +..+.+|++|+|.|.++|++|+++|+|+++.++|++|+++
T Consensus        77 ~Q~l~~~~Gg~v~~~~~~~~G~~~i~~~~~~~lf~~~---~~~~~v~~~H~~~v~~~p~~~~v~a~s~~~~v~~i~~~~~  153 (184)
T PRK00758         77 HQLIAKAFGGEVGRAEKGEYALVEVEILDEDDILRGL---PPEITVWASHADEVKELPDGFEILARSDICEVEAMKHKDK  153 (184)
T ss_pred             HHHHHHHCCCCCCCCCCEEECCEEEEEECCCCCCCCC---CCCCEEEEEEEEEEEECCCCEEEEEECCCCCEEEEEECCC
T ss_conf             6665876699330276215433689997388751115---8863787640058996587159999849998899998999


Q ss_pred             CEEEEEEEEHHHCCCHHHHHHHHHHHHHCC
Q ss_conf             011246521222152025779987550106
Q gi|254780414|r  169 KYYAVQFHPEVVHTVGGSQLIDNFVHHVAG  198 (520)
Q Consensus       169 ~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~  198 (520)
                      ++||||||||+.+|++|.+||+||+ +|||
T Consensus       154 ~i~gvQFHPEs~~t~~G~~ll~nFl-~icg  182 (184)
T PRK00758        154 PIYGVQFHPEVSHTEKGEEIFKNFI-KICG  182 (184)
T ss_pred             CEEEEEECCCCCCCCCHHHHHHHHH-HHHC
T ss_conf             9999991884799927899999999-9855


No 17 
>PRK08007 para-aminobenzoate synthase component II; Provisional
Probab=100.00  E-value=0  Score=368.71  Aligned_cols=183  Identities=27%  Similarity=0.371  Sum_probs=168.5

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             69999889705788998888659406985289-89889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .|||+|+++|||++|+|++|++|++++|+|+| .++++++..+|+||||||||.++.+.+.+......++.++|||||||
T Consensus         1 MILiIDn~DsFT~ni~~~l~~~g~~v~V~~~d~~~~~~i~~~~p~~IvlSpGPg~P~~~~~~~~~i~~~~~~iPiLGICl   80 (187)
T PRK08007          1 MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAGISLDVIRHYAGRLPILGVCL   80 (187)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCEEEECCCCCCHHHCCCCHHHHHHHCCCCCEEEECH
T ss_conf             99999689818999999998779979999389899999984298979999999995890840468997538998899879


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCCCCEEEEEE
Q ss_conf             99998997096999869866103667523886222787266553368600220110--1244421123239831788986
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDSTPFAFIAD  165 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~~~iaai~~  165 (520)
                      |||+||+++||+|.+++.++||++.......+.+|+++   +..+.|||+|++.|.  ++|++|+++|+|++++++|++|
T Consensus        81 G~Q~ia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~~~---~~~~~v~~~hs~~v~~~~lp~~~~v~a~~~~~~v~ai~~  157 (187)
T PRK08007         81 GHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGL---ANPLTVTRYHSLVVEPDSLPECFEVTAWSETREIMGIRH  157 (187)
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCEEEEECCCCCCCCC---CCCEEEEEEEEEEEECCCCCCCEEEEEECCCCCEEEEEE
T ss_conf             99999998098073478320152069998998626789---987378975578886476898159999929986899998


Q ss_pred             CCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             35001124652122215202577998755
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      +++++|||||||||.||++|.+||+|||.
T Consensus       158 ~~~~~~GVQFHPEs~~T~~G~~il~NFl~  186 (187)
T PRK08007        158 RQWDLEGVQFHPESILSEQGHQLLANFLH  186 (187)
T ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHHC
T ss_conf             99998999958977999677899999857


No 18 
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate.  GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP.  GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=100.00  E-value=0  Score=367.34  Aligned_cols=181  Identities=52%  Similarity=0.935  Sum_probs=175.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH
Q ss_conf             99998897057889988886594069852898988997239979999853889999999753768980899889977899
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ   89 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~   89 (520)
                      |+|+|||++++|+|+|.+|++|+.++|+|++++.++++..+|+||||||||.|+.+.+++...+++++.++|+||||+||
T Consensus         1 I~iiD~g~~~~~si~~~l~~~G~~~~vv~~~~~~~~~~~~~~dgvils~GP~~~~~~~~~~~~~~i~~~~~PilGIClG~   80 (181)
T cd01742           1 ILILDFGSQYTHLIARRVRELGVYSEILPNTTPLEEIKLKNPKGIILSGGPSSVYEEDAPRVDPEIFELGVPVLGICYGM   80 (181)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHCCCCEEEEHHHH
T ss_conf             79999986389999999997799499996999989997349898998999998555798333099984799999985999


Q ss_pred             HHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCCC
Q ss_conf             99899709699986986610366752388622278726655336860022011012444211232398317889863500
Q gi|254780414|r   90 QIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRK  169 (520)
Q Consensus        90 QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~~  169 (520)
                      |+||.++||+|.+...+++|+..+.+..++++|+++   .....+|++|+|+|.++|++++++|+|++++++|+++++++
T Consensus        81 Qll~~a~Gg~v~~~~~~~~G~~~~~~~~~~~l~~~~---~~~~~~~~~H~~~v~~~p~~~~~~a~s~~~~v~~~~~~~~~  157 (181)
T cd01742          81 QLIAKALGGKVERGDKREYGKAEIEIDDSSPLFEGL---PDEQTVWMSHGDEVVKLPEGFKVIASSDNCPVAAIANEEKK  157 (181)
T ss_pred             HHHHHHCCCCEEECCCCEECCEEEEEECCCCCCCCC---CCCEEEEEECCEEEEECCCCEEEEEECCCCEEEEEEECCCC
T ss_conf             999987597602189855364478981262100588---98567885636299845873079999599409999989999


Q ss_pred             EEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             112465212221520257799875
Q gi|254780414|r  170 YYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       170 iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +||+|||||+++|+.|.+||+|||
T Consensus       158 i~gvQfHPEs~~s~~G~~il~NFl  181 (181)
T cd01742         158 IYGVQFHPEVTHTEKGKEILKNFL  181 (181)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHC
T ss_conf             899995788899847379998429


No 19 
>PRK06774 para-aminobenzoate synthase component II; Provisional
Probab=100.00  E-value=0  Score=358.69  Aligned_cols=184  Identities=22%  Similarity=0.338  Sum_probs=166.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             69999889705788998888659406985289-89889972399799998538899999997537689808998899778
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      .|||+|+++|||++|+|++|++|++++|+++| .+++++...+|+|||||+||.++.+.+.+......+..++|||||||
T Consensus         1 mILiiDn~DsFT~nl~~~l~~~g~~v~V~~~d~~~~~~i~~~~p~~ivLSpGPG~P~~~~~~~~~i~~~~~~iPILGICl   80 (191)
T PRK06774          1 MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPSHVVISPGPCTPNEAGISLAVIRHFADKLPILGVCL   80 (191)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCEEEECCCCCCHHHHCCHHHHHHHHCCCCCEEEEHH
T ss_conf             99999699976999999998779959998699889999985399969999999896790730689997446997886168


Q ss_pred             HHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH--HCCCCCCCEEECCCCC----CEE
Q ss_conf             9999899709699986986610366752388622278726655336860022011--0124442112323983----178
Q gi|254780414|r   88 GQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV--EHIPEGFEVIASSDST----PFA  161 (520)
Q Consensus        88 G~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP~gf~viA~S~~~----~ia  161 (520)
                      |||+||+++||+|.+++.++||++......++.+|+|+   +..+.|||+|++.+  .++|++|+++|.|+++    .++
T Consensus        81 G~Q~ia~~~Gg~v~~~~~~~hG~~~~i~~~~~~lf~g~---~~~~~v~~~Hs~~v~~~~lp~~~~v~a~s~~~~~~~~i~  157 (191)
T PRK06774         81 GHQALGQAFGARVVRARQVMHGKTSAICHSGQGVFRGL---NQPLTVTRYHSLVIATDSLPGCFELTAWTERGGEMDEIM  157 (191)
T ss_pred             HHHHHHHHCCCEEEECCCCEECEEEEEEECCCCCCCCC---CCCCEEEECCCEEEEECCCCCCEEEEEEECCCCCCCEEE
T ss_conf             79998656098492899747570368998998760689---998688504650788344899879999979999988688


Q ss_pred             EEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHH
Q ss_conf             8986350011246521222152025779987550
Q gi|254780414|r  162 FIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHH  195 (520)
Q Consensus       162 ai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~  195 (520)
                      |++|+++++|||||||||.||++|.+||+|||.+
T Consensus       158 ai~~~~~~i~GVQFHPEs~~T~~G~~il~NFl~~  191 (191)
T PRK06774        158 GIRHRTLPLEGVQFHPESILSEQGHQLLDNFLKN  191 (191)
T ss_pred             EEEECCCCEEEEEECCCCCCCCCHHHHHHHHHCC
T ss_conf             8883899989987689889995888999998449


No 20 
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II.  CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species.  The E.coli enzyme is
Probab=100.00  E-value=0  Score=361.95  Aligned_cols=173  Identities=25%  Similarity=0.445  Sum_probs=146.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-CCCCCCHHHHHCCCCEEEECHH
Q ss_conf             999988970578899888865940698528989889972399799998538899999-9975376898089988997789
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-DSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-~ap~~~~~I~~~~iPILGICyG   88 (520)
                      |+|||||||||  |+||+||+|+||+|+|+++++++++..+|+||||||||+|+++. .++...+++++.++||||||||
T Consensus         1 i~ilDfGsqy~--i~r~lrelg~~~~v~~~~~~~~~i~~~~p~giIlS~GPg~p~~~~~~~~~~~~~~~~~iPILGIClG   78 (178)
T cd01744           1 VVVIDFGVKHN--ILRELLKRGCEVTVVPYNTDAEEILKLDPDGIFLSNGPGDPALLDEAIKTVRKLLGKKIPIFGICLG   78 (178)
T ss_pred             CEEEECCCHHH--HHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEECCCCCCHHHHCCHHHHHHHHHHCCCCEEEECHH
T ss_conf             99998874999--9999998799799993989999998419997998999999577344499999997469988998121


Q ss_pred             HHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCC-CCCEEEEEE
Q ss_conf             9998997096999869866103667523886222787266553368600220110--1244421123239-831788986
Q gi|254780414|r   89 QQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSD-STPFAFIAD  165 (520)
Q Consensus        89 ~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~-~~~iaai~~  165 (520)
                      ||+||+++||+|.+.+.+++|..       .++....  .......||+|+|.|.  ++|++|+++|.|. ++.+||++|
T Consensus        79 ~Q~ia~~~Gg~v~k~~~g~~G~n-------~pv~~~~--~~~~~~~~~~H~~~v~~~~lp~~~~v~a~s~~d~~i~ai~h  149 (178)
T cd01744          79 HQLLALALGAKTYKMKFGHRGSN-------HPVKDLI--TGRVYITSQNHGYAVDPDSLPGGLEVTHVNLNDGTVEGIRH  149 (178)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCC-------CCCEECC--CCCEEEEECCCCEEEEECCCCCCCEEEEECCCCCCEEEEEE
T ss_conf             78899881983001566724787-------1216768--88388864475548762458998579996489985799998


Q ss_pred             CCCCEEEEEEEEHHHCCCH-HHHHHHHHH
Q ss_conf             3500112465212221520-257799875
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVG-GSQLIDNFV  193 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~-G~~iL~NFl  193 (520)
                      +++++||||||||+.+|++ |..|++||+
T Consensus       150 ~~~~i~GVQFHPEs~~~~~~~~~if~nFl  178 (178)
T cd01744         150 KDLPVFSVQFHPEASPGPHDTEYLFDEFL  178 (178)
T ss_pred             CCCCEEEEEECCCCCCCCCCCHHHHHHHC
T ss_conf             99999999859979999977489897239


No 21 
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional
Probab=100.00  E-value=6.4e-43  Score=326.94  Aligned_cols=352  Identities=18%  Similarity=0.250  Sum_probs=229.0

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCC----CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             8699998897057889988886594069852898----988997239979999853889999999753768980899889
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN----ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~----~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      .+||++|.=-.||..|+..+|+++....|+..+.    .++++...+|++||||+||+++.|.+...-.-..+..++|||
T Consensus         2 ~~ILlIDNyDSFTyNL~~~l~~~g~~v~V~rnd~~~~~~~e~~~~~~p~~IVlSPGPG~P~dag~~~~ii~~~~~~iPIL   81 (531)
T PRK09522          2 ADILLLDNIDSFTYNLADQLRSNGHNVVIYRNHIPAQTLIERLATMSNPVLMLSPGPGVPSEAGCMPELLTRLRGKLPII   81 (531)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCHHCCCHHHHHHHHCCCCCEE
T ss_conf             70999828886288999999866995699969983130199997249596998999989023657399999865999989


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEE
Q ss_conf             97789999899709699986986610366752388622278726655336860022011012444211232398317889
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFI  163 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai  163 (520)
                      |||||||+|+++|||+|.+++..+||++.....+.+.+|+|+   +..+.|||||++.++.+|++|+++|+++ +.++|+
T Consensus        82 GICLGhQ~ia~~~Gg~v~~a~~~~HGk~s~i~~~~~~lF~gl---p~~~~v~rYHSl~~~~lP~~l~v~A~~~-g~iMai  157 (531)
T PRK09522         82 GICLGHQAIVEAYGGYVGQAGEILHGKASSIEHDGQAMFAGL---TNPLPVARYHSLVGSNIPAGLTINAHFN-GMVMAV  157 (531)
T ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEEECCCCCCCCC---CCCCEEEEECEECCCCCCCCEEEEEEEC-CEEEEE
T ss_conf             987877899997298896779843233656798985202899---9997799644330447999879997169-999999


Q ss_pred             EECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHH
Q ss_conf             86350011246521222152025779987550106441114067899999999765044403664056404779999998
Q gi|254780414|r  164 ADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY  243 (520)
Q Consensus       164 ~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~  243 (520)
                      +|+++|+||||||||+.||++|.+||+||| +.|.-+..      .+..++.|                         |+
T Consensus       158 ~h~~~pi~GVQFHPESi~T~~G~~il~NFL-n~~~~~~~------~~~~~k~~-------------------------l~  205 (531)
T PRK09522        158 RHDADRVCGFQFHPESILTTQGARLLEQTL-AWAQQKLE------PTNTLQPI-------------------------LE  205 (531)
T ss_pred             EECCCCEEEEEECCCCCCCCCHHHHHHHHH-CCCCCCCC------CCCCHHHH-------------------------HH
T ss_conf             989998699820875468877799999985-65434355------44408999-------------------------99


Q ss_pred             HHC-CCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH-HHHHH--HHCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             622-3656999973895515627899998862369857997588-99999--9668988899998875658999999997
Q gi|254780414|r  244 EAI-GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS-ERFIR--KLKNIVDPETKRKVIGQLFIEVFEEEAK  319 (520)
Q Consensus       244 kAi-g~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~-~~Fl~--~L~gv~DPE~KRkiIG~~Fi~vf~~~a~  319 (520)
                      |.. |.+          |-..|++++++..-+-   +..  +|+ .-||-  +.||.|--|    |.|  |.+++-+.+.
T Consensus       206 kl~~g~~----------Lt~~ea~~~m~~im~G---~~t--~~qi~a~L~~lr~kGEt~~E----i~g--~a~amr~~a~  264 (531)
T PRK09522        206 KLYQAQT----------LSQQESHQLFSAVVRG---ELK--PEQLAAALVSMKIRGEHPNE----IAG--AATALLENAA  264 (531)
T ss_pred             HHHCCCC----------CCHHHHHHHHHHHHCC---CCC--HHHHHHHHHHHHHCCCCHHH----HHH--HHHHHHHHCC
T ss_conf             9866999----------9999999999999689---999--99999999999852898999----999--9999998486


Q ss_pred             HCCCCE--E-EEECC-------CC----CHHHHHHCCCCCCCCEEEEEECCC-----C---HHHHHCCCH----------
Q ss_conf             439970--9-98646-------22----024542024677763034430232-----0---113203202----------
Q gi|254780414|r  320 KIGGAQ--F-LGQGT-------LY----PDVIESISFFGGPSSIIKSHHNVG-----G---LPEHMDMKL----------  367 (520)
Q Consensus       320 ~~~~~~--~-L~QGT-------ly----pDvIES~~~~~~~~~~IKsHHNvg-----g---lp~~~~~~l----------  367 (520)
                      ++....  + =-=||       +-    .-++=++.     -..+--|-|.+     |   +-+.+..++          
T Consensus       265 ~~~~~~~~~iD~~GTGGDg~~tfNiST~aa~v~Aa~-----Gv~VaKHGNrs~sSksGSADvLealGv~i~~~~~~~~~~  339 (531)
T PRK09522        265 PFPRPDYLFADIVGTGGDGSNSINISTASAFVAAAC-----GLKVAKHGNRSVSSKSGSSDLLAAFGINLDMNADKSRQA  339 (531)
T ss_pred             CCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCC-----CCEEEEECCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             168899870232567998888724789999999739-----986760589877988629999997099988999999999


Q ss_pred             HH------HHHHHHHHHHHHHH---HHHCCCHHHHCCCCCCCC-CCEEEECCCCCHHHHHHHHH
Q ss_conf             23------78987389999999---981999889426888983-11122100036789999999
Q gi|254780414|r  368 VE------PLKELFKDEVRLLG---KELRLPDSFVERHPCPGP-GLAIRCIGEITEERINILRE  421 (520)
Q Consensus       368 iE------Pl~~l~KdEVR~lg---~~Lglp~~~~~RhPFPGP-GLaiRi~g~vt~e~~~i~r~  421 (520)
                      +|      =+...|-.-.|.++   ++||++.-+=-=-|.--| +....++|--.++.++.+-+
T Consensus       340 l~~~gi~FlfAp~~Hpamk~v~pvRk~Lg~rTiFNiLGPL~NPa~~~~qliGV~~~~~~~~~a~  403 (531)
T PRK09522        340 LDELGVCFLFAPKYHTGFRHAMPVRQQLKTRTLFNVLGPLINPAHPPLALIGVYSPELVLPIAE  403 (531)
T ss_pred             HHHCCEEEEECHHHCHHHHHHHHHHHHCCCCCCEECCCCCCCCCCCCCEEEEECCHHHHHHHHH
T ss_conf             9974915862343366699999999971988512134555788788726980379999999999


No 22 
>pfam00117 GATase Glutamine amidotransferase class-I.
Probab=100.00  E-value=1.1e-43  Score=332.41  Aligned_cols=182  Identities=34%  Similarity=0.531  Sum_probs=159.9

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHH-HCCCCEEEECCCCCCCCCC-CCCCCCHHHHHCCCCEEEECHH
Q ss_conf             9998897057889988886594069852898988997-2399799998538899999-9975376898089988997789
Q gi|254780414|r   11 LIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFK-EQNPQAIILSGSPASSLDI-DSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus        11 lIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~-~~~p~GIILSGGP~SV~d~-~ap~~~~~I~~~~iPILGICyG   88 (520)
                      +|+|||+|||++|+|++|++|++++|+|++.+.+.+. ..+|+||||||||+++.+. ....+.+++++.++||||||+|
T Consensus         1 liiD~~dsft~~i~~~l~~~g~~~~v~~~~~~~~~~~~~~~~d~iilspGpg~p~~~~~~~~~i~~~~~~~~PiLGIClG   80 (187)
T pfam00117         1 LLIDNGDSFTYNLARALRELGVEVEVVPNDTPAEEILELLNPDGIIISPGPGSPGDAGGAIEAIKELRENKIPILGICLG   80 (187)
T ss_pred             CEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCCCEEEECCCCCCHHHCCCHHHHHHHHHHCCCCEEEEEHH
T ss_conf             98937863899999999868997999989998699985259998999199861101345899999999779989999888


Q ss_pred             HHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCC-CCEEEEEE
Q ss_conf             9998997096999869866103667523886222787266553368600220110--12444211232398-31788986
Q gi|254780414|r   89 QQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDS-TPFAFIAD  165 (520)
Q Consensus        89 ~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~-~~iaai~~  165 (520)
                      ||+|+.++||+|.+.+..++|+.. .+...+.+|.++   +....+|++|+|.|.  .+|++|+++|+|.+ +.++|+++
T Consensus        81 ~Qll~~~~Gg~v~~~~~~~~G~~~-~i~~~~~~~~~~---~~~~~~~~~Hs~~v~~~~lp~~~~i~a~s~~~~~i~a~~~  156 (187)
T pfam00117        81 HQLLALAFGGKVIKAKEPHHGKNS-PVGHDKGLFYGL---PNVFIVRRYHSYAVDPDTLPDGLEVTAASDNGGEIMAIRH  156 (187)
T ss_pred             HHHHHHHCCCCCCCCCEEECCEEE-EECCCHHHHCCC---CCCCEEEEEEEEEEEECCCCCCEEEEEECCCCCCEEEEEE
T ss_conf             999999719986443101057048-973211644279---9773777603489986257886299998688871899998


Q ss_pred             CCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             3500112465212221520257799875501
Q gi|254780414|r  166 EKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       166 ~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      +++++||||||||+.+|++|.++|+||++++
T Consensus       157 ~~~~~~gvQfHPE~~~t~~G~~ll~nfl~~~  187 (187)
T pfam00117       157 KENPIFGVQFHPESSLTPGGPELLFNFLIKL  187 (187)
T ss_pred             CCCCEEEEEECCCCCCCCCCHHHHHHHHCCC
T ss_conf             8998999995997799977048998777439


No 23 
>PRK05637 anthranilate synthase component II; Provisional
Probab=100.00  E-value=7.7e-40  Score=304.94  Aligned_cols=186  Identities=23%  Similarity=0.323  Sum_probs=154.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH--HHHHCCCCEEEE
Q ss_conf             869999889705788998888659406985289898899723997999985388999999975376--898089988997
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPK--EILESNIPLLGI   85 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~--~I~~~~iPILGI   85 (520)
                      .+||++|+..+||+.|++++|++|++++|++++.+++++.+.+|++||||+||+++.|.+  ....  +.+..++|||||
T Consensus         2 ~~ILlIDnyDSFT~Nl~~~l~~~g~~v~V~rn~~~~~~~~~~~pd~ivlSPGPg~P~d~g--~~~~~~~~~~~~iPILGI   79 (208)
T PRK05637          2 THVVLIDNHDSFVYNLVDAFAVAGYKCTVFRNTVPVETILAANPDLICLSPGPGYPADAG--NMMALIERTLGQIPLLGI   79 (208)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCEEEECCCCCCHHHCC--CHHHHHHHHHCCCCEEEH
T ss_conf             779999488975999999998679907999699999999851999599999999957775--749999997356982211


Q ss_pred             CHHHHHHHHHCCCEEEECCCCCCCEEEE-EECC---CCCCCCCCCCCC---------CCEEEEEECCCHHHCCCCCCCEE
Q ss_conf             7899998997096999869866103667-5238---862227872665---------53368600220110124442112
Q gi|254780414|r   86 CYGQQIMCQSLGGKTKNSQSREFGRAFI-EIKK---NCSLLKGMWEKG---------SKQQVWMSHGDQVEHIPEGFEVI  152 (520)
Q Consensus        86 CyG~QlLa~~~GG~V~~~~~~EyG~~~I-~i~~---~~~lf~gl~~~~---------~~~~VwmSH~D~V~~lP~gf~vi  152 (520)
                      |||||+||.+|||+|.+.+. .||++.. ..+.   .+++|+|++...         ....||++|++.+..+|+++..+
T Consensus        80 CLGhQ~i~~~~Gg~v~~~~~-~HG~~s~i~~~~~g~~~~lf~gl~~~~~~~~~~~~~~~~~v~rYHSl~~~~~p~~~~~~  158 (208)
T PRK05637         80 CLGYQALIEYHGGKVEPCGP-VHGTTDNMILTDAGVQSPVFAGLATDVEPDHPEIPGRKVPIGRYHSLGCVVAPDGIESL  158 (208)
T ss_pred             HHHHHHHHHHCCCEEECCCC-CCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCEEEECCCCCEEE
T ss_conf             47789999970978830677-65506678987888877000688765544553456775357710601671079997488


Q ss_pred             ECCC--CC-CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             3239--83-17889863500112465212221520257799875501
Q gi|254780414|r  153 ASSD--ST-PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       153 A~S~--~~-~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      +.++  .+ .++|++|+++++||||||||+.+|++|.+||+||+-.+
T Consensus       159 ~~~~~~~~~viMa~~h~~~p~~GVQFHPESi~T~~G~~il~nfv~~~  205 (208)
T PRK05637        159 GTCSSEIGDVIMAARTTDGKAIGLQFHPESVLSPTGPVILSRCVEQL  205 (208)
T ss_pred             EEEECCCCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             99975999999999978999799866975368877799999999999


No 24 
>pfam00958 GMP_synt_C GMP synthase C terminal domain. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. This family is the C-terminal domain specific to the GMP synthases EC:6.3.5.2. In prokaryotes this domain mediates dimerization. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains.
Probab=100.00  E-value=7.5e-41  Score=312.16  Aligned_cols=93  Identities=68%  Similarity=1.061  Sum_probs=91.9

Q ss_pred             HHHHHHCCCHHHHHHHHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             99998646533322010455686324215998541447999632168775587101898999987557504879812578
Q gi|254780414|r  427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVV  506 (520)
Q Consensus       427 ~~~l~~~~ly~~~~q~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~  506 (520)
                      ++||+++|||+++|||||+|||+||||||||+|+|+|+|+||+|+|.|||||+|+++||++|++||+||+|||+|||||+
T Consensus         1 ~eel~~~gly~~iwQ~favLlPvksVGV~GD~RsY~~~v~lR~V~S~D~MTA~~~~~p~~~L~~is~rI~nev~~v~rV~   80 (93)
T pfam00958         1 IEELRKAGLYDKIWQAFAVLLPVKSVGVMGDERTYGYVVALRAVESTDFMTADWARLPYEVLERISNRITNEVPGVNRVV   80 (93)
T ss_pred             CHHHHHCCCHHHHHHHEEEECCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             94688777456545353686154323554885145304899978625554235566999999999999987077757799


Q ss_pred             ECCCCCCCCCCCC
Q ss_conf             6089417976668
Q gi|254780414|r  507 YDITSKPPATIEW  519 (520)
Q Consensus       507 ydit~Kpp~tiew  519 (520)
                      |||||||||||||
T Consensus        81 yDiT~KPP~TIEw   93 (93)
T pfam00958        81 YDITSKPPATIEW   93 (93)
T ss_pred             EECCCCCCCCCCC
T ss_conf             9789998977669


No 25 
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily. Adenine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.
Probab=100.00  E-value=1.5e-37  Score=288.50  Aligned_cols=180  Identities=28%  Similarity=0.346  Sum_probs=164.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHH
Q ss_conf             36640564047799999986223656999973895515627899998862369857997588999999668988899998
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK  304 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRk  304 (520)
                      |++|+||||||||+|+|.|+|+|++++||++|+|+||++|.+++.+..+. +|+++.+++.++.+...+.  .+|++++.
T Consensus         1 V~vA~SGGVDSs~la~la~~alG~~v~aV~~~s~~~~~~E~e~a~~~a~~-~gi~~~~i~~~~l~~~~~~--~N~~~RCy   77 (202)
T cd01990           1 VAVAFSGGVDSTLLLKAAVDALGDRVLAVTATSPLFPRRELEEAKRLAKE-IGIRHEVIETDELDDPEFA--KNPPDRCY   77 (202)
T ss_pred             CEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHH-CCCCEEEEECCHHHHHHHC--CCCHHHHH
T ss_conf             98982385999999999999768787999972798997899999999986-3985799734111016554--59755622


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHH--HHHHHHHHH
Q ss_conf             875658999999997439970998646220245420246777630344302320113203202237898--738999999
Q gi|254780414|r  305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKE--LFKDEVRLL  382 (520)
Q Consensus       305 iIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~--l~KdEVR~l  382 (520)
                      +..+.|++.+.+.|++. +.++++|||.|+|+.|..                .|+.-...+.+++||++  |+|||||++
T Consensus        78 ~CK~~l~~~l~~~a~~~-g~~~v~dGtn~dDl~d~R----------------PGl~A~~e~~v~sPL~e~gl~K~eVR~l  140 (202)
T cd01990          78 LCKKALYEALKEIAEEL-GLDVVLDGTNADDLGDYR----------------PGLKALRELGVRSPLAEAGLGKAEIREL  140 (202)
T ss_pred             HHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCC----------------CCHHHHHHCCCCCCHHHCCCCHHHHHHH
T ss_conf             99899999999999967-997894157576323557----------------8688998769988526519788999999


Q ss_pred             HHHHCCCHHHHCCCCCCCCCCEEEEC--CCCCHHHHHHHHHHHHHHHH
Q ss_conf             99819998894268889831112210--00367899999999999999
Q gi|254780414|r  383 GKELRLPDSFVERHPCPGPGLAIRCI--GEITEERINILRESDAIYRE  428 (520)
Q Consensus       383 g~~Lglp~~~~~RhPFPGPGLaiRi~--g~vt~e~~~i~r~ad~i~~~  428 (520)
                      +++||||   +|++| |+|+||.|++  ++||+|+++++++|++++.+
T Consensus       141 a~~lgLp---~~~kp-~~~CLasRip~g~~it~e~L~~v~~aE~~L~~  184 (202)
T cd01990         141 ARELGLP---TWDKP-AMACLASRIPYGTEITEERLKKVEAAEEFLRS  184 (202)
T ss_pred             HHHCCCC---CCCCC-CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9983998---56689-98754666578884899999999999999998


No 26 
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=100.00  E-value=2.1e-37  Score=287.61  Aligned_cols=179  Identities=21%  Similarity=0.418  Sum_probs=137.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCCCCCCCCCCCC---HHHHHCCCCEE
Q ss_conf             869999889705788998888659406985289898899723997999985-38899999997537---68980899889
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPASSLDIDSPQIP---KEILESNIPLL   83 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~SV~d~~ap~~~---~~I~~~~iPIL   83 (520)
                      .+|+||||||||+|+|+|++|++|++++|..   ..+++.  ++++|||+| |+.+..-+....+.   .+.++.++|||
T Consensus         2 k~I~Iid~G~~n~~si~~~l~~lg~~~~i~~---~~~~l~--~~d~iILPGvG~~~~~~~~l~~~~~~i~~~~~~~~PiL   76 (201)
T PRK13143          2 KMIVIIDYGLGNLRSVSKGLERAGADVEITS---DPEEIL--SADGIVLPGVGAFGDVMENLGPLKETINEAVDDGKPFL   76 (201)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEECC---CHHHHH--HCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             8899998897199999999998698599928---999984--37967973888188999876515799999998699879


Q ss_pred             EECHHHHHHHHH------------CCCEEEECCC----CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCC
Q ss_conf             977899998997------------0969998698----661036675238862227872665533686002201101244
Q gi|254780414|r   84 GICYGQQIMCQS------------LGGKTKNSQS----REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPE  147 (520)
Q Consensus        84 GICyG~QlLa~~------------~GG~V~~~~~----~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~  147 (520)
                      |||||||+|+..            ++|+|.+...    +++|+..+.+.+++++|+++.   ....+||+|++.+...++
T Consensus        77 GIClGmQll~~~s~E~~~~~GLg~~~g~v~~~~~~~~ip~~G~~~i~~~~~~~l~~~i~---~~~~~yf~Hs~~~~~~~~  153 (201)
T PRK13143         77 GICLGMQMLFESSEEGGLTKGLGLIPGRVVRFPPGVKVPHMGWNTVNIVKDCPLFEGIK---DGEYFYFVHSYYADPDDP  153 (201)
T ss_pred             EEEHHHHHHHHHCCCCCCCCCCEEECCEEEECCCCCCCCCCCCEEEEEECCCHHHCCCC---CCCEEEEEEEEEEEECCC
T ss_conf             98089865534140267644536863389973654446634426876532680122866---554799971448982798


Q ss_pred             CCCEEECCC-CCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCC
Q ss_conf             421123239-831788986350011246521222152025779987550106
Q gi|254780414|r  148 GFEVIASSD-STPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAG  198 (520)
Q Consensus       148 gf~viA~S~-~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~  198 (520)
                      ++. +|.|+ ...++++ ..++++||+|||||+ +|+.|.+||+||+ ++|+
T Consensus       154 ~~~-~~~t~~~~~~~a~-i~~~ni~GvQFHPEk-s~~~G~~ilknF~-~~~k  201 (201)
T PRK13143        154 DVI-VATTDYGIEFPAV-VCKGNVFGTQFHPEK-SGETGLKILENFV-ELIK  201 (201)
T ss_pred             CCE-EEEECCCCEEEEE-EECCCEEEEECCCCC-CCCCHHHHHHHHH-HHHC
T ss_conf             626-8996199808999-938989999189823-6725599999999-9869


No 27 
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=100.00  E-value=5.4e-37  Score=284.60  Aligned_cols=175  Identities=28%  Similarity=0.476  Sum_probs=135.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-----CCCCCCCCCCCHHHHHCCCCE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-----999999975376898089988
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-----SSLDIDSPQIPKEILESNIPL   82 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-----SV~d~~ap~~~~~I~~~~iPI   82 (520)
                      .|+|+||||||+|+|+|++|++|++|+|.+   +.+++.  +.+++||+| |..     +..+.+.+...++.++.++||
T Consensus         1 mI~IiD~G~~n~~si~r~l~~lg~~~~i~~---~~~~l~--~~d~lIlPGvG~~~~~~~~l~~~~~~~~i~~~~~~~~Pi   75 (199)
T PRK13181          1 MIAIIDYGAGNLRSVANALKRLGVEAVVSS---DPEEIE--GADKVILPGVGAFGQAMAALRESGLDEAIKEHVEKKQPV   75 (199)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEC---CHHHHH--HHHCEECCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCE
T ss_conf             999998896099999999998698099979---999974--211004579865330256665638679999999769988


Q ss_pred             EEECHHHHHHHHH-----------CCCEEEECCCC-----CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCC
Q ss_conf             9977899998997-----------09699986986-----6103667523886222787266553368600220110124
Q gi|254780414|r   83 LGICYGQQIMCQS-----------LGGKTKNSQSR-----EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIP  146 (520)
Q Consensus        83 LGICyG~QlLa~~-----------~GG~V~~~~~~-----EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP  146 (520)
                      ||||||||+|+..           ++|+|.+...+     +.|+..+...+++++|+++.   ....+||+|+|.+...+
T Consensus        76 LGIClGmQlL~~~~~eg~~~GLgl~~g~v~~~~~~~~~~phiGw~~i~~~~~~~lf~~~~---~~~~~yf~Hs~~v~~~~  152 (199)
T PRK13181         76 LGICLGMQLLCESSEEGNVKGLGLIPGDVKRFRSGKDKVPQMGWNSVKPLKESPLFKGIE---ENSRFYFVHSYYVPPED  152 (199)
T ss_pred             EEEEEEEEEEEECCCCCCCCCCCEECCEEEECCCCCCCCCCCCCEEEEEECCCHHHCCCC---CCCEEEEEEEEEEECCC
T ss_conf             998042676541000365466666212899827765555777745887621684453765---55604888503786178


Q ss_pred             CCCCEEECCCCC-CE-EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             442112323983-17-889863500112465212221520257799875501
Q gi|254780414|r  147 EGFEVIASSDST-PF-AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       147 ~gf~viA~S~~~-~i-aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      ++ .++|.++.+ .+ ++++  +.++||+|||||++| +.|.+||+||+ ++
T Consensus       153 ~~-~~~a~~~~g~~~~~~v~--~~ni~GvQFHPE~s~-~~G~~il~nFl-~i  199 (199)
T PRK13181        153 PE-DVLATTNYGVPFCSAVE--KDNIYAVQFHPEKSG-KAGLKLLKNFA-EL  199 (199)
T ss_pred             CC-CEEEEECCCCEEEEEEE--CCCEEEEECCCCCCC-HHHHHHHHHHH-CC
T ss_conf             76-32799638984999998--999999908978178-60999999986-69


No 28 
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=100.00  E-value=3.1e-34  Score=264.85  Aligned_cols=181  Identities=28%  Similarity=0.457  Sum_probs=156.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH--HHCCCCEEE
Q ss_conf             869999889705788998888659406985289-89889972399799998538899999997537689--808998899
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEI--LESNIPLLG   84 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I--~~~~iPILG   84 (520)
                      -+||++|.=-.||..++..+|+++....++..+ .+.+++...+|++||+|.||.+..|.+  .....|  +..++||||
T Consensus         2 ~~IL~IDNyDSFtyNLv~yl~~lg~~v~V~rnd~~~~~~~~~~~pd~iviSPGPG~P~d~G--~~~~~i~~~~~~~PiLG   79 (191)
T COG0512           2 MMILLIDNYDSFTYNLVQYLRELGAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKDAG--ISLELIRRFAGRIPILG   79 (191)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCHHHCC--HHHHHHHHHCCCCCEEE
T ss_conf             5699997744249999999997399349998896587788604999899848997937736--18999998608998899


Q ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC--CCCCCCEEECCCC-CCEE
Q ss_conf             778999989970969998698661036675238862227872665533686002201101--2444211232398-3178
Q gi|254780414|r   85 ICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH--IPEGFEVIASSDS-TPFA  161 (520)
Q Consensus        85 ICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~--lP~gf~viA~S~~-~~ia  161 (520)
                      ||+|||.|+.+|||+|.+++..-+|++...-...+.+|+|++   +.+.|-..|+-.+.+  +|++|+++|.|++ +.++
T Consensus        80 VCLGHQai~~~fGg~V~~a~~~~HGK~s~i~h~g~~iF~glp---~~f~v~RYHSLvv~~~~lP~~l~vtA~~~d~~~IM  156 (191)
T COG0512          80 VCLGHQAIAEAFGGKVVRAKEPMHGKTSIITHDGSGLFAGLP---NPFTVTRYHSLVVDPETLPEELEVTAESEDGGVIM  156 (191)
T ss_pred             ECCCHHHHHHHHCCEEEECCCCCCCEEEEEECCCCCCCCCCC---CCCEEEEEEEEEECCCCCCCCEEEEEEECCCCEEE
T ss_conf             874378999973978875597767812554029960015799---98888862789844787998338999968998798


Q ss_pred             EEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             89863500112465212221520257799875
Q gi|254780414|r  162 FIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       162 ai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |++|++.|+||||||||+..|+.|.+||+||+
T Consensus       157 ai~h~~~pi~gvQFHPESilT~~G~~il~Nfl  188 (191)
T COG0512         157 AVRHKKLPIYGVQFHPESILTEYGHRILENFL  188 (191)
T ss_pred             EEEECCCCEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             88608998788820871036621489999998


No 29 
>PRK13566 anthranilate synthase; Provisional
Probab=100.00  E-value=7e-34  Score=262.37  Aligned_cols=191  Identities=24%  Similarity=0.406  Sum_probs=168.8

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             34488699998897057889988886594069852898988997239979999853889999999753768980899889
Q gi|254780414|r    4 RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus         4 ~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      .....|||++|.--.++|.+|+.+|++|..+.++.++.+.+.+...+|++|+||.||....|.+.+..-...+..++|||
T Consensus       520 ~~~g~rVLlVDn~DSFvhtLa~YlrqlGAeV~vvR~d~~~~~l~~~~pD~vvlSPGPG~P~d~g~~~~i~~~~~~~iPil  599 (724)
T PRK13566        520 VGSGKRVLLVDHEDSFVHTLANYFRQTGAEVTTVRYPVAEEILDRVNPDLVVLSPGPGRPEDFDCKATIDAALARNLPIF  599 (724)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHHCCEEEEEECCCCHHHHHHHCCCEEEECCCCCCCHHCCCHHHHHHHHHCCCCEE
T ss_conf             78775799984653279999999998198799981898767776318898998799979000558599999985799879


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEE-EEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCCCCCE
Q ss_conf             97789999899709699986986610366-7523886222787266553368600220110--12444211232398317
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAF-IEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSDSTPF  160 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~-I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~~~~i  160 (520)
                      |+|+|||.|+.+|||+|.+.+..-+|++. |..+....+|.|+   ++.+.+-..|+-.+.  .+|++++++|.|+++.|
T Consensus       600 GVCLGhQaI~eafGg~l~~~~~p~HGK~S~I~~~~~~~~F~gl---p~~f~v~RYHSL~v~~~~lP~~L~VTA~tedGvi  676 (724)
T PRK13566        600 GVCLGLQAIVEAFGGELGQLAYPMHGKPSRIRVRGPGLVFSGL---PNEFTVGRYHSLFADPERLPDELLVTAETEDGVI  676 (724)
T ss_pred             EECCCHHHHHHHHCCEEEECCCCCCCCEEEEEEECCCCCCCCC---CCCEEEEEEEEEEECCCCCCCCEEEEEECCCCEE
T ss_conf             9771276998974938854585788981357984897410789---9960788413798626779983389998589828


Q ss_pred             EEEEECCCCEEEEEEEEHHHCC---CHHHHHHHHHHHHHC
Q ss_conf             8898635001124652122215---202577998755010
Q gi|254780414|r  161 AFIADEKRKYYAVQFHPEVVHT---VGGSQLIDNFVHHVA  197 (520)
Q Consensus       161 aai~~~~~~iyGVQFHPEV~hT---~~G~~iL~NFl~~Ic  197 (520)
                      +|++|+..|++|||||||+..|   +.|.+||+|++-...
T Consensus       677 Mai~H~~lpi~gVQFHPESIlT~~g~~G~~ii~N~~~~~~  716 (724)
T PRK13566        677 MAIEHKTLPVAAVQFHPESIMTLGGEVGLRIIENVVRLLA  716 (724)
T ss_pred             EEEEECCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHHHH
T ss_conf             9885178761256107678622887443999999999986


No 30 
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=100.00  E-value=6.5e-35  Score=269.75  Aligned_cols=172  Identities=24%  Similarity=0.373  Sum_probs=132.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-----CCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             9999889705788998888659406985289898899723997999985-388-----9999999753768980899889
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-----SSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-----SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      |.|||||+||+|+|+|++|++|++|+++.   +.+++.  ++++|||+| |..     +..+.+......+.++.++|||
T Consensus         1 I~IiD~G~~ni~si~~~l~~lg~~~~ii~---~~~~l~--~~d~iIlPGvG~f~~~~~~l~~~~~~~~i~~~~~~~~PiL   75 (198)
T cd01748           1 IAIIDYGMGNLRSVANALERLGAEVIITS---DPEEIL--SADKLILPGVGAFGDAMANLRERGLIEALKEAIASGKPFL   75 (198)
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCCEEEEC---CHHHHH--HCCEEEECCCCCCHHHHHHHHHCCHHHHHHHHHHCCCCEE
T ss_conf             99997697789999999998799299979---999983--0898998788740344444100381999999987699689


Q ss_pred             EECHHHHHHHHH------------CCCEEEECCCC------CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCC
Q ss_conf             977899998997------------09699986986------610366752388622278726655336860022011012
Q gi|254780414|r   84 GICYGQQIMCQS------------LGGKTKNSQSR------EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHI  145 (520)
Q Consensus        84 GICyG~QlLa~~------------~GG~V~~~~~~------EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~l  145 (520)
                      |||+|||+|+..            ++|+|.+.+..      +.|+..+...+++++|.++.   ....+||+|++.+. .
T Consensus        76 GIClG~QlL~~~s~E~~~~~gLg~~~g~V~~~~~~~~~~iP~iGwn~i~~~~~~~~~~~~~---~~~~~yF~HS~~v~-~  151 (198)
T cd01748          76 GICLGMQLLFESSEEGGGTKGLGLIPGKVVRFPASEGLKVPHMGWNQLEITKESPLFKGIP---DGSYFYFVHSYYAP-P  151 (198)
T ss_pred             EEEEEEEEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCHHCCCC---CCCEEEEEECCEEE-C
T ss_conf             9981145466676506863553655409998877778866411224675033680320777---67535886241775-2


Q ss_pred             CCCCCEEECCCC-CC-EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             444211232398-31-7889863500112465212221520257799875
Q gi|254780414|r  146 PEGFEVIASSDS-TP-FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       146 P~gf~viA~S~~-~~-iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      ++...++|.++. .. +++++  .+++||+|||||++| +.|.+||+||+
T Consensus       152 ~~~~~~~a~~~~~~~~~a~i~--~~ni~GvQFHPEkS~-~~G~~ll~nFl  198 (198)
T cd01748         152 DDPDYILATTDYGGKFPAAVE--KDNIFGTQFHPEKSG-KAGLKLLKNFL  198 (198)
T ss_pred             CCCCEEEEEECCCCEEEEEEE--CCCEEEEECCCCCCC-HHHHHHHHHHC
T ss_conf             897506889759983999998--799999978985247-60899999539


No 31 
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents the small subunit of the glutamine-dependent form (6.3.5.5 from EC) of carbamoyl phosphate synthase, CPSase II. The small subunit catalyses the hydrolysis of glutamine to ammonia, which in turn used by the large chain to synthesize carbamoyl phosphate. The C-terminal domain of the small subunit of CPSase has glutamine amidotransferase activity. Note that the sequence from the mammalian urea cycle form has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I (6.3.4.16 from EC). CPSases of pyrimidine biosynthesis, arginine biosynthesis, and the urea cycle may be encoded by one or by several genes, depending on the species. ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=100.00  E-value=2.7e-33  Score=258.13  Aligned_cols=172  Identities=27%  Similarity=0.486  Sum_probs=134.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-CCC----CCCHHHHHCCCCE
Q ss_conf             86999988970578899888865940698528989889972399799998538899999-997----5376898089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-DSP----QIPKEILESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-~ap----~~~~~I~~~~iPI   82 (520)
                      -+|+++|||.+.+  |.|++-+-|+--.|+||++++++|++.+||||+||+||.   |+ .+.    ..-+++++.++|+
T Consensus       197 ~~Vv~~DfG~K~n--Ilr~L~~rG~~v~vVP~~~~~~~i~~~~PDGiflSNGPG---DPH~~~~~~i~~~~~l~~~~~P~  271 (383)
T TIGR01368       197 LRVVVIDFGVKQN--ILRRLVKRGCEVTVVPYDTDAEEIKKYNPDGIFLSNGPG---DPHAAVEPAIETVRELLEAKIPI  271 (383)
T ss_pred             EEEEEEECCCCHH--HHHHHHHCCCEEEEECCCCCHHHHHHHCCCEEEEECCCC---CCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             5999985588755--898997669879996789988999865788899908798---80567899999999998448971


Q ss_pred             EEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEE---CCCHHH--CCC-CCCCEEECCC
Q ss_conf             9977899998997096999869866103667523886222787266553368600---220110--124-4421123239
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMS---HGDQVE--HIP-EGFEVIASSD  156 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmS---H~D~V~--~lP-~gf~viA~S~  156 (520)
                      ||||+||||||.|+||+..|.+-+..|.       |.|.-+ +    .+-+|.|+   ||++|+  .|| .+|+++-.+-
T Consensus       272 fGICLGHQllALA~Ga~TyKlKFGHRG~-------NhPV~~-~----~~g~v~ITsQNHGyAVD~~sl~~~~~~~th~nL  339 (383)
T TIGR01368       272 FGICLGHQLLALAFGAKTYKLKFGHRGG-------NHPVKD-L----RTGRVEITSQNHGYAVDEESLLAGDLEVTHVNL  339 (383)
T ss_pred             CCCCHHHHHHHHHCCCCEEECCCCCCCC-------CCCEEE-C----CCCEEEEEEECCCEECCHHHCCCCCEEEEEEEC
T ss_conf             0026668999997388700046567887-------513144-2----798799997068712575355788538999835


Q ss_pred             -CCCEEEEEECCCCEEEEEEEEHHHCCCHHHH-HHHHHHHHH
Q ss_conf             -8317889863500112465212221520257-799875501
Q gi|254780414|r  157 -STPFAFIADEKRKYYAVQFHPEVVHTVGGSQ-LIDNFVHHV  196 (520)
Q Consensus       157 -~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~-iL~NFl~~I  196 (520)
                       |+.+|+|+|+++|+|+||||||.+-.|+-.. ||+.|+-.|
T Consensus       340 NDgt~EG~~h~~~P~fSVQyHPEA~PGPhD~~~lFd~F~~~~  381 (383)
T TIGR01368       340 NDGTVEGIRHKDLPVFSVQYHPEASPGPHDTEYLFDEFIDLI  381 (383)
T ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             979331530058786677006888887002379999999998


No 32 
>PRK13175 consensus
Probab=100.00  E-value=3.8e-32  Score=249.99  Aligned_cols=178  Identities=24%  Similarity=0.321  Sum_probs=132.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCC------CCCCCCCCCCCHHHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985388------99999997537689808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA------SSLDIDSPQIPKEILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~------SV~d~~ap~~~~~I~~~~iP   81 (520)
                      .||+|||||+|+.++|+|++|++|+++++..   ..+++.  +.+++||+|+-+      +..+.+......+.++.++|
T Consensus         2 ~kI~IiD~g~gn~~si~~al~~lg~~~~i~~---~~~~i~--~~d~lILPGvGsf~~~~~~l~~~~l~~~i~~~~~~g~P   76 (206)
T PRK13175          2 PKIAVIDYGMGNLHSVCKALERLGAEPILTS---DPADLL--AADALILPGVGAFDPAMQNLRSRGLIPPIKDAIASGKP   76 (206)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEC---CHHHHH--CCCEEEECCCCCCHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             8799997997689999999998799899979---989983--28928968998526788755531871689999856997


Q ss_pred             EEEECHHHHHHHHH-----------CCCEEEECC------CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC
Q ss_conf             89977899998997-----------096999869------8661036675238862227872665533686002201101
Q gi|254780414|r   82 LLGICYGQQIMCQS-----------LGGKTKNSQ------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH  144 (520)
Q Consensus        82 ILGICyG~QlLa~~-----------~GG~V~~~~------~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~  144 (520)
                      |||||+|||+|+..           ++|+|.+..      .++.|+..+...+++++|+++.   ....+|++|++++..
T Consensus        77 iLGIClGmQlL~~~seeg~~~GLgli~g~V~k~~~~~~~~iPh~Gw~~i~~~~~~~l~~~~~---~~~~~yf~HSy~~~~  153 (206)
T PRK13175         77 FLGICLGLQLLFESSEEGTEPGLGILPGKVQRFPSEPGLRIPHMGWNQLLTQPDCPLWENLP---PNPWVYFVHSYYAVP  153 (206)
T ss_pred             EEEEEHHHHHHHHCCCCCCCCCCCEECEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCC---CCCCEEEEECCEEEE
T ss_conf             79986786676132534564776352107986265555337610450578517884201126---788238975007840


Q ss_pred             CCCCCCEEECCC--CCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             244421123239--83178898635001124652122215202577998755010
Q gi|254780414|r  145 IPEGFEVIASSD--STPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       145 lP~gf~viA~S~--~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                      .++...+...+.  ...+++++.  .++||+|||||.++ +.|.+||+||| +.|
T Consensus       154 ~~~~~~~~~~~~~~~~~~a~v~~--~ni~G~QFHPEkS~-~~G~~llknFl-~~v  204 (206)
T PRK13175        154 LDPSDTAATVTHGSQKVTAAIAR--DNLMAVQFHPEKSG-TAGLKLLRNFV-SQV  204 (206)
T ss_pred             CCCCCEEEEEECCCCCEEEEEEC--CCEEEEECCCCCCC-CCHHHHHHHHH-HHH
T ss_conf             68762699996089838999978--99999948982468-43789999999-996


No 33 
>PRK09065 glutamine amidotransferase; Provisional
Probab=100.00  E-value=3.3e-32  Score=250.39  Aligned_cols=168  Identities=27%  Similarity=0.452  Sum_probs=135.4

Q ss_pred             CCEEEEEECCC----------CHHHHHHHHHHHCCCEEEEECC-C-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH-
Q ss_conf             88699998897----------0578899888865940698528-9-898899723997999985388999999975376-
Q gi|254780414|r    7 SSKVLIIDFGS----------QFTQLIARRVRESKVYCEVIAF-K-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPK-   73 (520)
Q Consensus         7 ~~~IlIlDfGS----------QytqLIaRriRelgVyseI~P~-~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~-   73 (520)
                      .-||+||.+|.          +|...+.+-+++.+.--+++.. + ..+..+  .+++|+|++|||+|||| +.|++.+ 
T Consensus         3 m~ki~IL~~g~~~~~~~~~~G~y~~~f~~ll~~~~~~~~~~~v~~ge~~p~~--~~~dg~iitGS~~~v~d-~~pWi~~l   79 (238)
T PRK09065          3 MLPLLIIETGTPPPSIRARYGDFPHWIRVALGLAEQPVVVVDVFAGEPLPAP--EDFAGVLITGSHAMVTD-RAPWSERT   79 (238)
T ss_pred             CCEEEEEECCCCCHHHHHHCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCH--HHCCEEEEECCCCCCCC-CCHHHHHH
T ss_conf             6169999889898799987399899999987236985799967279899895--78488999798520579-98889999


Q ss_pred             -----HHHHCCCCEEEECHHHHHHHHHCCCEEEECCC-CCCCEEEEEECC---CCCCCCCCCCCCCCEEEEEECCCHHHC
Q ss_conf             -----89808998899778999989970969998698-661036675238---862227872665533686002201101
Q gi|254780414|r   74 -----EILESNIPLLGICYGQQIMCQSLGGKTKNSQS-REFGRAFIEIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEH  144 (520)
Q Consensus        74 -----~I~~~~iPILGICyG~QlLa~~~GG~V~~~~~-~EyG~~~I~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~  144 (520)
                           ++++.++|+||||||||+||+++||+|.+.+. .|.|...++++.   .+++|.++   +..+.++++|+|.|.+
T Consensus        80 ~~~ir~~~~~~~PilGICfGhQllA~AlGG~V~~~p~G~eiG~~~v~lt~~g~~dplf~~~---p~~~~~~~~H~D~V~~  156 (238)
T PRK09065         80 ADWLRQAAAAGMPLLGICYGHQLLAHALGGEVGYNPAGRESGTVALELHPAAAQDPLFAGL---PATFPAHATHLQTVLR  156 (238)
T ss_pred             HHHHHHHHHCCCCEEEEEHHHHHHHHHHCCEEEECCCCCCCCEEEEEECHHCCCCCHHCCC---CCCCEEEEEEECEEEE
T ss_conf             9999999877999999817789999984987976799763651256875100457111189---8761799995142896


Q ss_pred             CCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHC
Q ss_conf             2444211232398317889863500112465212221
Q gi|254780414|r  145 IPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH  181 (520)
Q Consensus       145 lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~h  181 (520)
                      +|+|++++|+|+.|++++++..+ ++||+|||||.++
T Consensus       157 lP~ga~~LAss~~c~~qa~~~g~-~~~gvQfHPEft~  192 (238)
T PRK09065        157 LPPGAVVLARSAHDPHQAFRYGP-SAWGVQFHPEFTA  192 (238)
T ss_pred             CCCCEEEEEECCCCHHHHEEECC-CEEEEECCCCCCH
T ss_conf             49983899809999057178589-4899956862899


No 34 
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed
Probab=99.97  E-value=2.4e-31  Score=244.30  Aligned_cols=176  Identities=27%  Similarity=0.450  Sum_probs=137.8

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-CCCCCCHHHHHCCCCEE
Q ss_conf             44886999988970578899888865940698528989889972399799998538899999-99753768980899889
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-DSPQIPKEILESNIPLL   83 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-~ap~~~~~I~~~~iPIL   83 (520)
                      ....+|+++|||.+++  |.|.+.+.|+...++||+++++++.+.+|+||+||+||....+- .+...-+++++.++|||
T Consensus       169 ~~~~~V~viD~GvK~n--Ilr~L~~rg~~v~VvP~~~~~~~I~~~~pDGIflSNGPGDP~~~~~~i~~ik~li~~~~Pif  246 (355)
T PRK12564        169 GGGYHVVAIDFGVKRN--ILRELAERGCRVTVVPATTTAEEILALNPDGVFLSNGPGDPAALDYAIEMIKELLEGKIPIF  246 (355)
T ss_pred             CCCEEEEEEECCCHHH--HHHHHHHCCCEEEEECCCCCHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             9971899993787388--99999987986999689787657641488889967999996887999999999852698789


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEE---ECCCHHH--CCCCCCCEEECCC-C
Q ss_conf             97789999899709699986986610366752388622278726655336860---0220110--1244421123239-8
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWM---SHGDQVE--HIPEGFEVIASSD-S  157 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~Vwm---SH~D~V~--~lP~gf~viA~S~-~  157 (520)
                      |||+|||+||.++|+++.|.+.+..|.       +.|..+ +    .+-.||+   .||++|.  .+|++++++..+- +
T Consensus       247 GICLGHQllalA~Ga~t~Km~fGHrG~-------NhPV~~-l----~t~~v~iTSQNHGyaVd~~sl~~~~~vt~~nlnD  314 (355)
T PRK12564        247 GICLGHQLLALALGAKTYKMKFGHRGA-------NHPVKD-L----ETGKVEITSQNHGFAVDEDSLPENLEVTHVNLND  314 (355)
T ss_pred             EECHHHHHHHHHCCCEECCCCCCCCCC-------CCCCEE-C----CCCEEEEEECCCCEEECCCCCCCCEEEEEEECCC
T ss_conf             988879999997198442055565789-------977335-5----7873999716742286666589873999993899


Q ss_pred             CCEEEEEECCCCEEEEEEEEHHHCCCH-HHHHHHHHHH
Q ss_conf             317889863500112465212221520-2577998755
Q gi|254780414|r  158 TPFAFIADEKRKYYAVQFHPEVVHTVG-GSQLIDNFVH  194 (520)
Q Consensus       158 ~~iaai~~~~~~iyGVQFHPEV~hT~~-G~~iL~NFl~  194 (520)
                      +.+++++|+++|+|+||||||..-.+. ..-+++.|+-
T Consensus       315 gtvEGi~h~~~p~fSVQfHPEa~pGP~D~~~lFd~F~~  352 (355)
T PRK12564        315 GTVEGLRHKDLPAFSVQYHPEASPGPHDAAYLFDEFVE  352 (355)
T ss_pred             CCCCCEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             96721788899878972188999899753889999999


No 35 
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine 
Probab=99.97  E-value=3.9e-31  Score=242.74  Aligned_cols=174  Identities=27%  Similarity=0.476  Sum_probs=133.3

Q ss_pred             EEEEEECCCCH-HHHHHHHHHHCC---CEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH------HHHHC
Q ss_conf             69999889705-788998888659---406985289898899723997999985388999999975376------89808
Q gi|254780414|r    9 KVLIIDFGSQF-TQLIARRVRESK---VYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPK------EILES   78 (520)
Q Consensus         9 ~IlIlDfGSQy-tqLIaRriRelg---VyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~------~I~~~   78 (520)
                      +|+||.....- .-.....+|+.+   +...++........-...+++|+|+||||+||++++.|++.+      ++++.
T Consensus         1 ~i~il~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~dgvii~Gg~~~~~~~~~pwi~~~~~~i~~~~~~   80 (188)
T cd01741           1 RILILQHDTPEGPGLFEDLLREAGAETIEIDVVDVYAGELLPDLDDYDGLVILGGPMSVDEDDYPWLKKLKELIRQALAA   80 (188)
T ss_pred             CEEEEECCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             98999779999974899999966998468999966669899784440889996998777867886699999999999987


Q ss_pred             CCCEEEECHHHHHHHHHCCCEEEECCCC-CCCEEEEEECC---CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEEC
Q ss_conf             9988997789999899709699986986-61036675238---8622278726655336860022011012444211232
Q gi|254780414|r   79 NIPLLGICYGQQIMCQSLGGKTKNSQSR-EFGRAFIEIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIAS  154 (520)
Q Consensus        79 ~iPILGICyG~QlLa~~~GG~V~~~~~~-EyG~~~I~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~  154 (520)
                      ++|+||||||||+||.++||+|.+++.+ |.|...+.+++   .+++|.++   +..+.++++|+|.|.++|++++++|+
T Consensus        81 ~~PilGIC~G~Qlla~alGg~V~~~~~~~e~G~~~i~lt~~~~~~~~~~~~---~~~~~~~~~H~d~v~~lP~~~~~la~  157 (188)
T cd01741          81 GKPVLGICLGHQLLARALGGKVGRNPKGWEIGWFPVTLTEAGKADPLFAGL---PDEFPVFHWHGDTVVELPPGAVLLAS  157 (188)
T ss_pred             CCCEEEECHHHHHHHHHCCCEEEECCCCCCEEEEEEEEECCCCCCCCCCCC---CCCCCHHHHHHEEEEECCCCCEEEEE
T ss_conf             999999846899999983999987898752157999995476654221479---97654340210272438999899998


Q ss_pred             CCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             398317889863500112465212221520257799875
Q gi|254780414|r  155 SDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       155 S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |+.|+++|++..+ ++||+|||||       ..+++||+
T Consensus       158 s~~~~~qa~~~~~-~~~g~QfHPE-------~~~~~~f~  188 (188)
T cd01741         158 SEACPNQAFRYGD-RALGLQFHPE-------ERLLRNFL  188 (188)
T ss_pred             CCCCCEEEEEECC-EEEEEECCCC-------HHHHHHCC
T ss_conf             8999788999799-5899957612-------76676309


No 36 
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=99.97  E-value=1.1e-30  Score=239.47  Aligned_cols=177  Identities=25%  Similarity=0.431  Sum_probs=133.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCC-CCCCCCCCHH---HHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-999-9999753768---9808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSL-DIDSPQIPKE---ILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~-d~~ap~~~~~---I~~~~iP   81 (520)
                      ..|.|+|||+|+.++|+|.+|++|+.++++.   +.+++.  +.+++||+| |.. +.. .-....++..   ..+.++|
T Consensus         1 ~mI~Iid~g~gNi~si~~al~~lG~~~~ii~---~~~~l~--~~d~lIlPGvGsf~~~~~~L~~~~l~~~i~~~~~~~~P   75 (204)
T PRK13141          1 TMIAIIDYGMGNLHSVSKALERLGAEAIITS---DPEEIL--AADAVILPGVGAFPDAMQNLRERGLVEVIKEAVASGKP   75 (204)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEC---CHHHHH--HCCEEEECCCCCCHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             9899997897589999999998699899979---999984--08989986887505687764653929999999865996


Q ss_pred             EEEECHHHHHHHHH------------CCCEEEECCCC------CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH
Q ss_conf             89977899998997------------09699986986------6103667523886222787266553368600220110
Q gi|254780414|r   82 LLGICYGQQIMCQS------------LGGKTKNSQSR------EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE  143 (520)
Q Consensus        82 ILGICyG~QlLa~~------------~GG~V~~~~~~------EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~  143 (520)
                      |||||+|||+|+..            +.|+|.+....      +.||..+...+++++|++++   ....+|++|++.+.
T Consensus        76 iLGIClGmQlL~~~s~E~g~~~GLgl~~g~v~~~~~~~~~~vPhiGw~~i~~~~~~~l~~~~~---~~~~~yf~HSy~v~  152 (204)
T PRK13141         76 LLGICLGMQLLFESSEEFGDTEGLGLLPGKVRRFPPGEGLKVPHMGWNQLEFTRPSPLLAGLP---EGAYVYFVHSYYAD  152 (204)
T ss_pred             EEEEHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCEEEEECCCCHHHHCCC---CCCCEEEEECCEEE
T ss_conf             897549899973013104664665436689997788888856510305776113780541677---77723786242783


Q ss_pred             CCCCCCCEEECCCC-CCE-EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             12444211232398-317-8898635001124652122215202577998755010
Q gi|254780414|r  144 HIPEGFEVIASSDS-TPF-AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       144 ~lP~gf~viA~S~~-~~i-aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                       .++...++|.++. ..+ ++++.  .++||+|||||.+|+ .|.+||+||+ ++|
T Consensus       153 -~~~~~~~~a~~~~g~~i~a~i~~--~ni~G~QFHPEkS~~-~G~~ilknFl-~l~  203 (204)
T PRK13141        153 -PPDEEVVAATCDYGQKFPAAVAK--DNLFGVQFHPEKSGD-IGLKILKNFL-EMV  203 (204)
T ss_pred             -CCCCCCEEEEECCCCEEEEEEEC--CCEEEEECCCCCCCH-HHHHHHHHHH-HHH
T ss_conf             -38975289995599889999971--999999889851485-2799999999-974


No 37 
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional
Probab=99.97  E-value=9.6e-31  Score=239.95  Aligned_cols=174  Identities=25%  Similarity=0.432  Sum_probs=135.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-CCCCCCHHHHH-CCCCEEE
Q ss_conf             886999988970578899888865940698528989889972399799998538899999-99753768980-8998899
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-DSPQIPKEILE-SNIPLLG   84 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-~ap~~~~~I~~-~~iPILG   84 (520)
                      .-+|+++|||..++  |.|.+.+.|+...++|++++++++...+|+||+||+||....+- .+....+++++ .++||||
T Consensus       194 ~~~VvviD~GiK~n--ILr~L~~~g~~v~VvP~~~~~~~I~~~~PDGIfLSNGPGDP~~~~~~i~~i~~li~~~~iPifG  271 (383)
T CHL00197        194 PLRIIVIDFGVKYN--ILRRLKSFGCEITIVPATSTYQDIMAYQPDGILLSNGPGDPSTVHYGIKTVKKLIKKANIPIFG  271 (383)
T ss_pred             CCEEEEEECCCCHH--HHHHHHHCCCEEEEECCCCCCCHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             74599996777188--9999997899899989998511342568888997899999789899999999999648997899


Q ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCE-EEEEECCCCCCCCCCCCCCCCEEEEE---ECCCHH--HCCCCC-CCEEECCC-
Q ss_conf             77899998997096999869866103-66752388622278726655336860---022011--012444-21123239-
Q gi|254780414|r   85 ICYGQQIMCQSLGGKTKNSQSREFGR-AFIEIKKNCSLLKGMWEKGSKQQVWM---SHGDQV--EHIPEG-FEVIASSD-  156 (520)
Q Consensus        85 ICyG~QlLa~~~GG~V~~~~~~EyG~-~~I~i~~~~~lf~gl~~~~~~~~Vwm---SH~D~V--~~lP~g-f~viA~S~-  156 (520)
                      ||+|||+||.++|+++.|.+.+..|. .++..               +-.||+   .||++|  .++|++ ++++..+- 
T Consensus       272 ICLGHQlLalA~GakT~KmkfGHrG~NhPV~~---------------t~kv~ITSQNHGyaVd~~sl~~~~~~vt~~nln  336 (383)
T CHL00197        272 ICMGHQILSLALEAKTFKLKFGHRGLNHPSGL---------------NQQVEITSQNHGFAVNAESLAKNKVYVTHFNLN  336 (383)
T ss_pred             ECHHHHHHHHHCCCEEEECCCCCCCCCCCCCC---------------CCCEEEEECCCCEEECCCCCCCCCCEEEEECCC
T ss_conf             55889999997398375668887798866015---------------875799627876176744478873189999388


Q ss_pred             CCCEEEEEECCCCEEEEEEEEHHHCCCH-HHHHHHHHHHHHC
Q ss_conf             8317889863500112465212221520-2577998755010
Q gi|254780414|r  157 STPFAFIADEKRKYYAVQFHPEVVHTVG-GSQLIDNFVHHVA  197 (520)
Q Consensus       157 ~~~iaai~~~~~~iyGVQFHPEV~hT~~-G~~iL~NFl~~Ic  197 (520)
                      ++.+++++|+++|+|+||||||..-.+. ..-+++.|+-.|-
T Consensus       337 D~tvEG~~~~~~p~fsvQfHPEa~pGP~Ds~~lF~~F~~~~~  378 (383)
T CHL00197        337 DGTVAGISHSPKPYFSVQYHPEASPGPHDADYLFEYFIEIMK  378 (383)
T ss_pred             CCCCCCEEECCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             896148698899878877488989898730889999999999


No 38 
>PRK07053 glutamine amidotransferase; Provisional
Probab=99.97  E-value=3.8e-30  Score=235.67  Aligned_cols=177  Identities=23%  Similarity=0.367  Sum_probs=137.9

Q ss_pred             CCEEEEEEC-CCCHHHHHHHHHHHCCCEEEEE-CCCCCHHHHHHCCCCEEEECCCCCCCCCCCC-CCCCHH------HHH
Q ss_conf             886999988-9705788998888659406985-2898988997239979999853889999999-753768------980
Q gi|254780414|r    7 SSKVLIIDF-GSQFTQLIARRVRESKVYCEVI-AFKNALDYFKEQNPQAIILSGSPASSLDIDS-PQIPKE------ILE   77 (520)
Q Consensus         7 ~~~IlIlDf-GSQytqLIaRriRelgVyseI~-P~~~~~e~i~~~~p~GIILSGGP~SV~d~~a-p~~~~~------I~~   77 (520)
                      ..+|||+-. -...--.|.+-+++.|+--+++ ++.-....-...+++|+|+.|||+||||++. |++..+      .++
T Consensus         2 mk~ilvlqH~~~E~pG~i~~~l~~~g~~~~~~~~~~~~~~p~~~~~~d~livlGGpms~~d~~~~Pwl~~e~~lIr~a~~   81 (235)
T PRK07053          2 MKTAVAIRHVAFEDLGSFEQVLGERGYRVRYVDVGVDDLEVLDALEPDLLVVLGGPIGVYDDALYPFLAPEIALLRQRLA   81 (235)
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             95399996899889869999999789959999678898899996667999993899898877668558999999999998


Q ss_pred             CCCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECC---CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEEC
Q ss_conf             8998899778999989970969998698661036675238---8622278726655336860022011012444211232
Q gi|254780414|r   78 SNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIAS  154 (520)
Q Consensus        78 ~~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~  154 (520)
                      .++|+||||||+|+||+++||+|.++..+|+|+..+..+.   .++++...   +....|+++|+|.+ ++|+|++++|+
T Consensus        82 ~~~PvLGIClG~QLlA~AlGG~V~~~~~~EiG~~~v~~t~~~~~dpl~~~~---~~~~~v~~wH~D~~-~LP~ga~~LAs  157 (235)
T PRK07053         82 AGLPTLGICLGAQLIARALGARVYPGAQKEIGWAPLTLTDAGRASPLRHLD---GADTPVLHWHGDTF-DLPEGAILLAS  157 (235)
T ss_pred             CCCCEEEECHHHHHHHHHHCCEEECCCCCCEEEEEEEECCCCCCCCHHCCC---CCCCEEEEEECEEE-ECCCCCEEEEC
T ss_conf             699889984738999997097786089960058877855123577000148---76772799954085-34998389982


Q ss_pred             CCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             398317889863500112465212221520257799875
Q gi|254780414|r  155 SDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       155 S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |+.|+++||+..+ ++||+|||||++.     .+++.++
T Consensus       158 s~~c~~Qaf~~g~-~~~g~QFHpE~t~-----~~v~~W~  190 (235)
T PRK07053        158 TPACRNQAFAWGN-HVLALQFHPEIRA-----DRFEPWL  190 (235)
T ss_pred             CCCCHHHHEEECC-CEEEEECCEECCH-----HHHHHHH
T ss_conf             8998589678479-6899965846888-----9999999


No 39 
>PRK05665 amidotransferase; Provisional
Probab=99.97  E-value=1.8e-30  Score=238.07  Aligned_cols=209  Identities=23%  Similarity=0.333  Sum_probs=148.0

Q ss_pred             EEEEEECCC----------CHHHHHHHHHHHCCCEEEEECCCC----CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH-
Q ss_conf             699998897----------057889988886594069852898----98899723997999985388999999975376-
Q gi|254780414|r    9 KVLIIDFGS----------QFTQLIARRVRESKVYCEVIAFKN----ALDYFKEQNPQAIILSGSPASSLDIDSPQIPK-   73 (520)
Q Consensus         9 ~IlIlDfGS----------QytqLIaRriRelgVyseI~P~~~----~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~-   73 (520)
                      ||+||..|.          .|.....+-+++.+...++..|++    .+..+  .+++|+|++|||+||||+. ||+.+ 
T Consensus         4 ki~IL~~d~~~~~~~~~~g~y~~mF~~ll~~~~~~~~~~~~~v~~ge~P~~~--~~~dg~vITGS~~~vyd~~-pWi~~L   80 (240)
T PRK05665          4 RICILETDVLRPELVAQYQGYGRMFEQLFARQPIAAEFVVYNVVQGDYPADD--EKFDAYLVTGSKADSFGTD-PWIQTL   80 (240)
T ss_pred             EEEEEECCCCCHHHHHHCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCH--HHCCEEEEECCCCCCCCCC-HHHHHH
T ss_conf             8999978999878997749988999999961899855999970068799897--7878999958987468996-769999


Q ss_pred             -----HHHHCCCCEEEECHHHHHHHHHCCCEEEECCCC-CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCC
Q ss_conf             -----898089988997789999899709699986986-61036675238862227872665533686002201101244
Q gi|254780414|r   74 -----EILESNIPLLGICYGQQIMCQSLGGKTKNSQSR-EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPE  147 (520)
Q Consensus        74 -----~I~~~~iPILGICyG~QlLa~~~GG~V~~~~~~-EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~  147 (520)
                           ++.+.++|+||||||||+||+++||+|++++.+ |.|...++++...+.+.+.   ...+.+++||+|.|.++|+
T Consensus        81 ~~~i~~~~~~~~pilGICfGHQliA~ALGG~V~~~~~Gw~vG~~~~~~~~~~~~~~~~---~~~~~l~~~H~D~V~~lP~  157 (240)
T PRK05665         81 KTYLLKLYERGDKLLGVCFGHQLLALLLGGKAERASQGWGVGIHRYQLAAHAPWMSPA---VTELTLLISHQDQVTALPE  157 (240)
T ss_pred             HHHHHHHHHCCCCEEEEEHHHHHHHHHHCCEEEECCCCCEEEEEEEEECCCCCCCCCC---CCCCEEEEEECCEEEECCC
T ss_conf             9999999876999899944368888860983612799736667998875877433587---5640799772242785799


Q ss_pred             CCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             42112323983178898635001124652122215202577998755010644111406789999999976504440366
Q gi|254780414|r  148 GFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVIC  227 (520)
Q Consensus       148 gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~  227 (520)
                      |++++|+|+.|++++++..+ ++|++|||||.++ +.-..+|+.-- +      .+ .++..++.++.+.          
T Consensus       158 ga~~Lass~~cp~q~~~~~~-~~~~~Q~HPEf~~-~~~~~ll~~R~-~------~i-~~~~~~~a~~sl~----------  217 (240)
T PRK05665        158 GATVIASSDFCPNAAYHIRD-QVLCFQGHPEFVH-DYSRALLDLRQ-E------HL-GEEVYSKGVASLA----------  217 (240)
T ss_pred             CEEEEEECCCCCHHHEECCC-CEEEEECCCCCCH-HHHHHHHHHHH-H------HC-CHHHHHHHHHHHC----------
T ss_conf             84899867998333426278-6899916968799-99999999977-6------36-9999999999706----------


Q ss_pred             EECCCCHHHHHHHHHHHHC
Q ss_conf             4056404779999998622
Q gi|254780414|r  228 AVSGGVDSTVAAFLIYEAI  246 (520)
Q Consensus       228 ~lSGGVDStV~A~Ll~kAi  246 (520)
                         --.|..+.|..+-+-+
T Consensus       218 ---~~~D~~~~a~~i~~Fl  233 (240)
T PRK05665        218 ---HDHQGTLVAEWMMRFV  233 (240)
T ss_pred             ---CCCCHHHHHHHHHHHH
T ss_conf             ---8875899999999998


No 40 
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed
Probab=99.97  E-value=2.6e-30  Score=236.83  Aligned_cols=179  Identities=26%  Similarity=0.468  Sum_probs=136.0

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-CCCCCCHHHHHCCCCEE
Q ss_conf             44886999988970578899888865940698528989889972399799998538899999-99753768980899889
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-DSPQIPKEILESNIPLL   83 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-~ap~~~~~I~~~~iPIL   83 (520)
                      ....+|+++|||-+.+  |.|.+.+.|+...++|++++++++.+.+|+||+||+||....+- ......++++ .++|||
T Consensus       165 ~~~~~V~viD~GvK~n--Ilr~L~~rg~~V~VvP~~~~~~~i~~~~pDGiflSNGPGDP~~~~~~i~~vr~l~-~~~Pif  241 (356)
T PRK12838        165 NGGKHVALIDFGLKHS--ILRSLSKRGCNVTVLPYNASLEDIKNLNPDGIVLSNGPGDPKELQPYLPTIKDLA-SSYPIL  241 (356)
T ss_pred             CCCEEEEEEECCCHHH--HHHHHHHCCCEEEEECCCCCCCHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHH-CCCCEE
T ss_conf             9975799995883699--9999997898899989988754023249748994389989688788999999997-498889


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEE---ECCCHHH--CCC-CCCCEEECCC-
Q ss_conf             97789999899709699986986610366752388622278726655336860---0220110--124-4421123239-
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWM---SHGDQVE--HIP-EGFEVIASSD-  156 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~Vwm---SH~D~V~--~lP-~gf~viA~S~-  156 (520)
                      |||+|||+||.++|+++.|.+.+..|.       +.|..+ +    .+-.||+   .||++|.  .+| .+++++..+- 
T Consensus       242 GICLGHQllalA~Gakt~KmkfGHrG~-------NhPV~~-~----~tgkv~ITSQNHGyaVd~~sl~~~~~~vt~~nln  309 (356)
T PRK12838        242 GICLGHQLIALALGAETYKLPFGHRGA-------NHPVID-L----ATGRVWMTSQNHGYVVDEDSIDEKQLSVTFFNLN  309 (356)
T ss_pred             EECHHHHHHHHHHCCEEEECCCCCCCC-------CCCCEE-C----CCCCEEEEECCCCCEECCCCCCCCCEEEEEECCC
T ss_conf             974889999997097486415566887-------826477-6----8994899726876167767689886599999089


Q ss_pred             CCCEEEEEECCCCEEEEEEEEHHHCCCH-HHHHHHHHHHHHCC
Q ss_conf             8317889863500112465212221520-25779987550106
Q gi|254780414|r  157 STPFAFIADEKRKYYAVQFHPEVVHTVG-GSQLIDNFVHHVAG  198 (520)
Q Consensus       157 ~~~iaai~~~~~~iyGVQFHPEV~hT~~-G~~iL~NFl~~Ic~  198 (520)
                      ++.+++|+|+++|+|+||||||..-.+. ..-+++.|+-.|-.
T Consensus       310 D~tveGi~~~~~p~fsVQfHPEa~PGP~D~~~lF~~F~~~~~~  352 (356)
T PRK12838        310 DGSIEGLRHKKLPVLSVQFHPEAHPGPHDAEYIFDEFLEMMGE  352 (356)
T ss_pred             CCCEEEEEECCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             9966107988998688712889998987438899999999998


No 41 
>PRK07567 glutamine amidotransferase; Provisional
Probab=99.96  E-value=3.6e-29  Score=228.73  Aligned_cols=160  Identities=22%  Similarity=0.432  Sum_probs=123.7

Q ss_pred             HHCCCCEEEECCCCCCCCCCC-CCCC------------CHHHHHCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEE
Q ss_conf             723997999985388999999-9753------------768980899889977899998997096999869866103667
Q gi|254780414|r   47 KEQNPQAIILSGSPASSLDID-SPQI------------PKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFI  113 (520)
Q Consensus        47 ~~~~p~GIILSGGP~SV~d~~-ap~~------------~~~I~~~~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I  113 (520)
                      ...+++|+|++|||.+|.|+. .++.            .+++.+.++|+||||||||+||.++||+|.+....|+|...+
T Consensus        48 dL~~ydgvivgGsp~~vsd~~~~~~~~q~~~e~~l~~Ll~~~~~~~~P~LGiC~G~Qlla~alGG~V~~~~~~e~G~~~i  127 (242)
T PRK07567         48 DLDDFSGVIVGGSPFNVSDPAYSKSPTQRRVEAELSGLLDEVVARDFPFLGCCYGVGTLGHHLGGVVDRTHGEPVGATTV  127 (242)
T ss_pred             CHHHCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHCCCEEECCCCCEEEEEEE
T ss_conf             83000789994889756785445646888999999999999984699889985638999997298882799870779999


Q ss_pred             EECC---CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHH
Q ss_conf             5238---8622278726655336860022011012444211232398317889863500112465212221520257799
Q gi|254780414|r  114 EIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLID  190 (520)
Q Consensus       114 ~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~  190 (520)
                      .++.   .+++|.++   +..+.+|++|+|.|.++|+|++++|+|+.|++++++..+ ++||+|||||++  ..+   +.
T Consensus       128 ~lt~~g~~Dpl~~~l---p~~f~a~~~H~d~V~~LP~ga~lLA~s~~cpvqafr~g~-~~y~~QFHPE~d--~~~---~~  198 (242)
T PRK07567        128 TLTDAGRRDPLTADL---PDTFTAFTGHKEAVVALPPGAVLLATGPTCPVQMFRAGE-NVYATQFHPELD--ADG---LK  198 (242)
T ss_pred             EECCCCCCCCCCCCC---CCCEEEEEECCCEEEECCCCCEEEECCCCCCHHEEEECC-CEEEEECCCCCC--HHH---HH
T ss_conf             981456779110179---844179986164137689984899849998236189379-789992484079--999---99


Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             875501064411140678999999997
Q gi|254780414|r  191 NFVHHVAGIQDNWVMSSYHKEIVSRIK  217 (520)
Q Consensus       191 NFl~~Ic~~~~~W~~~~~~~~~i~~Ir  217 (520)
                      +-+ ++-+=..-+.++. .+..+...+
T Consensus       199 ~ri-~~y~~~gy~~~~~-~~~~~~~~~  223 (242)
T PRK07567        199 NRI-DFYKDYGYFSPED-ADELIARLR  223 (242)
T ss_pred             HHH-HHHHHCCCCCHHH-HHHHHHHHH
T ss_conf             999-9998758888788-999998630


No 42 
>PRK06490 glutamine amidotransferase; Provisional
Probab=99.96  E-value=3.4e-28  Score=221.76  Aligned_cols=176  Identities=23%  Similarity=0.371  Sum_probs=134.0

Q ss_pred             CCCCEEEEEECCC-CHHHHHHHHHHHCCCEEEEE-CCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHH------H
Q ss_conf             4488699998897-05788998888659406985-289-8988997239979999853889999999753768------9
Q gi|254780414|r    5 ERSSKVLIIDFGS-QFTQLIARRVRESKVYCEVI-AFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKE------I   75 (520)
Q Consensus         5 ~~~~~IlIlDfGS-QytqLIaRriRelgVyseI~-P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~------I   75 (520)
                      ....+||||-.-. .-.-+|...+++.|+-..++ |+. .++.+ ...+++|+|+.|||+||+|+. |++..+      .
T Consensus         9 ~~~k~vLviqH~~~e~pG~i~~~L~~~G~~~~i~r~~~gd~lP~-~l~~~dglvVlGGpmsa~D~~-p~l~~e~~~I~~~   86 (243)
T PRK06490          9 RDKRPILIVLHQERSTPGRVGQLLRERGYPLDIRRPRLGDPLPE-TLEDHAGAVIFGGPMSANDPD-DFIRREIDWISVP   86 (243)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCC-CCCCCCEEEEECCCCCCCCCC-CHHHHHHHHHHHH
T ss_conf             78985799966899997299999997898589996789998999-754605899928999989987-1799999999999


Q ss_pred             HHCCCCEEEECHHHHHHHHHCCCEEEECCC--CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEE
Q ss_conf             808998899778999989970969998698--661036675238862227872665533686002201101244421123
Q gi|254780414|r   76 LESNIPLLGICYGQQIMCQSLGGKTKNSQS--REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIA  153 (520)
Q Consensus        76 ~~~~iPILGICyG~QlLa~~~GG~V~~~~~--~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA  153 (520)
                      ++.++|+||||||+|+||+++||+|.+.+.  .|.|+.++..+.....+.+.     ...|++.|+|.++ +|+|++++|
T Consensus        87 l~~~~P~LGICLGaQLlA~alGg~V~~~~~g~~EiG~~~i~~t~~g~~~~~~-----p~~v~~wH~e~f~-LP~gA~lLA  160 (243)
T PRK06490         87 LKENKPFLGICLGAQMLARHLGARVAPHPDGRVEIGYYPLRPTEAGRALMPW-----PEMVYHWHREGFD-LPKGAELLA  160 (243)
T ss_pred             HHCCCCEEEECHHHHHHHHHHCCEEECCCCCCCCCCCEEEEECCCCCCCCCC-----CCEEEEEECCCCC-CCCCCEEEE
T ss_conf             9869988998884999999839888448888775785235677453234589-----7836786243200-699958987


Q ss_pred             CCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             23983178898635001124652122215202577998755
Q gi|254780414|r  154 SSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       154 ~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      +|+.|+++||+.. .++||+||||||+.     .|+++++.
T Consensus       161 ~s~~c~~QAFr~G-~~a~g~QFHpEvt~-----~~i~~W~~  195 (243)
T PRK06490        161 TGDDFPNQAFRYG-DNAWGLQFHPEVTR-----AMMHRWTV  195 (243)
T ss_pred             CCCCCCHHHEEEC-CCEEEEECCEECCH-----HHHHHHHH
T ss_conf             8999836828976-94899954847878-----99999995


No 43 
>PRK08250 glutamine amidotransferase; Provisional
Probab=99.96  E-value=2e-28  Score=223.36  Aligned_cols=174  Identities=21%  Similarity=0.327  Sum_probs=132.3

Q ss_pred             EEEEEECCC-CHHHHHHHHHHHCCCEEEEE-CCCCC-HHHHHHCCCCEEEECCCCCCCCC--CCCCCCC--------HHH
Q ss_conf             699998897-05788998888659406985-28989-88997239979999853889999--9997537--------689
Q gi|254780414|r    9 KVLIIDFGS-QFTQLIARRVRESKVYCEVI-AFKNA-LDYFKEQNPQAIILSGSPASSLD--IDSPQIP--------KEI   75 (520)
Q Consensus         9 ~IlIlDfGS-QytqLIaRriRelgVyseI~-P~~~~-~e~i~~~~p~GIILSGGP~SV~d--~~ap~~~--------~~I   75 (520)
                      ||+|+-.-. .-.-.|..-+++.|+...++ ++... +.. ...+++|+|+.|||+|+++  +..|++.        +..
T Consensus         2 rilviqH~~~E~pG~i~~~l~~~G~~~~~~~~~~g~~lP~-~~~~~d~liVlGGpms~~~~~e~~p~l~l~~E~~lir~a   80 (235)
T PRK08250          2 RVHFIIHESFESPGAYLKWAEDRGYTISWSRVYAGEALPE-NADGFDMLIVLGGPQSPRTTREECPYFDSKAEQHLINQA   80 (235)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHCCCEEEEEECCCCCCCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             7999981899897078999997899699996689998999-810258899978998777732127874709999999999


Q ss_pred             HHCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECC---CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEE
Q ss_conf             808998899778999989970969998698661036675238---86222787266553368600220110124442112
Q gi|254780414|r   76 LESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKK---NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVI  152 (520)
Q Consensus        76 ~~~~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~---~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~vi  152 (520)
                      .+.++|+||||||+|+||+++||+|.+++.+|+|+..+..+.   .+++|.++   +....|+..|+| +..+|+|++++
T Consensus        81 ~~~~~PvlGIClG~QliA~AlGg~V~~~~~~EiG~~~i~~t~~~~~d~~~~~~---~~~~~v~~wH~d-~~~LP~gA~lL  156 (235)
T PRK08250         81 ITARKAVVGVCLGSQLIGEALGAKYCQSPEKEIGHFPITLTEAGLRDPLLKHF---GSTLTVGHWHND-MPGLTDQATVL  156 (235)
T ss_pred             HHCCCCEEEEEHHHHHHHHHCCCEEECCCCCEEEEEEEEEECCCCCCHHHHCC---CCCCEEEEEEEE-EEECCCCCEEE
T ss_conf             98699889981677999998098775489982448971630144458466528---987657898523-62069996799


Q ss_pred             ECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             32398317889863500112465212221520257799875
Q gi|254780414|r  153 ASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       153 A~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |+|+.|+++|++..+ ++||+|||||++.     +++++++
T Consensus       157 Ass~~c~~Qaf~~g~-~~~g~QfHpE~t~-----~~v~~wi  191 (235)
T PRK08250        157 ATSEGCPRQIVQYGN-LVYGFQCHMEFTV-----EAVEGLI  191 (235)
T ss_pred             ECCCCCHHHHEEECC-CEEEEECCEECCH-----HHHHHHH
T ss_conf             739998489588269-5899971037899-----9999999


No 44 
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]
Probab=99.96  E-value=5.7e-28  Score=220.14  Aligned_cols=181  Identities=25%  Similarity=0.394  Sum_probs=134.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCC-CCCCCCCHHHHHCCCCEE
Q ss_conf             4488699998897057889988886594069852898988997239979999853889999-999753768980899889
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD-IDSPQIPKEILESNIPLL   83 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d-~~ap~~~~~I~~~~iPIL   83 (520)
                      +...+|+++|||.+.+  |.|.+-+.|+...++|++++++++.+.+|+||+||+||...-. +.+...-+++++..+|+|
T Consensus       177 ~~~~~Vv~iD~GvK~n--Ilr~L~~rg~~vtVVP~~t~~eeIl~~~pDGiflSNGPGDP~~~~~~i~~ik~l~~~~iPif  254 (368)
T COG0505         177 EPGKHVVVIDFGVKRN--ILRELVKRGCRVTVVPADTSAEEILALNPDGIFLSNGPGDPAPLDYAIETIKELLGTKIPIF  254 (368)
T ss_pred             CCCCEEEEEECCCCHH--HHHHHHHCCCEEEEECCCCCHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             7776799997673177--99999977984999769899999985189979974899880677899999999864689837


Q ss_pred             EECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--CCCCCCCEEECCC-CCCE
Q ss_conf             977899998997096999869866103667523886222787266553368600220110--1244421123239-8317
Q gi|254780414|r   84 GICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--HIPEGFEVIASSD-STPF  160 (520)
Q Consensus        84 GICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~lP~gf~viA~S~-~~~i  160 (520)
                      |||+|||+||.++|++..|.+-+..|.       +.+.-+ +. .+.....=+.||++|.  ++++.++++..+- ++.+
T Consensus       255 GICLGHQllalA~Ga~T~KmkFGHrG~-------NhPV~d-l~-tgrv~ITSQNHGyaVd~~s~~~~~~vth~nlnDgTv  325 (368)
T COG0505         255 GICLGHQLLALALGAKTYKMKFGHRGA-------NHPVKD-LD-TGRVYITSQNHGYAVDEDSLVETLKVTHVNLNDGTV  325 (368)
T ss_pred             EECHHHHHHHHHCCCCEEECCCCCCCC-------CCCCCC-CC-CCEEEEEECCCCEECCHHHCCCCCEEEEEECCCCCC
T ss_conf             886888999986678643203688778-------967631-65-880899946886013822327776058981799970


Q ss_pred             EEEEECCCCEEEEEEEEHHHCCCHHHH-HHHHHHHHH
Q ss_conf             889863500112465212221520257-799875501
Q gi|254780414|r  161 AFIADEKRKYYAVQFHPEVVHTVGGSQ-LIDNFVHHV  196 (520)
Q Consensus       161 aai~~~~~~iyGVQFHPEV~hT~~G~~-iL~NFl~~I  196 (520)
                      ++++|+++|+|.||||||-+-.++-.. ++..|+-.+
T Consensus       326 EGi~h~~~P~fSVQ~HPEAsPGPhDt~ylFd~Fi~~~  362 (368)
T COG0505         326 EGIRHKDLPAFSVQYHPEASPGPHDTRYLFDEFIELM  362 (368)
T ss_pred             CCEECCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             0245279863787148999989864477999999999


No 45 
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221   This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase. In at least one case, a single polypeptide from Bacillus subtilis was shown to have both functions. ; GO: 0004049 anthranilate synthase activity, 0008152 metabolic process.
Probab=99.96  E-value=2.5e-28  Score=222.62  Aligned_cols=186  Identities=26%  Similarity=0.387  Sum_probs=146.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCC-----CEEE-EECCC-CCHHHHHHCCC-----CEEEECCCCCCCCCCCCC-CCCHHH
Q ss_conf             69999889705788998888659-----4069-85289-89889972399-----799998538899999997-537689
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESK-----VYCE-VIAFK-NALDYFKEQNP-----QAIILSGSPASSLDIDSP-QIPKEI   75 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelg-----Vyse-I~P~~-~~~e~i~~~~p-----~GIILSGGP~SV~d~~ap-~~~~~I   75 (520)
                      .||.+|.=-.||-.+.|.+.|+|     |... |...+ .+..+|....|     ++|++|.||.+..+..-- .+--++
T Consensus         1 ~vL~IDnYDSFTYNlv~~~~~~gdisPGv~~V~Vkrnd~~~~~~ie~L~P~~~lfdaivisPGPC~P~eAa~~~Gii~~~   80 (212)
T TIGR00566         1 MVLLIDNYDSFTYNLVQYFEELGDISPGVAEVVVKRNDSLTLQEIEALLPLLPLFDAIVISPGPCTPNEAAISMGIILEA   80 (212)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHCCCCCCCCEEEECCCCCCCCHHHCCHHHHHHH
T ss_conf             92456567423789999864217767361057772067310345876311356334567658656832122041179999


Q ss_pred             H---HCCC---CEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCC--CCCCEEEEEECCCHH--HCC
Q ss_conf             8---0899---88997789999899709699986986610366752388622278726--655336860022011--012
Q gi|254780414|r   76 L---ESNI---PLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE--KGSKQQVWMSHGDQV--EHI  145 (520)
Q Consensus        76 ~---~~~i---PILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~--~~~~~~VwmSH~D~V--~~l  145 (520)
                      +   ..++   ||||||+|||.||+++||.|.++..-.||++.---.+...+|.|+++  -+..+.+=.+|+..|  +.|
T Consensus        81 i~h~aGkldevPILGvCLG~QA~~qA~Gg~V~~a~~~~HGk~s~i~hng~~~f~GL~~GyPP~~L~~TRYHSL~V~p~~l  160 (212)
T TIGR00566        81 IRHFAGKLDEVPILGVCLGHQALAQAFGGDVVRANTVMHGKTSEIEHNGAGIFRGLFNGYPPDTLTATRYHSLVVEPETL  160 (212)
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCEEECCCEEECCCCCCCCCCCCCCCCEEEEEECCCCC
T ss_conf             87423762267602010556878874287225421136873001247771012465577686644357505566744577


Q ss_pred             CCCCCEEECCCCC--CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             4442112323983--178898635001124652122215202577998755
Q gi|254780414|r  146 PEGFEVIASSDST--PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       146 P~gf~viA~S~~~--~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      |.-|.++|.++..  .++||+|++++++|||||||+..|++|.+||+|||.
T Consensus       161 ~~~~~~~~~~~~~G~eiM~irh~~~p~eGVQFHPESilSe~G~~ll~Nfl~  211 (212)
T TIGR00566       161 PTCFQVTALEEENGIEIMAIRHRDLPLEGVQFHPESILSELGHQLLANFLH  211 (212)
T ss_pred             CCCCCEEEEECCCCCEEEHHHHCCCCCCCEEECCHHHHHHHHHHHHHHHHC
T ss_conf             622010100016870131013347850220107135534227899998723


No 46 
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112   This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate.; GO: 0004049 anthranilate synthase activity, 0000162 tryptophan biosynthetic process.
Probab=99.95  E-value=8.3e-27  Score=211.82  Aligned_cols=196  Identities=25%  Similarity=0.434  Sum_probs=163.3

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCE
Q ss_conf             63448869999889705788998888659406985289898899723997999985388999999975376898089988
Q gi|254780414|r    3 KRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPL   82 (520)
Q Consensus         3 ~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPI   82 (520)
                      .-+...+||.+|---.|-|.+|..+|.-|.-..-+.+...-+.+....||=|+||.||....|=+--.--++....++||
T Consensus       520 dGq~G~~iLLvDHeDSFVHTLAnY~RqTGAsVTTlRh~~ae~~fd~~rPDLVVLSPGPGrP~dFdv~~Ti~aa~ar~lP~  599 (726)
T TIGR01815       520 DGQEGKRILLVDHEDSFVHTLANYLRQTGASVTTLRHSFAEELFDEERPDLVVLSPGPGRPKDFDVKETIKAALARDLPV  599 (726)
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHHHHHHCCCCE
T ss_conf             86258779998547543777788876348755304304789997327998898687312387544788999999728985


Q ss_pred             EEECHHHHHHHHHCCCEEEECCCCCCCEE-EEEECCC-CCCCCCCCCCCCCEEEEEECCCHH--HCCCCCCCEEECCCCC
Q ss_conf             99778999989970969998698661036-6752388-622278726655336860022011--0124442112323983
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNSQSREFGRA-FIEIKKN-CSLLKGMWEKGSKQQVWMSHGDQV--EHIPEGFEVIASSDST  158 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~~~~EyG~~-~I~i~~~-~~lf~gl~~~~~~~~VwmSH~D~V--~~lP~gf~viA~S~~~  158 (520)
                      ||+|+|.|-|+.+|||.........||++ .|.+... +.+|.|+   +...+|=-+|+---  .+||.+|+|+|.|+|+
T Consensus       600 FGVCLGLQg~vEafGG~L~vL~~P~HGK~srirVl~p~s~~F~gL---pe~~TVGRYHSlfA~~~rLP~el~vTA~s~Dg  676 (726)
T TIGR01815       600 FGVCLGLQGLVEAFGGELDVLAIPVHGKASRIRVLEPDSVLFAGL---PEELTVGRYHSLFARSDRLPKELKVTAESEDG  676 (726)
T ss_pred             EEEHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCCEEEECCC---CCCEEEEEEEEEEECCCCCCCCCEEEEEECCC
T ss_conf             774134689998746721357888788633688836875787278---97034300376755645687423787850687


Q ss_pred             CEEEEEECCCCEEEEEEEEHHHCCC---HHHHHHHHHHHHHCCCCC
Q ss_conf             1788986350011246521222152---025779987550106441
Q gi|254780414|r  159 PFAFIADEKRKYYAVQFHPEVVHTV---GGSQLIDNFVHHVAGIQD  201 (520)
Q Consensus       159 ~iaai~~~~~~iyGVQFHPEV~hT~---~G~~iL~NFl~~Ic~~~~  201 (520)
                      .|+||+|...|+=+||||||+..|-   -|..||+|-+-+.++-.+
T Consensus       677 ~iMaiEH~~lP~AAVQFHPESImtL~G~aGl~mi~NVv~~la~~a~  722 (726)
T TIGR01815       677 VIMAIEHRKLPVAAVQFHPESIMTLDGDAGLAMIENVVDKLAKSAK  722 (726)
T ss_pred             EEEEEECCCCCCCEEECCCCHHHCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             1732024768711251176110005604689999999999733102


No 47 
>PRK13180 consensus
Probab=99.95  E-value=6.9e-27  Score=212.36  Aligned_cols=176  Identities=22%  Similarity=0.363  Sum_probs=127.2

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCCC-----CCCCCCCCCHHHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-38899-----999997537689808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPASS-----LDIDSPQIPKEILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~SV-----~d~~ap~~~~~I~~~~iP   81 (520)
                      .+|.|+|||+++.+.+.|++|++|+.+++.   ...+++.  +.+++||.| |..+-     .+.+....-.+..+.++|
T Consensus         2 kkI~IiDyg~gNi~Sv~~al~~~g~~~~i~---~~~~~~~--~~d~lIlPGVGsf~~~m~~L~~~~~~~~i~~~~~~gkp   76 (209)
T PRK13180          2 KRVVVLDYGSGNLRSAQRALERVGAEVEVT---ADPDAAL--NADGLVVPGVGAFAACMAGLRAVGGDRIIGERLAAGRP   76 (209)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             779999789438999999999869989997---9999995--38968999988557777765536919999999976998


Q ss_pred             EEEECHHHHHHHHH---C----------CCEEEECC---CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC-
Q ss_conf             89977899998997---0----------96999869---8661036675238862227872665533686002201101-
Q gi|254780414|r   82 LLGICYGQQIMCQS---L----------GGKTKNSQ---SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH-  144 (520)
Q Consensus        82 ILGICyG~QlLa~~---~----------GG~V~~~~---~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~-  144 (520)
                      +||||+|||+|+..   .          .|+|++.+   .++.||..+...+++.+|+++..   ...+|+.|++.+.. 
T Consensus        77 iLGIClGMQlL~~~s~E~g~~~~GLg~i~G~v~~l~~~~vPh~GWn~v~~~~~~~l~~~i~~---~~~fYFvHSy~v~~~  153 (209)
T PRK13180         77 VLGICVGMQILFERGVEHGVETEGCGEWPGTVERLDAPVLPHMGWNTVEAPAGSVLFAGLDA---DERFYFVHSYAAQRW  153 (209)
T ss_pred             EEEEEEHEEEEEECEECCCCCCCCCCEECCEEEECCCCCCCCCCCEEEECCCCCHHHHCCCC---CCCEEEECEEEECCC
T ss_conf             79984120888703111676778813655089977888787356557770677635408885---895889685266345


Q ss_pred             ----CC-CCCCEEECCC--CCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             ----24-4421123239--83178898635001124652122215202577998755
Q gi|254780414|r  145 ----IP-EGFEVIASSD--STPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       145 ----lP-~gf~viA~S~--~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                          .+ .....+|.+.  ...++++++  .++||+|||||.++ ..|.++|+||+-
T Consensus       154 ~~~~~~~~~~~~~~~~~~g~~~~aav~~--~ni~G~QFHPEKS~-~~Gl~ll~nFl~  207 (209)
T PRK13180        154 EGSPDPRTAPPLVTWATHGAPFVAAVEN--GPLSATQFHPEKSG-DAGAALLRNWVD  207 (209)
T ss_pred             CCCCCCCCCCCEEEEEECCCEEEEEEEC--CCEEEEECCCCCCC-HHHHHHHHHHHH
T ss_conf             6555656655358998479826999982--99999939963267-738999999986


No 48 
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=99.94  E-value=9.3e-27  Score=211.46  Aligned_cols=177  Identities=23%  Similarity=0.391  Sum_probs=129.2

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CC-CCCCCCCCCHHH---HHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-99-999997537689---808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SS-LDIDSPQIPKEI---LESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV-~d~~ap~~~~~I---~~~~iP   81 (520)
                      .+|.|+|+|++..+.+.|.++.++..++++-. .+.+++.  +.+.+||.| |.. ++ ..-........+   .+.+.|
T Consensus         2 ~kI~IiDyg~gNi~Sv~~al~~~~~~~~i~i~-~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~~~~~i~~~~~~~kp   78 (208)
T PRK13146          2 MSVAIIDYGSGNLRSAARALERAAPGADVTVT-ADPDAVR--AADRLVLPGVGAFADCMRGLRAVGGLREAVEEAAAGRP   78 (208)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHCCCCEEEEE-CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             88999937955899999999985799739996-9999984--28878983889779999987640768999999983998


Q ss_pred             EEEECHHHHHHHHH------------CCCEEEECCC-------CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH
Q ss_conf             89977899998997------------0969998698-------6610366752388622278726655336860022011
Q gi|254780414|r   82 LLGICYGQQIMCQS------------LGGKTKNSQS-------REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV  142 (520)
Q Consensus        82 ILGICyG~QlLa~~------------~GG~V~~~~~-------~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V  142 (520)
                      +||||+|||+|+..            +.|+|++...       +..||..+...+++++|+++.+   ....|+.|++++
T Consensus        79 iLGICLGmQlL~~~s~E~g~~~GLgli~G~V~kl~~~~~~~kiPhiGWn~i~~~~~~~l~~~i~~---~~~fYFvHSY~~  155 (208)
T PRK13146         79 FLGICVGMQLLFERGEEHGDTPGLGWIPGDVVRLQPDGPALKVPHMGWNTVDQPRDHPLFDGIPD---GARFYFVHSYAA  155 (208)
T ss_pred             EEEEEEEEEEEECCCEECCCCCCCEEECCEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCCC---CCEEEEEEEEEE
T ss_conf             79888546412112400686570118741899998788666574425277885689820047887---887999731375


Q ss_pred             HCCCCCCCEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             012444211232398-317889863500112465212221520257799875
Q gi|254780414|r  143 EHIPEGFEVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       143 ~~lP~gf~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .. .+...++|.|+. ..+.|+.. ..++||+|||||.+| ..|.++|+||+
T Consensus       156 ~~-~~~~~~~a~t~yg~~~~a~v~-~~ni~G~QFHPEKS~-~~Gl~llknFl  204 (208)
T PRK13146        156 AP-ANPADVLAWTDYGGPFTAAVA-RGNLFATQFHPEKSG-DAGLRLLRNFL  204 (208)
T ss_pred             EC-CCCHHEEEEEECCCEEEEEEE-CCCEEEEECCCCCCC-HHHHHHHHHHH
T ss_conf             31-882100899638987999998-399999989930056-83899999986


No 49 
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=99.94  E-value=2.2e-26  Score=208.83  Aligned_cols=171  Identities=22%  Similarity=0.359  Sum_probs=127.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-----CCCCCC-CCCCHHHHHCCCCE
Q ss_conf             9999889705788998888659406985289898899723997999985-3889-----999999-75376898089988
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-----SLDIDS-PQIPKEILESNIPL   82 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-----V~d~~a-p~~~~~I~~~~iPI   82 (520)
                      |.|+|||+++.+.++|.++.+|+.+++.   .+.+++.  +.+++||.| |..+     ..+.+- ..+.+.+++.+.|+
T Consensus         2 I~IiDyg~gNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~l~~~i~~~~~~~~~pi   76 (201)
T PRK13152          2 IALIDYKAGNLNSVAKAFEKIGAINFIA---KNPKDLQ--KADKLLLPGVGSFKEAMKNLKELGFIEALKEQVLVQKKPI   76 (201)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCE
T ss_conf             9999559427999999999869988997---8999996--5895898288849999987775185889999998769966


Q ss_pred             EEECHHHHHHHHH------------CCCEEEEC------CCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC
Q ss_conf             9977899998997------------09699986------98661036675238862227872665533686002201101
Q gi|254780414|r   83 LGICYGQQIMCQS------------LGGKTKNS------QSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH  144 (520)
Q Consensus        83 LGICyG~QlLa~~------------~GG~V~~~------~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~  144 (520)
                      ||||+|||+|+..            +.|+|.+-      +.+..||..++..+++++|+++.   ....+|+.|++++. 
T Consensus        77 LGIClGmQlL~~~s~E~~~~~GLg~i~G~v~kl~~~~~~kvPhiGWn~v~~~~~~~l~~~~~---~~~~fYF~HSy~v~-  152 (201)
T PRK13152         77 LGICLGMQLFLERGYEGGVCEGLGFIEGEVVKFEEDLNLKIPHMGWNELEILKQSPLYQGIP---NKSDFYFVHSFYVK-  152 (201)
T ss_pred             EEEEHHHEEEEECCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCEEEEEEECCCCHHHCCCC---CCCEEEEEEEEEEC-
T ss_conf             99852134621042437863655899769998677767666632258986034797563887---66719997200623-


Q ss_pred             CCCCCCEEECCCC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             2444211232398--317889863500112465212221520257799875
Q gi|254780414|r  145 IPEGFEVIASSDS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       145 lP~gf~viA~S~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .++ -.++|.++.  ..+|+++  ..++||+|||||.+ .+.|.++|+||+
T Consensus       153 ~~~-~~~~~~~~yg~~~~aav~--~~Ni~G~QFHPEKS-~~~Gl~lLknFl  199 (201)
T PRK13152        153 CKD-EFVSAKAQYGHKFVASLQ--KDHIFATQFHPEKS-QNLGLKLLENFL  199 (201)
T ss_pred             CCC-CCEEEEEECCCEEEEEEE--ECCEEEEECCCCCC-CHHHHHHHHHHH
T ss_conf             688-748999984998999998--49999991894116-775899999997


No 50 
>PRK13153 consensus
Probab=99.94  E-value=8.8e-26  Score=204.48  Aligned_cols=171  Identities=21%  Similarity=0.386  Sum_probs=128.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-CCC-CCCCCCCHH---HHHCCCCEE
Q ss_conf             9999889705788998888659406985289898899723997999985-3889-999-999753768---980899889
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-SLD-IDSPQIPKE---ILESNIPLL   83 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V~d-~~ap~~~~~---I~~~~iPIL   83 (520)
                      |.|+|||++..+.+.|.++.+|+.++|..   +.+++..  .+.|||.| |..+ +.. -....++..   ..+.+.|+|
T Consensus         2 I~IiDyg~gNi~Sv~~al~~lg~~~~ii~---~~~~i~~--~d~lIlPGVGsf~~~m~~L~~~~l~~~i~~~~~~g~piL   76 (203)
T PRK13153          2 IGIIDYNAGNLASVINAFEKIGAKARLES---DPSKLKE--YDKLILPGVGAFGDAMEHLKSNGMDEAIKEFAKSGKPFL   76 (203)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEC---CHHHHHH--CCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCCEE
T ss_conf             99996693289999999998699889976---9999965--893898788834889997775375788999987599689


Q ss_pred             EECHHHHHHHHH------------CCCEEEECCCC---------CCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH
Q ss_conf             977899998997------------09699986986---------610366752388622278726655336860022011
Q gi|254780414|r   84 GICYGQQIMCQS------------LGGKTKNSQSR---------EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV  142 (520)
Q Consensus        84 GICyG~QlLa~~------------~GG~V~~~~~~---------EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V  142 (520)
                      |||+|||+|+..            +.|+|.+.+..         ..||..+...+++++++++.+   ...+|..|++++
T Consensus        77 GIClGmQlL~~~s~E~g~~~GLgli~G~V~~l~~~~~~~~~kiPhiGWn~i~~~~~~~~~~~~~~---~~~~YF~HSy~~  153 (203)
T PRK13153         77 GICLGMQLLFEKSYEFGEHEGLGLIEGEVVKFDESKFDEPLKVPHMGWNRLEFKKETPLFRGLPE---SFYLYFVHSYHA  153 (203)
T ss_pred             EEEHHHHHCCCCCEECCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCHHHEECCCCCHHHCCCCC---CCEEEEEEEEEC
T ss_conf             98555342004759067568884887789986722235566787343554103456866607776---873999910342


Q ss_pred             HCCCCCCCEEECCCCC--CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             0124442112323983--17889863500112465212221520257799875
Q gi|254780414|r  143 EHIPEGFEVIASSDST--PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       143 ~~lP~gf~viA~S~~~--~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                        .|++-.++|.++.+  .+++++.  .++||+|||||.++ +.|.++|+||+
T Consensus       154 --~~~~~~~~~~~~~g~~~~aai~~--~Ni~G~QFHPEKS~-~~Gl~llknFl  201 (203)
T PRK13153        154 --VCDDKDVLGKTTYGYEFVSAVQH--DNVFGFQPHPEKSH-DNGLKILKNFV  201 (203)
T ss_pred             --CCCCCCEEEEECCCCEEEEEEEE--CCEEEEECCCCCCC-HHHHHHHHHHH
T ss_conf             --56876899995599868999982--99999928944077-85999999996


No 51 
>PRK13176 consensus
Probab=99.93  E-value=6.9e-26  Score=205.23  Aligned_cols=179  Identities=25%  Similarity=0.400  Sum_probs=129.3

Q ss_pred             EEEEEECCC----CHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC---C-CCCCH----HHH
Q ss_conf             699998897----05788998888659406985289898899723997999985388999999---9-75376----898
Q gi|254780414|r    9 KVLIIDFGS----QFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID---S-PQIPK----EIL   76 (520)
Q Consensus         9 ~IlIlDfGS----QytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~---a-p~~~~----~I~   76 (520)
                      ||.|+|||+    +.++.+.|..++.++.+++.- ....+.+  .+++.|||.|-.+....-.   + ..+..    .+.
T Consensus         2 kI~IIDyg~GNi~Sv~~al~~~g~~~~i~~~i~~-~~~~~~~--~~~~~lILPGVGsf~~~m~~L~~~~g~~~~i~~~~~   78 (216)
T PRK13176          2 RVAIIDYGSGNLHSATKAFERAAREAGIAAEIDV-TSDPDRV--ARADRIVLPGVGAFADCRRGLDAVDGMVEALTEAVE   78 (216)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEE-ECCHHHH--HCCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             8999906983799999999998764388960999-7899998--379979989987789999987762772899999999


Q ss_pred             HCCCCEEEECHHHHHHHHH------------CCCEEEECC-------CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEE
Q ss_conf             0899889977899998997------------096999869-------866103667523886222787266553368600
Q gi|254780414|r   77 ESNIPLLGICYGQQIMCQS------------LGGKTKNSQ-------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMS  137 (520)
Q Consensus        77 ~~~iPILGICyG~QlLa~~------------~GG~V~~~~-------~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmS  137 (520)
                      +.+.||||||+|||+|+..            +.|+|++-.       ....||..+...+++++|+++........+|..
T Consensus        79 ~~~~piLGIClGmQlL~~~s~E~~~~~GLgli~G~V~kl~~~~~~~kvPh~GWn~v~~~~~~~~~~~i~~~~~~~~fYFv  158 (216)
T PRK13176         79 KKARPFLGICVGMQLMATRGLEKTVTDGLGWIAGDVVEITPSDPSLKIPHMGWNTLDVKRPHPVFDGIPTGDKGLHAYFV  158 (216)
T ss_pred             HCCCCEEEEEHHHEEHHHCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEECHHHEEECCCCHHHCCCCCCCCCCEEEEE
T ss_conf             76995799853121265368678886733067249999478886764864167786867886777387778887358999


Q ss_pred             CCCHHHCCCCCCCEEECCC-CCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             2201101244421123239-8317889863500112465212221520257799875
Q gi|254780414|r  138 HGDQVEHIPEGFEVIASSD-STPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       138 H~D~V~~lP~gf~viA~S~-~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |++++...+ ...++|.|+ +.++.|+-.. .++||+|||||.+|. .|.+||+||+
T Consensus       159 HSY~~~~~~-~~~~~a~t~yg~~f~a~v~k-~Ni~G~QFHPEKS~~-~Gl~ll~nFl  212 (216)
T PRK13176        159 HSYHLAAAN-EADVLAHADYGGPVTAIVGR-DTMVGTQFHPEKSQR-LGLALIANFL  212 (216)
T ss_pred             EEEEEECCC-CCCEEEEEECCCEEEEEEEE-CCEEEECCCCCCCCH-HHHHHHHHHH
T ss_conf             756760488-47799999759989999983-999999099310278-4999999985


No 52 
>PRK13178 consensus
Probab=99.93  E-value=2.7e-25  Score=201.00  Aligned_cols=175  Identities=23%  Similarity=0.381  Sum_probs=129.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC---CCCCCCH---HHHHCCCCEE
Q ss_conf             999988970578899888865940698528989889972399799998538899999---9975376---8980899889
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI---DSPQIPK---EILESNIPLL   83 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~---~ap~~~~---~I~~~~iPIL   83 (520)
                      |.|||+|+..-+.+.|.++.+|+.+.|.   .+.+++.  +.+++||.|..+.-..-   .+-.++.   +..+.+.|+|
T Consensus         2 I~IiDyg~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~l~~~i~~~~~~gkpiL   76 (213)
T PRK13178          2 LAILDYKAGNQTSVRRALNHLGIPCVIT---ADPEVIQ--GAAGIIFPGVGAAGQAMNELRTTGLDEVLREQVQAGKPLL   76 (213)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHCCCCEE
T ss_conf             9999659308999999999869998997---7999994--3998998998856999998750062899998743699579


Q ss_pred             EECHHHHHHHHH-----------CCCEEEECC------------CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             977899998997-----------096999869------------866103667523886222787266553368600220
Q gi|254780414|r   84 GICYGQQIMCQS-----------LGGKTKNSQ------------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGD  140 (520)
Q Consensus        84 GICyG~QlLa~~-----------~GG~V~~~~------------~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D  140 (520)
                      |||+|||+|...           +.|+|++.+            .+..||..+...+++++|+++..   ...+|..|++
T Consensus        77 GIClGmQlLf~~seE~~~~GLgli~G~v~~l~~~~~~~~~~~~kvPhiGWn~i~~~~~~~l~~~~~~---~~~fYFvHSY  153 (213)
T PRK13178         77 GICVGCQIMLDYSQENDTKCLGIIPGECRLFNPALTDEDGAPIRVPHMGWNSVVQRRPCPLFKGIEP---EAEFYFVHSY  153 (213)
T ss_pred             EEEHHHEEEECCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCC---CCEEEEEEEE
T ss_conf             9842455554144245422467561069988854344347775677212212771799852245677---7879998689


Q ss_pred             HHHCCCCCCCEEECCCCCC--EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCC
Q ss_conf             1101244421123239831--788986350011246521222152025779987550106
Q gi|254780414|r  141 QVEHIPEGFEVIASSDSTP--FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAG  198 (520)
Q Consensus       141 ~V~~lP~gf~viA~S~~~~--iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~  198 (520)
                      .+  .|+...++|.|..+.  ++++  ...++||+|||||.+ .+.|.+||+||+ +.|.
T Consensus       154 ~~--~~~~~~~ia~t~yg~~f~a~v--~k~Ni~G~QFHPEKS-g~~Gl~lLknF~-~~~~  207 (213)
T PRK13178        154 FP--APPEEYVIATTTYGIEFCSAH--GGPGLWAVQFHPEKS-GRPGLRLLANFH-RYCT  207 (213)
T ss_pred             EE--CCCCCCEEEEEECCCEEEEEE--EECCEEEEECCCCCC-CHHHHHHHHHHH-HHHH
T ss_conf             85--389864899997899799999--809999991995316-886999999999-9987


No 53 
>PRK13174 consensus
Probab=99.93  E-value=5.7e-25  Score=198.69  Aligned_cols=176  Identities=20%  Similarity=0.349  Sum_probs=126.6

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCCCC-C-CCCCCCCHHH--HHCCCCE
Q ss_conf             869999889705788998888659406985289898899723997999985-388999-9-9997537689--8089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPASSL-D-IDSPQIPKEI--LESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~SV~-d-~~ap~~~~~I--~~~~iPI   82 (520)
                      .+|.|||||+...+.+.|.++.+|+.+.++.  .+.+++.  +.+.|||.| |..+.. + -....++..+  +..+.|+
T Consensus         2 k~I~IiDyG~gNi~Sv~~al~~~g~~~~~i~--~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~~~~~i~~~~~~kpi   77 (212)
T PRK13174          2 QTVAVIDYGMGNLHSVAKALEHVGAGRVLVT--SDAAVIR--EADRVVFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPF   77 (212)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEC--CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHCCCCE
T ss_conf             8899995881079999999997499879983--8989996--38979965888689999998876969999999749987


Q ss_pred             EEECHHHHHHHHH------------CCCEEEEC-----------CCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             9977899998997------------09699986-----------986610366752388622278726655336860022
Q gi|254780414|r   83 LGICYGQQIMCQS------------LGGKTKNS-----------QSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHG  139 (520)
Q Consensus        83 LGICyG~QlLa~~------------~GG~V~~~-----------~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~  139 (520)
                      ||||+|||+|+..            +.|+|.+.           +.+..|+..+....+++++.++.+   ...+|+.|+
T Consensus        78 LGICLGMQlL~~~s~E~g~~~GLgli~G~V~~~~~~~~~~~~~~kiPhiGWn~i~~~~~~~l~~~~~~---~~~fYFvHS  154 (212)
T PRK13174         78 LGICVGMQALLERSEENGGVDCIGLFPGQVRFFGKDLHEDGEHLKVPHMGWNQVSQAVDHPLWHDIPD---LARFYFVHS  154 (212)
T ss_pred             EEEEHHHHHHHHCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCEECCEEEEECCCCCHHCCCCC---CCEEEEEEE
T ss_conf             99808899876175478987753363507998675556555455675500124760688812106776---575998756


Q ss_pred             CHHHCCCCCCCEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             011012444211232398-317889863500112465212221520257799875
Q gi|254780414|r  140 DQVEHIPEGFEVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       140 D~V~~lP~gf~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +++. ..+...++|.+.. ..+.|.-. +.++||+|||||.++ ..|.++|+||+
T Consensus       155 Y~~~-~~~~~~~~a~t~~g~~f~a~v~-k~Ni~G~QFHPEKS~-~~Gl~lLknFi  206 (212)
T PRK13174        155 YYIE-AGNPRQVVGRGHYGVDFAAALA-DGSRFAVQFHPEKSH-THGLQLLQNFA  206 (212)
T ss_pred             EEEC-CCCHHCEEEEEECCCEEEEEEE-ECCEEEECCCCCCCC-HHHHHHHHHHH
T ss_conf             6752-6982038999989988999998-499999908910057-75899999998


No 54 
>KOG0026 consensus
Probab=99.93  E-value=2.1e-24  Score=194.56  Aligned_cols=194  Identities=24%  Similarity=0.415  Sum_probs=151.4

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHH-HHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH--HHCC
Q ss_conf             344886999988970578899888-8659406985289-89889972399799998538899999997537689--8089
Q gi|254780414|r    4 RERSSKVLIIDFGSQFTQLIARRV-RESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEI--LESN   79 (520)
Q Consensus         4 ~~~~~~IlIlDfGSQytqLIaRri-RelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I--~~~~   79 (520)
                      +..+..|+++|.=..+|-.....+ -|++...+++..| .+.++++.+||.++++|.||....|.+.  ....|  |...
T Consensus        15 ~~~n~piv~IDNYDSFT~Nv~qYL~~e~g~~~~VyRNDeiTV~El~~~NP~~LliSPGPG~P~DsGI--s~~~i~~f~~~   92 (223)
T KOG0026          15 SKQNGPIIVIDNYDSFTYNLCQYLMGELGCHFEVYRNDELTVEELKRKNPRGLLISPGPGTPQDSGI--SLQTVLELGPL   92 (223)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHCCCCCEEECCCCCCCCCCCC--HHHHHHHHCCC
T ss_conf             6566878998455513489999863125871799846731178886259880785699989764542--48999985787


Q ss_pred             CCEEEECHHHHHHHHHCCCEEEECC-CCCCCEEE-EEECC--CCCCCCCCCCCCCCEEEEEECCCHH--HCCC-CCCCEE
Q ss_conf             9889977899998997096999869-86610366-75238--8622278726655336860022011--0124-442112
Q gi|254780414|r   80 IPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAF-IEIKK--NCSLLKGMWEKGSKQQVWMSHGDQV--EHIP-EGFEVI  152 (520)
Q Consensus        80 iPILGICyG~QlLa~~~GG~V~~~~-~~EyG~~~-I~i~~--~~~lf~gl~~~~~~~~VwmSH~D~V--~~lP-~gf~vi  152 (520)
                      +|+||||.|.|.|..+|||+|.++. .--+|+.. ++-+.  ...+|+|++   ..+.|-..|+...  +++| +.++++
T Consensus        93 iP~fGvCMGlQCi~e~fGGkv~~a~~~i~HGK~S~i~~D~~~~~G~f~g~~---q~~~V~RYHSLa~~~sSlP~d~L~VT  169 (223)
T KOG0026          93 VPLFGVCMGLQCIGEAFGGKIVRSPFGVMHGKSSMVHYDEKGEEGLFSGLS---NPFIVGRYHSLVIEKDSFPSDELEVT  169 (223)
T ss_pred             CCEEEEEECHHHHHHHHCCEEECCCCCEEECCCCCCCCCCCCCCCCCCCCC---CCEEEEEEEEEEECCCCCCHHHEEEE
T ss_conf             855656400344456528576305752462453332237754332102799---87277765440001356871030456


Q ss_pred             ECCCCCCEEEEEECCCC-EEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             32398317889863500-112465212221520257799875501064411140
Q gi|254780414|r  153 ASSDSTPFAFIADEKRK-YYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVM  205 (520)
Q Consensus       153 A~S~~~~iaai~~~~~~-iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~  205 (520)
                      |+|+|+.+++.+|+++. +-|||||||+..|+.|+.+++||+ ++.  .++|.-
T Consensus       170 awTEnG~iMgaRHkKY~~ieGVQfHPESIlteeGk~~irNfl-ni~--~~tWeE  220 (223)
T KOG0026         170 AWTEDGLVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFI-KIV--EKKWSE  220 (223)
T ss_pred             EECCCCEEEEEECCCCEECCCEEECCHHHHHHHHHHHHHHHH-HHC--CCCCCC
T ss_conf             641385788741233100232232607764466589999998-753--361102


No 55 
>PRK13177 consensus
Probab=99.92  E-value=3.1e-24  Score=193.39  Aligned_cols=173  Identities=21%  Similarity=0.379  Sum_probs=121.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-C----CC--CCCCCCCHHHHHC
Q ss_conf             8869999889705788998888659406985289898899723997999985-3889-9----99--9997537689808
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-S----LD--IDSPQIPKEILES   78 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V----~d--~~ap~~~~~I~~~   78 (520)
                      ..+|.|+|||+...+.+.|.++.+|..+.++.  .+.+++.  +.+.|||.| |..+ +    .+  ...+.+...+.+.
T Consensus         2 ~~~I~IiDyg~GNi~Sv~~al~~~g~~~~~i~--~~~~~i~--~~d~lIlPGVGsF~~~m~~Lk~~~~~~~~i~~~~~~~   77 (207)
T PRK13177          2 ASTIALIDYGAGNLRSVHNALKAAGAEGVVVT--ADPDEVR--RADRVVLPGVGAFAACMGGLRAIPGMVEAMEERVLEG   77 (207)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCEEEE--CCHHHHH--CCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHHC
T ss_conf             99899991893279999999998299828995--8999983--5997998997878999977641044489999999976


Q ss_pred             CCCEEEECHHHHHHHHH------------CCCEEEECCC-------CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             99889977899998997------------0969998698-------6610366752388622278726655336860022
Q gi|254780414|r   79 NIPLLGICYGQQIMCQS------------LGGKTKNSQS-------REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHG  139 (520)
Q Consensus        79 ~iPILGICyG~QlLa~~------------~GG~V~~~~~-------~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~  139 (520)
                      +.|+||||+|||+|+..            +.|+|.+...       +.-||..+...+++..+   .   ....+|+.|+
T Consensus        78 ~~piLGICLGmQlLf~~s~E~g~~~GLgli~G~V~~l~~~~~~~kiPh~GWn~v~~~~~~~~~---~---~~~~~YFvHS  151 (207)
T PRK13177         78 GAPFLGICVGMQLLADRGEEHGVTPGLGWIGGEVRLIEPADPSCKVPHMGWNDVAPTTGSHPL---I---RPGEAYFLHS  151 (207)
T ss_pred             CCCEEEECHHHHHHHHCCCCCCCCCCCCEECCEEEEECCCCCCCCCCEEEEHEEEECCCCCCC---C---CCCCEEEEEE
T ss_conf             995699818788576576078877754554536898168887775876440102544667766---7---7784578988


Q ss_pred             CHHHCCCCCCCEEECCCCC-C-EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             0110124442112323983-1-7889863500112465212221520257799875
Q gi|254780414|r  140 DQVEHIPEGFEVIASSDST-P-FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       140 D~V~~lP~gf~viA~S~~~-~-iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +++. ..+...++|.|+.+ . +|+++  ..++||+|||||.++ ..|.++|+||+
T Consensus       152 Y~~~-~~~~~~i~~~t~y~~~~~a~v~--k~Ni~G~QFHPEKS~-~~Gl~lLknFl  203 (207)
T PRK13177        152 YHFV-PDDGAHVLATTDHGGGITAAVA--RDNIVGVQFHPEKSQ-AYGLALLARFL  203 (207)
T ss_pred             EEEE-CCCCCCEEEEECCCCEEEEEEE--ECCEEEEECCCCCCC-HHHHHHHHHHH
T ss_conf             8985-3897416899737998999999--599999939920067-86899999987


No 56 
>PRK13171 consensus
Probab=99.92  E-value=6e-24  Score=191.37  Aligned_cols=175  Identities=23%  Similarity=0.396  Sum_probs=128.1

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC--CCCCCCCCCCHHHHHCCCCEEE
Q ss_conf             869999889705788998888659406985289898899723997999985-3889--9999997537689808998899
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS--SLDIDSPQIPKEILESNIPLLG   84 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S--V~d~~ap~~~~~I~~~~iPILG   84 (520)
                      .+|.|+|+|...-+.+.+.++.+|+.++|..   +.+++.  +.+++||.| |..+  ...-....+...+.+.++|+||
T Consensus         2 ~~I~IiDyg~gNi~Sv~~al~~lg~~~~ii~---~~~~i~--~~~~lIlPGVGsf~~~m~~L~~~~~~~~i~~~~~piLG   76 (200)
T PRK13171          2 TDVALIDAGGANLGSVRYALERLGVEARVVR---DAAGLQ--GAQRVILPGVGAAPEAMARLRAQGLIEPLRELQVPLIG   76 (200)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEC---CHHHHH--CCCEEEECCCCCHHHHHHHHHHCCCHHHHHHCCCCEEE
T ss_conf             8799996895179999999998499879978---999995--29989989988789999999872126789864997355


Q ss_pred             ECHHHHHHHHH-----------CCCEEEECC------CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCC
Q ss_conf             77899998997-----------096999869------8661036675238862227872665533686002201101244
Q gi|254780414|r   85 ICYGQQIMCQS-----------LGGKTKNSQ------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPE  147 (520)
Q Consensus        85 ICyG~QlLa~~-----------~GG~V~~~~------~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~  147 (520)
                      ||+|||+|+..           +.|+|++..      .+..||..+...+++++++++.+   ....|..|++.+.   .
T Consensus        77 IClGmQlLf~~SeEg~~~GLgli~G~V~kl~~~~~~~vPh~GWn~i~~~~~~~~~~~~~~---~~~fYFvHSY~~~---~  150 (200)
T PRK13171         77 ICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRVPHMGWNRLVPMRDSALLAGLPE---RASAYFVHGYAAP---V  150 (200)
T ss_pred             EEHHHHHHHCCCCCCCCCCCCEECCEEEECCCCCCCCCCEEEEEEEECCCCCHHHCCCCC---CCCEEEECCCCCC---C
T ss_conf             607657540354379976616770189986777678683642434533678876729987---9819998296117---8


Q ss_pred             CCCEEECCCCC-CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             42112323983-17889863500112465212221520257799875501
Q gi|254780414|r  148 GFEVIASSDST-PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       148 gf~viA~S~~~-~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      .-..++.++.+ .+.|+. ...+++|+|||||-+ .+.|.++|+||+ ++
T Consensus       151 ~~~~i~~~~~~~~f~a~v-~~~ni~G~QFHPEKS-~~~Gl~ll~nF~-~l  197 (200)
T PRK13171        151 TADTVAACDHGGLFTAIV-QNGLRCGAQFHPERS-ADTGARILRNFL-EM  197 (200)
T ss_pred             CCCEEEEECCCCEEEEEE-ECCCEEEECCCCCCC-CHHHHHHHHHHH-HH
T ss_conf             887899942798499999-819989980894326-675799999998-54


No 57 
>KOG0370 consensus
Probab=99.92  E-value=2.7e-24  Score=193.86  Aligned_cols=231  Identities=23%  Similarity=0.424  Sum_probs=166.5

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCC---CHHHHHCCCC
Q ss_conf             4488699998897057889988886594069852898988997239979999853889999999753---7689808998
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQI---PKEILESNIP   81 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~---~~~I~~~~iP   81 (520)
                      .+.-+|+++|+|..|+|+  |++-..|+.-.++||+.+++..   +|+||+||+||.+.--  .|.+   -.++++.++|
T Consensus       170 Gk~~~I~aiDcG~K~N~I--RcL~~RGa~vtVvPw~~~i~~~---~yDGlflSNGPGdPe~--~~~~v~~vr~lL~~~~P  242 (1435)
T KOG0370         170 GKSLRILAIDCGLKYNQI--RCLVKRGAEVTVVPWDYPIAKE---EYDGLFLSNGPGDPEL--CPLLVQNVRELLESNVP  242 (1435)
T ss_pred             CCCCEEEECCCCCHHHHH--HHHHHHCCEEEEECCCCCCCCC---CCCEEEEECCCCCCHH--HHHHHHHHHHHHHCCCC
T ss_conf             864179973567418999--9999849569990377622012---5561797279999056--58999999999827998


Q ss_pred             EEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEE---ECCCHHH--CCCCCCCEEECCC
Q ss_conf             8997789999899709699986986610366752388622278726655336860---0220110--1244421123239
Q gi|254780414|r   82 LLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWM---SHGDQVE--HIPEGFEVIASSD  156 (520)
Q Consensus        82 ILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~Vwm---SH~D~V~--~lP~gf~viA~S~  156 (520)
                      ++|||+|||++|.+.|++..+.+.+..|+..       +....     .+-++++   .|++.|.  .+|.||+.+-.+.
T Consensus       243 vfGIClGHQllA~AaGakT~KmKyGNRGhNi-------P~~~~-----~tGrc~ITSQNHGYAVD~~tLp~gWk~lFvN~  310 (1435)
T KOG0370         243 VFGICLGHQLLALAAGAKTYKMKYGNRGHNI-------PCTCR-----ATGRCFITSQNHGYAVDPATLPAGWKPLFVNA  310 (1435)
T ss_pred             EEEEEHHHHHHHHHHCCCEEEEECCCCCCCC-------CCEEC-----CCCEEEEEECCCCEEECCCCCCCCCCHHEEEC
T ss_conf             5897366699998608744886315567774-------62200-----37659998157761534532457770320413


Q ss_pred             -CCCEEEEEECCCCEEEEEEEEHHHCCCHHHH-HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC-
Q ss_conf             -8317889863500112465212221520257-7998755010644111406789999999976504440366405640-
Q gi|254780414|r  157 -STPFAFIADEKRKYYAVQFHPEVVHTVGGSQ-LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGV-  233 (520)
Q Consensus       157 -~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~-iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGV-  233 (520)
                       ++..++|.|..+|+|.+|||||.+-++.... ++..|++.+-+.+.+=+.+-++.. ....-..+.-+||+..-|||. 
T Consensus       311 NDgSNEGI~Hss~P~fSvQFHPEat~GP~DTeyLFDiFi~lvkk~kst~tAs~~~t~-~~~~~~~~~~~kVlvlGSGGLs  389 (1435)
T KOG0370         311 NDGSNEGIMHSSKPFFSVQFHPEATPGPHDTEYLFDVFIELVKKSKSTPTASAFITE-PAKAAPRVEVKKVLVLGSGGLS  389 (1435)
T ss_pred             CCCCCCEEECCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCCCCCCEEEEECCCCCC
T ss_conf             567773376279872116307867899751399999999998887417854443345-5544442235179998158733


Q ss_pred             -------HHHHHHHHHHHHCC-CCEEEEEECC
Q ss_conf             -------47799999986223-6569999738
Q gi|254780414|r  234 -------DSTVAAFLIYEAIG-INLTCVLVDH  257 (520)
Q Consensus       234 -------DStV~A~Ll~kAig-~~l~~vfVD~  257 (520)
                             |-|-.-++  ||+. ++.+-|+|+-
T Consensus       390 IGQAGEFDYSGsQAi--KAlkEe~i~TiLiNP  419 (1435)
T KOG0370         390 IGQAGEFDYSGSQAI--KALKEENIFTILINP  419 (1435)
T ss_pred             CCCCCEEEEEHHHHH--HHHHHCCCEEEEECC
T ss_conf             212403554078898--765532617999789


No 58 
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=99.91  E-value=4.2e-24  Score=192.45  Aligned_cols=169  Identities=25%  Similarity=0.409  Sum_probs=125.5

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC-----CCCCCCHHHHHCCCCEE
Q ss_conf             6999988970578899888865940698528989889972399799998538899999-----99753768980899889
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-----DSPQIPKEILESNIPLL   83 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~-----~ap~~~~~I~~~~iPIL   83 (520)
                      +|.|+|||+..-+.+.|.++.+|+.++|.   .+.+++.  +.+.|||.|= .| ++.     ..-.+...|.+.+.|+|
T Consensus         2 kI~IiDyG~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lILPGV-Gs-F~~am~~L~~~~l~~~i~~~~kpiL   74 (196)
T PRK13170          2 NVVIIDTGCANLSSVKFAFERLGYNPVVS---RDPDVIL--AADKLFLPGV-GT-AQAAMDQLRERELIELIKACTQPVL   74 (196)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCC-CC-HHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             89999279558999999999879979996---7989984--3897997189-98-8999999987356899997089748


Q ss_pred             EECHHHHHHHHH---------CC---CEEEECCC-----CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCC
Q ss_conf             977899998997---------09---69998698-----66103667523886222787266553368600220110124
Q gi|254780414|r   84 GICYGQQIMCQS---------LG---GKTKNSQS-----REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIP  146 (520)
Q Consensus        84 GICyG~QlLa~~---------~G---G~V~~~~~-----~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP  146 (520)
                      |||+|||+|+..         +|   |+|++.+.     +.-||..+...+++++|+++.+   ...+|..|++++.  |
T Consensus        75 GICLGMQlL~~~S~E~g~~~GLgli~G~V~kl~~~~~~vPhiGWn~i~~~~~~~l~~~i~~---~~~fYFvHSY~~~--~  149 (196)
T PRK13170         75 GICLGMQLLGRRSEESGGVDCLGIIDGDVPKLTDFGLPLPHMGWNQVTPQAGHPLFQGIED---GSYFYFVHSYAMP--V  149 (196)
T ss_pred             EEEEEEEEEEECCCCCCCCCCCEEEEEEEEECCCCCCCCCEEEEEEEEECCCCHHHCCCCC---CCEEEEEEEEEEC--C
T ss_conf             8880031346355368986600054229999776788774421488873589876649885---8879998778706--8


Q ss_pred             CCCCEEECCCCC-CE-EEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             442112323983-17-889863500112465212221520257799875
Q gi|254780414|r  147 EGFEVIASSDST-PF-AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       147 ~gf~viA~S~~~-~i-aai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .+ ..+|.|+.+ .+ ++++  ..++||+|||||.+ .+.|.++|+||+
T Consensus       150 ~~-~~ia~t~yg~~f~s~v~--~~Ni~G~QFHPEKS-~~~Gl~lLknFl  194 (196)
T PRK13170        150 NP-YTIAQCNYGEPFSAAIQ--KDNFYGVQFHPERS-GAAGAQLLKNFL  194 (196)
T ss_pred             CC-CEEEEEECCCEEEEEEE--ECCEEEEECCCCCC-CHHHHHHHHHHH
T ss_conf             88-88999978998999997--19999996892006-784899999996


No 59 
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional
Probab=99.91  E-value=1.3e-22  Score=181.77  Aligned_cols=196  Identities=17%  Similarity=0.264  Sum_probs=132.0

Q ss_pred             CCCCCCCCEEEEEE----CCCCH----HHHHHHHHHHCCCEEEEECCC-CCHHHHHH--CCCCEEEECCCCCCC----CC
Q ss_conf             98634488699998----89705----788998888659406985289-89889972--399799998538899----99
Q gi|254780414|r    1 MHKRERSSKVLIID----FGSQF----TQLIARRVRESKVYCEVIAFK-NALDYFKE--QNPQAIILSGSPASS----LD   65 (520)
Q Consensus         1 m~~~~~~~~IlIlD----fGSQy----tqLIaRriRelgVyseI~P~~-~~~e~i~~--~~p~GIILSGGP~SV----~d   65 (520)
                      |.+-.+++-|-|.-    +..+.    .+--.+.|.+.|--..++|+. ...+.+..  ...+|++|||||..|    |.
T Consensus         1 m~~~M~kPiIGIt~~~~~~~g~~~~~v~~~Y~~ai~~aGgiPvllP~~~~~~~~~~~~l~~lDGllltGG~~Di~P~~Yg   80 (254)
T PRK11366          1 MENIMNNPVIGVVMCRNRLKGHATQTLQEKYLNAIIHAGGLPIALPHALAEPSLLEQLLPKLDGIYLPGSPSNVQPHLYG   80 (254)
T ss_pred             CCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHCCEEEECCCCCCCCHHHCC
T ss_conf             97767999899938864547865768889999999982985898488878878999999878989968998988942368


Q ss_pred             CC--CCCCC-----------HHHHHCCCCEEEECHHHHHHHHHCCCEEEEC--------CCCC---------CC-EEEEE
Q ss_conf             99--97537-----------6898089988997789999899709699986--------9866---------10-36675
Q gi|254780414|r   66 ID--SPQIP-----------KEILESNIPLLGICYGQQIMCQSLGGKTKNS--------QSRE---------FG-RAFIE  114 (520)
Q Consensus        66 ~~--ap~~~-----------~~I~~~~iPILGICyG~QlLa~~~GG~V~~~--------~~~E---------yG-~~~I~  114 (520)
                      ++  .|..+           +..++.++||||||.|||+|+.++||++..-        .+++         |. ...+.
T Consensus        81 e~~~~~~~dp~RD~~E~~L~~~A~~~~~PiLGICRG~Q~lNVa~GGtL~qdl~~~~~~~~H~~~~~~~~~~~~~~~H~V~  160 (254)
T PRK11366         81 ENGDEPDADPGRDLLSMALINAALERRIPIFAICRGLQELVVATGGSLHRKLCEQPELLEHREDPELPVEQQYAPSHEVQ  160 (254)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEE
T ss_conf             89888888842129999999999985999798603558999873886442200376523445688898543325641189


Q ss_pred             ECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCCCE-EEEEEEEHHHCCCH--HHHHHHH
Q ss_conf             23886222787266553368600220110124442112323983178898635001-12465212221520--2577998
Q gi|254780414|r  115 IKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKY-YAVQFHPEVVHTVG--GSQLIDN  191 (520)
Q Consensus       115 i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~~i-yGVQFHPEV~hT~~--G~~iL~N  191 (520)
                      +...+.|.+ +........|...|+..|.++++||++.|+++++.|+||++.+.++ .|||||||....+.  ...||+.
T Consensus       161 i~~~s~L~~-i~~~~~~~~VNS~HhQav~~lg~gl~v~A~a~DG~IEAie~~~~~f~lGVQWHPE~~~~~~~~~~~LF~a  239 (254)
T PRK11366        161 VEEGGLLSA-LLPECSNFWVNSLHGQGAKVVSPRLRVEARSPDGLVEAVSVINHPFALGVQWHPEWNSSEYALSRILFEG  239 (254)
T ss_pred             ECCCCCHHH-HHCCCCCEEEECHHHHHHHCCCCCCEEEEEECCCCEEEEEECCCCEEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             868986999-7489870587421354331337773899990899779999579985899970887787678678999999


Q ss_pred             HHHHHCC
Q ss_conf             7550106
Q gi|254780414|r  192 FVHHVAG  198 (520)
Q Consensus       192 Fl~~Ic~  198 (520)
                      |+ +-|+
T Consensus       240 Fv-~a~r  245 (254)
T PRK11366        240 FI-TACQ  245 (254)
T ss_pred             HH-HHHH
T ss_conf             99-9999


No 60 
>pfam07722 Peptidase_C26 Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyse the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C terminus.
Probab=99.90  E-value=5.4e-23  Score=184.56  Aligned_cols=153  Identities=18%  Similarity=0.320  Sum_probs=111.3

Q ss_pred             HHHHHHCCCEEEEECCCCCHHHHHH--CCCCEEEECCCCCCC----CCCCC-C-----CCC---------HHHHHCCCCE
Q ss_conf             9888865940698528989889972--399799998538899----99999-7-----537---------6898089988
Q gi|254780414|r   24 ARRVRESKVYCEVIAFKNALDYFKE--QNPQAIILSGSPASS----LDIDS-P-----QIP---------KEILESNIPL   82 (520)
Q Consensus        24 aRriRelgVyseI~P~~~~~e~i~~--~~p~GIILSGGP~SV----~d~~a-p-----~~~---------~~I~~~~iPI   82 (520)
                      .+.|+..|.-..++|++.+.+.+..  ...+||+|+||+..+    |.+.. +     ...         +..++.++||
T Consensus        30 v~~i~~aGg~pv~iP~~~~~~~~~~~l~~~dGlll~GG~~di~P~~yg~~~~~~~~~~~~~Rd~~e~~l~~~a~~~~~Pi  109 (219)
T pfam07722        30 VKAVEGAGGLPVLLPILEDPEDLEALLDLVDGLLLTGGQSNVDPSLYGEEPSPSGGYYDPARDAFELALIRAALERGKPI  109 (219)
T ss_pred             HHHHHHCCCEEEEECCCCCHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCE
T ss_conf             99999859999997899998999999976798998598876782214677686678757888999999999998769987


Q ss_pred             EEECHHHHHHHHHCCCEEEEC--------------CCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCC
Q ss_conf             997789999899709699986--------------986610366752388622278726655336860022011012444
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNS--------------QSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEG  148 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~--------------~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~g  148 (520)
                      ||||+|||+|+.++||++...              ..+.+....+.+.+++.+.+ +.. .....|+..|++.|.+++++
T Consensus       110 lGICrG~Qllnv~~GGtL~q~i~~~~~~~~~~~~~~~~~~~~h~v~i~~~s~l~~-~~~-~~~~~vnS~Hhq~I~~l~~~  187 (219)
T pfam07722       110 LGICRGMQLLNVALGGTLYQDIPEHPGNSDHHHQLAVQYAPSHAVSLEPGSLLAR-LLG-AEEILVNSLHHQAIKRLAPG  187 (219)
T ss_pred             EEECHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHH-HHC-CCCEEEECCHHHHHHCCCCC
T ss_conf             9976508999999678300023012575445668876425603899778973998-729-98457974506577404898


Q ss_pred             CCEEECCCCCCEEEEEECCCC--EEEEEEEEH
Q ss_conf             211232398317889863500--112465212
Q gi|254780414|r  149 FEVIASSDSTPFAFIADEKRK--YYAVQFHPE  178 (520)
Q Consensus       149 f~viA~S~~~~iaai~~~~~~--iyGVQFHPE  178 (520)
                      |+++|+++++.++||++.+.+  ++|||||||
T Consensus       188 l~v~A~a~Dg~iEaie~~~~~~f~~GVQwHPE  219 (219)
T pfam07722       188 LRVEATAPDGTIEAIESPNAPYFVLGVQWHPE  219 (219)
T ss_pred             CEEEEEECCCCEEEEEECCCCCCEEEEEECCC
T ss_conf             58999948997899996699986799972889


No 61 
>PRK13148 consensus
Probab=99.89  E-value=2.7e-22  Score=179.53  Aligned_cols=180  Identities=19%  Similarity=0.366  Sum_probs=124.0

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-CCC-CCCCCCCHHH--HHCCCCE
Q ss_conf             869999889705788998888659406985289898899723997999985-3889-999-9997537689--8089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-SLD-IDSPQIPKEI--LESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V~d-~~ap~~~~~I--~~~~iPI   82 (520)
                      .+|.|+|||.---+.+.|.++.+|.-+++.-. ...+++.  +.+.|||.| |..+ +.+ -..-.++..+  ...+.|+
T Consensus         2 ~~I~IIDyg~GNl~Sv~~al~~~g~~~~~~i~-~~~~~i~--~~d~lILPGVGsF~~am~~L~~~~l~~~i~~~~~~kpi   78 (225)
T PRK13148          2 STIAIVDYGMGNFHSVARALQHAAPDADIRIC-NRPEQID--AADRVVFPGQGAMPDCMRTLNESGLRAAVERAAASKPL   78 (225)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHCCCCCEEEE-CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHCCCCE
T ss_conf             87999979944999999999985789739998-9999995--49979989978879999998864879999998638986


Q ss_pred             EEECHHHHHHHHHC-----------CCEEEEC--------------------------CCCCCCEEEEEECCCCCCCCCC
Q ss_conf             99778999989970-----------9699986--------------------------9866103667523886222787
Q gi|254780414|r   83 LGICYGQQIMCQSL-----------GGKTKNS--------------------------QSREFGRAFIEIKKNCSLLKGM  125 (520)
Q Consensus        83 LGICyG~QlLa~~~-----------GG~V~~~--------------------------~~~EyG~~~I~i~~~~~lf~gl  125 (520)
                      ||||+|||+|+..-           -|+|.+-                          +...-||..+...+.+.+|+++
T Consensus        79 LGICLGMQlLf~~SeEg~~~GLgli~G~V~kl~~~~~~~~~~~~~~~~~~~~~~~~~lkiPh~GWn~v~~~~~~~l~~~i  158 (225)
T PRK13148         79 MGVCVGEQMLFERSEEGDTPCLGIFPGEVRRFAGPQFADPVAADQAAAAPPAAARERLKVPHMGWNQVRQTRSHALWEGI  158 (225)
T ss_pred             EEEEHHHHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCEEECCCCCCHHCCC
T ss_conf             99827788766245226977565587899981476545642112333455544354888888861203778997121266


Q ss_pred             CCCCCCEEEEEECCCHHHCCCCCCCEEECCCCC-C-EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             266553368600220110124442112323983-1-78898635001124652122215202577998755010644111
Q gi|254780414|r  126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDST-P-FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNW  203 (520)
Q Consensus       126 ~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~-~-iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W  203 (520)
                      .+....+.|   |++++. .-+...++|.|+.+ . +++++.  .++||+|||||-+ ...|.+||+||+        +|
T Consensus       159 ~~~~~fYFv---HSY~~~-~~~~~~~~a~t~yg~~f~s~v~~--~Ni~G~QFHPEKS-~~~Gl~lLknFl--------~w  223 (225)
T PRK13148        159 PDGTHFYFV---HSYYAA-PSDPALTTGVTDYGVAFTCAVAA--ANIFAVQFHPEKS-AEHGLRLYRNFV--------DW  223 (225)
T ss_pred             CCCCEEEEE---EEEEEC-CCCCCCEEEEEECCCEEEEEEEE--CCEEEEECCHHHH-CHHHHHHHHHHH--------CC
T ss_conf             778706887---545631-68815589998589989999996--9999990881231-577999999987--------67


Q ss_pred             CC
Q ss_conf             40
Q gi|254780414|r  204 VM  205 (520)
Q Consensus       204 ~~  205 (520)
                      ++
T Consensus       224 ~p  225 (225)
T PRK13148        224 QP  225 (225)
T ss_pred             CC
T ss_conf             99


No 62 
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism]
Probab=99.89  E-value=9.8e-22  Score=175.57  Aligned_cols=175  Identities=25%  Similarity=0.380  Sum_probs=124.6

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-CCCC-CCCCCCHHHHH---CCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-3889-9999-99753768980---8998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-SLDI-DSPQIPKEILE---SNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V~d~-~ap~~~~~I~~---~~iP   81 (520)
                      .+|+|+|||+-.-+.+.|.++.+|....|.   .+.+++..  .++|||.| |... +.+. ..-.+...+.+   .++|
T Consensus         2 ~~i~IIDyg~GNL~Sv~~Aler~G~~~~vs---~d~~~i~~--AD~liLPGVGaf~~am~~L~~~gl~~~i~~~~~~~kP   76 (204)
T COG0118           2 MMVAIIDYGSGNLRSVKKALERLGAEVVVS---RDPEEILK--ADKLILPGVGAFGAAMANLRERGLIEAIKEAVESGKP   76 (204)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEE---CCHHHHHH--CCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             789999728635999999999759806981---69889710--8887866978889999988863669999999755997


Q ss_pred             EEEECHHHHHHHHH------------CCCEEEECCC-----CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHC
Q ss_conf             89977899998997------------0969998698-----661036675238862227872665533686002201101
Q gi|254780414|r   82 LLGICYGQQIMCQS------------LGGKTKNSQS-----REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEH  144 (520)
Q Consensus        82 ILGICyG~QlLa~~------------~GG~V~~~~~-----~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~  144 (520)
                      +||||+|||+|...            +.|+|.+.+.     ..-||..+...+++++|+|+.+....+.|   |++++.-
T Consensus        77 ~LGIClGMQlLfe~SeE~~~~~GLg~i~G~V~r~~~~~~kvPHMGWN~l~~~~~~~l~~gi~~~~~~YFV---HSY~~~~  153 (204)
T COG0118          77 FLGICLGMQLLFERSEEGGGVKGLGLIPGKVVRFPAEDLKVPHMGWNQVEFVRGHPLFKGIPDGAYFYFV---HSYYVPP  153 (204)
T ss_pred             EEEEEHHHHHHHHCCCCCCCCCCCCEECCEEEECCCCCCCCCCCCCCEEECCCCCHHHCCCCCCCEEEEE---EEEEECC
T ss_conf             7998175777664154368988702130168876888887886665223126787443289988779999---7876157


Q ss_pred             CCCCCCEEECCCCC-CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             24442112323983-17889863500112465212221520257799875
Q gi|254780414|r  145 IPEGFEVIASSDST-PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       145 lP~gf~viA~S~~~-~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                       .+.-.++|.++.+ ++.|.-.++ ++||+|||||-+ +..|.+||+||+
T Consensus       154 -~~~~~v~~~~~YG~~f~AaV~k~-N~~g~QFHPEKS-g~~Gl~lL~NFl  200 (204)
T COG0118         154 -GNPETVVATTDYGEPFPAAVAKD-NVFGTQFHPEKS-GKAGLKLLKNFL  200 (204)
T ss_pred             -CCCCEEEEECCCCCEEEEEEEEC-CEEEEECCCCCC-HHHHHHHHHHHH
T ss_conf             -99861888646898358999708-899992386311-387899999998


No 63 
>COG2071 Predicted glutamine amidotransferases [General function prediction only]
Probab=99.88  E-value=1.2e-21  Score=174.85  Aligned_cols=172  Identities=19%  Similarity=0.282  Sum_probs=123.9

Q ss_pred             HHHHHHCCCEEEEECCCCCHHHHHH--CCCCEEEECCCCCCC----CCCCC--------CCCC-------HHHHHCCCCE
Q ss_conf             9888865940698528989889972--399799998538899----99999--------7537-------6898089988
Q gi|254780414|r   24 ARRVRESKVYCEVIAFKNALDYFKE--QNPQAIILSGSPASS----LDIDS--------PQIP-------KEILESNIPL   82 (520)
Q Consensus        24 aRriRelgVyseI~P~~~~~e~i~~--~~p~GIILSGGP~SV----~d~~a--------p~~~-------~~I~~~~iPI   82 (520)
                      .+.+...|....++|.-...+.+..  ...+|+||||| ++|    |.++.        |.-|       ++.++.++||
T Consensus        32 v~ai~~aGg~pillP~~~d~~~~~~~l~~iDgliltGg-~nV~P~~YGee~~~~~~~~~p~RD~~E~aLi~~ALe~~iPI  110 (243)
T COG2071          32 VDAIIKAGGIPILLPALEDPEDARQYLDLIDGLILTGG-SNVDPSLYGEEPSEKDGPYDPERDAFELALIRAALERGIPI  110 (243)
T ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHHHHCCEEEECCC-CCCCHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCE
T ss_conf             99999769950885488877789999865367895289-86898783988885567788430077899999999769988


Q ss_pred             EEECHHHHHHHHHCCCEEEEC--------C-----CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCC
Q ss_conf             997789999899709699986--------9-----866103667523886222787266553368600220110124442
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNS--------Q-----SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGF  149 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~--------~-----~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf  149 (520)
                      ||||+|+|+|+.+|||+..+-        +     ...++...+.+..++.|.+-+ .... ..|..-|..++.++.++|
T Consensus       111 LgICRG~QllNVa~GGtL~q~i~~~~~~~~H~~~~~~~~~~H~V~i~~~s~La~i~-g~~~-~~VNS~HhQaIk~La~~L  188 (243)
T COG2071         111 LGICRGLQLLNVALGGTLYQDISEQPGHIDHRQPNPVHIESHEVHIEPGSKLAKIL-GESE-FMVNSFHHQAIKKLAPGL  188 (243)
T ss_pred             EEECCCHHHHHHHHCCEEEHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHC-CCCC-EEECCHHHHHHHHHCCCC
T ss_conf             99840157887875675302123054500256999865431579954784177753-7652-263151778999767886


Q ss_pred             CEEECCCCCCEEEEEECC-CCEEEEEEEEHHHCCC--HHHHHHHHHHHHHCCC
Q ss_conf             112323983178898635-0011246521222152--0257799875501064
Q gi|254780414|r  150 EVIASSDSTPFAFIADEK-RKYYAVQFHPEVVHTV--GGSQLIDNFVHHVAGI  199 (520)
Q Consensus       150 ~viA~S~~~~iaai~~~~-~~iyGVQFHPEV~hT~--~G~~iL~NFl~~Ic~~  199 (520)
                      ++.|.++++.|+|+++++ ..+.|||||||-.-.+  .-.+|++.|+ +.|+-
T Consensus       189 ~V~A~a~DG~VEAie~~~~~fvlGVQWHPE~~~~~~~~~~~LFe~F~-~~~~~  240 (243)
T COG2071         189 VVEARAPDGTVEAVEVKNDAFVLGVQWHPEYLVDTNPLSLALFEAFV-NACKK  240 (243)
T ss_pred             EEEEECCCCCEEEEEECCCCEEEEEECCHHHHCCCCHHHHHHHHHHH-HHHHH
T ss_conf             79999799958989853885079986175552267868899999999-99875


No 64 
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine 
Probab=99.88  E-value=1.4e-21  Score=174.38  Aligned_cols=145  Identities=23%  Similarity=0.380  Sum_probs=107.4

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHH--HCCCCEEEECCCCCC---CCCCC-C-------CC-------CCHHHHHCCC
Q ss_conf             889988886594069852898988997--239979999853889---99999-9-------75-------3768980899
Q gi|254780414|r   21 QLIARRVRESKVYCEVIAFKNALDYFK--EQNPQAIILSGSPAS---SLDID-S-------PQ-------IPKEILESNI   80 (520)
Q Consensus        21 qLIaRriRelgVyseI~P~~~~~e~i~--~~~p~GIILSGGP~S---V~d~~-a-------p~-------~~~~I~~~~i   80 (520)
                      +...+.+...|.-..++|+..+...+.  ....+|+|||||+.-   .|.++ .       |.       +-+..++.++
T Consensus        22 ~~y~~~i~~~G~~Pi~iP~~~~~~~~~~~l~~lDGliLtGG~Di~p~~yg~~~~~~~~~~~~~RD~~E~~l~~~a~~~~~  101 (189)
T cd01745          22 QYYVDAVRKAGGLPVLLPPVDDEEDLEQYLELLDGLLLTGGGDVDPPLYGEEPHPELGPIDPERDAFELALLRAALERGK  101 (189)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCEEEECCCCCCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999879999996899987999999987799997288778810038877765678886689999999999998098


Q ss_pred             CEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCE
Q ss_conf             88997789999899709699986986610366752388622278726655336860022011012444211232398317
Q gi|254780414|r   81 PLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPF  160 (520)
Q Consensus        81 PILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~i  160 (520)
                      ||||||+|||+|+.++||+...-                     +       .|...|++.|.++|+++.++|+++++.|
T Consensus       102 PilGICRG~Q~inv~~GGtL~q~---------------------i-------~VNS~H~~~i~~l~~~l~~~a~~~dg~i  153 (189)
T cd01745         102 PILGICRGMQLLNVALGGTLYQD---------------------I-------RVNSLHHQAIKRLADGLRVEARAPDGVI  153 (189)
T ss_pred             CCEEEHHHHHHHHHHHCCEEEEC---------------------C-------CCCCCCHHHHHCCCCCCEEEEECCCCCE
T ss_conf             76035054999999959857503---------------------4-------0576410067607888689999699987


Q ss_pred             EEEEECCCC-EEEEEEEEHHHCC--CHHHHHHHHHH
Q ss_conf             889863500-1124652122215--20257799875
Q gi|254780414|r  161 AFIADEKRK-YYAVQFHPEVVHT--VGGSQLIDNFV  193 (520)
Q Consensus       161 aai~~~~~~-iyGVQFHPEV~hT--~~G~~iL~NFl  193 (520)
                      +|+++++++ ++|||||||-.-.  +...+|++.|+
T Consensus       154 Ea~~~~~~~~~~gvqwHPE~~~~~~~~~~~lF~~fv  189 (189)
T cd01745         154 EAIESPDRPFVLGVQWHPEWLADTDPDSLKLFEAFV  189 (189)
T ss_pred             EEEEECCCCCEEEEECCCCCCCCCCHHHHHHHHHHC
T ss_conf             999968999089997488678989857889999869


No 65 
>PRK13179 consensus
Probab=99.87  E-value=7.7e-21  Score=169.17  Aligned_cols=174  Identities=19%  Similarity=0.302  Sum_probs=121.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCCC-CCCCCCH---HHHHCCCCEE
Q ss_conf             9999889705788998888659406985289898899723997999985-388-99999-9975376---8980899889
Q gi|254780414|r   10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLDI-DSPQIPK---EILESNIPLL   83 (520)
Q Consensus        10 IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d~-~ap~~~~---~I~~~~iPIL   83 (520)
                      |.|+|+|+---+.+.+.++.+|+.+.+.   .+.+++.  +.+.|||.| |.. ++.+. ..-.++.   +..+.+.|+|
T Consensus         2 I~IiDyg~gNi~Sv~~al~~~g~~~~i~---~~~~~i~--~~d~lILPGVGsF~~~m~~L~~~~l~~~i~~~~~~~kpiL   76 (207)
T PRK13179          2 IAIIDYGMGNLRSVQKGFEKVGFEAVVT---ADPKVVL--EAEKVVLPGVGAFRDCMRNLEQGGFVEPILRVIRDGRPFL   76 (207)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCCEE
T ss_conf             9999569358999999999859987996---8999994--3998998997867999999885376168999986599689


Q ss_pred             EECHHHHHHHHH------------CCCEEEEC-----------CCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             977899998997------------09699986-----------9866103667523886222787266553368600220
Q gi|254780414|r   84 GICYGQQIMCQS------------LGGKTKNS-----------QSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGD  140 (520)
Q Consensus        84 GICyG~QlLa~~------------~GG~V~~~-----------~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D  140 (520)
                      |||+|||+|...            +-|+|.+-           +.+.-||..+...+++++|.++.+....+   ..|++
T Consensus        77 GICLGmQlLf~~S~E~g~~~GLgli~G~V~kl~~~~~~~~~~~kiPhiGWn~i~~~~~~~~~~~~~~~~~fY---FvHSY  153 (207)
T PRK13179         77 GICVGMQLLFTDSEEFGLYQGLNVIPGHVLRFPEGMREGGEELKVPHMGWNQLSIRRRPPAFQGIEDGTNVY---FVHSY  153 (207)
T ss_pred             EEEHHHHHCCCCCCCCCCCCCCCEECEEEEECCCCCCCCCCCCCCCEEEEEEEECCCCCCHHCCCCCCCEEE---EEECC
T ss_conf             980779963798806995577878340799876443444654668751125664367883101445677079---98431


Q ss_pred             HHHCCCCCCCEEECCCCC--CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             110124442112323983--17889863500112465212221520257799875501
Q gi|254780414|r  141 QVEHIPEGFEVIASSDST--PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       141 ~V~~lP~gf~viA~S~~~--~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      ++.-. +...+.|++..+  .+|+++  ..++||+|||||-+ ...|.++|+||+ ++
T Consensus       154 ~~~~~-~~~~i~~~~~yg~~~~a~v~--k~Ni~G~QFHPEKS-~~~Gl~lLknF~-el  206 (207)
T PRK13179        154 YVKPD-DESVVAATTGYGIEFCAAVW--KDNIVATQFHPEKS-QAVGLSILKNFG-EM  206 (207)
T ss_pred             EECCC-CCCCEEEEEECCCEEEEEEE--ECCEEEEECCHHHC-CHHHHHHHHHHH-HC
T ss_conf             64157-84518999848997999999--69999995880125-586899999997-13


No 66 
>PRK13173 consensus
Probab=99.87  E-value=1.1e-20  Score=168.01  Aligned_cols=173  Identities=25%  Similarity=0.386  Sum_probs=117.0

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHH--HCCCCE
Q ss_conf             869999889705788998888659406985289898899723997999985-388-9999-99975376898--089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEIL--ESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~--~~~iPI   82 (520)
                      .+|.|||+|+---..+.|.++.+|+.++|.   .+.+++.  +.+.+||.| |.. ++.. -..-.++..+.  ..+.|+
T Consensus         2 ~kI~IiDyg~gNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lILPGVGsF~~~m~~L~~~~l~~~i~~~~~~kpi   76 (211)
T PRK13173          2 TKIALLDYGMGNLHSASKALSAVGAEVSIT---NDPKVIA--AADKIVFPGVGAMRDCMAGMHEAGIDEVVRQAIFNKPV   76 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHCCCCE
T ss_conf             879999689449999999999869988996---7999984--38968975778689999998862979999988629998


Q ss_pred             EEECHHHHHHHHH---------CC---CEEEECC------------CCCCCEEEEEEC-CCCCCCCCCCCCCCCEEEEEE
Q ss_conf             9977899998997---------09---6999869------------866103667523-886222787266553368600
Q gi|254780414|r   83 LGICYGQQIMCQS---------LG---GKTKNSQ------------SREFGRAFIEIK-KNCSLLKGMWEKGSKQQVWMS  137 (520)
Q Consensus        83 LGICyG~QlLa~~---------~G---G~V~~~~------------~~EyG~~~I~i~-~~~~lf~gl~~~~~~~~VwmS  137 (520)
                      ||||+|||+|+..         +|   |+|++-.            .+.-||..+... ..+++++++.+...   ++..
T Consensus        77 LGICLGMQlLf~~s~E~g~~~GLgli~G~V~~l~~~~~~~~~~~~kvPhiGWn~v~~~~~~~~l~~~i~~~~~---fYFv  153 (211)
T PRK13173         77 MAICVGMQALFEQSAENGGTPCLSILDGTVKAFDPSWKDPKGVQIKVPHMGWNTISGMDFEHPLWNGIDDKAH---FYFV  153 (211)
T ss_pred             EEEEHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHCCCCCCCE---EEEE
T ss_conf             9981888985068988999671306600698767444675555434660003454335765364449987860---7998


Q ss_pred             CCCHHHCCCCC-CCEEECCCC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             22011012444-211232398--317889863500112465212221520257799875
Q gi|254780414|r  138 HGDQVEHIPEG-FEVIASSDS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       138 H~D~V~~lP~g-f~viA~S~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      |++.+.  |.+ ..+.|.+..  ..+++++  ..++||+|||||-++ +.|.++|+||+
T Consensus       154 HSY~~~--~~~~~~~~~~~~yg~~f~a~v~--k~Ni~G~QFHPEKS~-~~Gl~lLknFl  207 (211)
T PRK13173        154 HSYYCE--PADSSQVAAICDYGQPFCASIL--KDNLFATQFHPEKSH-TAGLQLLKNFV  207 (211)
T ss_pred             EEEEEE--CCCCCEEEEEEECCCEEEEEEE--ECCEEEEECCHHHCC-HHHHHHHHHHH
T ss_conf             667870--3782507899838988999999--699999908801245-86899999997


No 67 
>KOG1224 consensus
Probab=99.87  E-value=3.6e-21  Score=171.50  Aligned_cols=195  Identities=23%  Similarity=0.275  Sum_probs=141.6

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHH-CCCEEEEECCC-CCHH----HHHH-CCCCEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             8634488699998897057889988886-59406985289-8988----9972-39979999853889999999753768
Q gi|254780414|r    2 HKRERSSKVLIIDFGSQFTQLIARRVRE-SKVYCEVIAFK-NALD----YFKE-QNPQAIILSGSPASSLDIDSPQIPKE   74 (520)
Q Consensus         2 ~~~~~~~~IlIlDfGSQytqLIaRriRe-lgVyseI~P~~-~~~e----~i~~-~~p~GIILSGGP~SV~d~~ap~~~~~   74 (520)
                      .++...-++|.+|.=..||-.|.|-+.. -++-|.++-++ ..-+    .+.. -..++|+.+.||.|..-+....+-.+
T Consensus         9 k~~~~rl~~LlID~YDSyTfNiy~ll~~~~~vp~V~~vh~~~~~~d~~~~l~q~~~FDaIVVgPGPG~P~~a~d~gI~~r   88 (767)
T KOG1224           9 KKSLPRLRTLLIDNYDSYTFNIYQLLSTINGVPPVVIVHDEWTWEDAYHYLYQDVAFDAIVVGPGPGSPMCAADIGICLR   88 (767)
T ss_pred             HHHHHHEEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHH
T ss_conf             86631202888712454121399999874179967998343237789998864002244896689979874788789999


Q ss_pred             HHHC--CCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCC-CCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             9808--99889977899998997096999869866103667523886222787266-55336860022011012444211
Q gi|254780414|r   75 ILES--NIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK-GSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        75 I~~~--~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~-~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
                      ++..  .|||||||+|+|.|+.+.|+.|...+..-+|+..-.-.+...+|.|++.. ++.+.+-..|+..+..+|-+...
T Consensus        89 l~~~~~~iPilGICLGfQal~l~hGA~v~~~n~p~HGrvs~i~~~~~~~f~gi~sg~~~~fK~~RYHSL~in~~pid~l~  168 (767)
T KOG1224          89 LLLECRDIPILGICLGFQALGLVHGAHVVHANEPVHGRVSGIEHDGNILFSGIPSGRNSDFKVVRYHSLIINSLPIDLLP  168 (767)
T ss_pred             HHHHCCCCCEEEEEHHHHHHHHHCCCCEECCCCCCCCEEEEEEECCCEEECCCCCCCCCCCEEEEEEEEEECCCCHHHHC
T ss_conf             99865788646543214767653166110378764324666772684787157778866440477677872577611212


Q ss_pred             -EECCC--CC-CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             -23239--83-178898635001124652122215202577998755010
Q gi|254780414|r  152 -IASSD--ST-PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       152 -iA~S~--~~-~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                       ++.++  |+ ..+++.+.+.|.||+|||||+..|+.|.++++||+ ++.
T Consensus       169 il~t~~ddng~ilMsi~~~~fPhfG~qyHPES~~s~~g~~lfkNFl-~lt  217 (767)
T KOG1224         169 ILWTIYDDNGHILMSIMHSSFPHFGLQYHPESIASTYGSQLFKNFL-DLT  217 (767)
T ss_pred             CEEEEECCCCEEEEEEECCCCCCCCEEECHHHHHHHHHHHHHHHHH-HHH
T ss_conf             0137606886289875315788534233707753134579998777-763


No 68 
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional
Probab=99.87  E-value=3.8e-21  Score=171.35  Aligned_cols=175  Identities=19%  Similarity=0.285  Sum_probs=116.4

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCH---HHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-9999-99975376---89808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPK---EILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~---~I~~~~iP   81 (520)
                      -+|.|+|+|+---..+.|.++.+|+.+.+..   ..+++.  +.++|||.| |.. ++.+ -..-.+..   +..+.+.|
T Consensus         2 ~~I~Iid~g~GNi~Sv~~al~~~g~~~~ii~---~~~~i~--~~d~lILPGVGsf~~~m~~L~~~~l~~~i~~~~~~g~p   76 (210)
T CHL00188          2 MKIGIIDYSMGNLHSVSRAIQQAGQQPCIIN---SESELA--QVHALVLPGVGSFDLAMKKLEKKGLITPIKKWIAEGNP   76 (210)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEC---CHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             7799995884789999999998699879979---999996--48968988867389999988630516999999976998


Q ss_pred             EEEECHHHHHHHHH-----------CCCEEEECC------CCCCCEEEEEECCCC------CCCCCCCCCCCCEEEEEEC
Q ss_conf             89977899998997-----------096999869------866103667523886------2227872665533686002
Q gi|254780414|r   82 LLGICYGQQIMCQS-----------LGGKTKNSQ------SREFGRAFIEIKKNC------SLLKGMWEKGSKQQVWMSH  138 (520)
Q Consensus        82 ILGICyG~QlLa~~-----------~GG~V~~~~------~~EyG~~~I~i~~~~------~lf~gl~~~~~~~~VwmSH  138 (520)
                      +||||+|||+|+..           +.|+|.+-+      .+..||..+...+..      +.++++....   .++-.|
T Consensus        77 iLGICLGmQlLf~~seEg~~~GLgli~G~v~k~~~~~~~kvPh~GWn~i~~~~~~~~~~~~~~~~~~~~~~---~~YFvH  153 (210)
T CHL00188         77 FIGICLGLHLLFETSEEGKEEGLGIYKGQVKRLKHSPVKVIPHMGWNRLECQNSECQNSEWVNWKAWPLNP---WAYFVH  153 (210)
T ss_pred             EEEEEHHEEEEEHHCCCCCCCCCCEECCEEEECCCCCCCCCCCCCHHHEECCCCCCCCCCCCHHHCCCCCC---CEEEEE
T ss_conf             69984210221022115676773456668999378866467320542324457643344451121577677---079974


Q ss_pred             CCHHHCCCCC-CCEEECCCCC---CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHH
Q ss_conf             2011012444-2112323983---1788986350011246521222152025779987550
Q gi|254780414|r  139 GDQVEHIPEG-FEVIASSDST---PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHH  195 (520)
Q Consensus       139 ~D~V~~lP~g-f~viA~S~~~---~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~  195 (520)
                      ++.+.  |.+ -.+.+.+..+   .+++++  ..++||+|||||-+ ...|.++|+||+.+
T Consensus       154 SY~~~--~~~~~~~~~~~~yg~~~~~a~v~--k~Ni~G~QFHPEKS-~~~Gl~lL~nFl~~  209 (210)
T CHL00188        154 SYGVM--PKSQACATTTTFYGKQQMVAAIE--YDNIFAMQFHPEKS-GEFGLWLLREFMKK  209 (210)
T ss_pred             EEEEC--CCCCCEEEEEEEECCEEEEEEEE--ECCEEEEECCCCCC-CHHHHHHHHHHHHC
T ss_conf             13552--79843799999639989999997--19999994880007-68799999999755


No 69 
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139   Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis. IGPS consists of two different subunits: HisH, a glutamine amidotransferase (glutaminase), and HisF, a synthase (cyclase). HisH functions to provide a source of nitrogen, which is required for the synthesis of histidine and purines. In the HisH glutaminase reaction, the hydrolysis of glutamine yields ammonia, which is then used by HisF in the subsequent synthase reaction. The X-ray structure of the HisH/HisF heterodimer of IGPS reveals a putative tunnel for the transfer of ammonia from HisH to HisF via a (beta-alpha)8 barrel fold within HisF that abuts HisH . Ammonia tunnels connect the glutaminase and synthase active sites.   HisH belongs to a large group of enzymes found in diverse and fundamental anabolic pathways. These enzymes share a common domain, referred to as the type-I glutamine amidotransferase (GATase) domain, which can occur either as single polypeptides (as with HisH) or as domains of large multifunctional proteins.; GO: 0016763 transferase activity transferring pentosyl groups, 0000105 histidine biosynthetic process, 0005737 cytoplasm.
Probab=99.87  E-value=2.1e-21  Score=173.23  Aligned_cols=173  Identities=24%  Similarity=0.367  Sum_probs=126.9

Q ss_pred             EEEEECCCCHHHH----HHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCCC-C----CCCCCCCCCHHHHHCC
Q ss_conf             9999889705788----998888659406985289898899723997999985-3889-9----9999975376898089
Q gi|254780414|r   10 VLIIDFGSQFTQL----IARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPAS-S----LDIDSPQIPKEILESN   79 (520)
Q Consensus        10 IlIlDfGSQytqL----IaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~S-V----~d~~ap~~~~~I~~~~   79 (520)
                      |+|||||.--=..    +.|.+..+|+-.+|..-+  .+.+.  ..+.|||-| |... +    .+-+-..+-..+...+
T Consensus         1 i~viDYG~GNL~SlyrGV~~Al~~~G~~~~v~~~~--y~~~~--~aD~l~LPGVG~F~~aM~~l~~~~~~~~~~~~~~~~   76 (211)
T TIGR01855         1 IVVIDYGVGNLRSLYRGVKRALKRVGAEPVVVKDS--YKELE--KADKLILPGVGAFKAAMARLRELGLLDLLELVVKKK   76 (211)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHCCCEEEEECCC--CHHHH--CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             97874371656889999999998449817996286--03431--068678578588899999988500587889999618


Q ss_pred             CCEEEECHHHHHHHHH-------------CCCEEEEC---------CCCCCCEEEEEECCCC-CCCCCCCCCCCCEEEEE
Q ss_conf             9889977899998997-------------09699986---------9866103667523886-22278726655336860
Q gi|254780414|r   80 IPLLGICYGQQIMCQS-------------LGGKTKNS---------QSREFGRAFIEIKKNC-SLLKGMWEKGSKQQVWM  136 (520)
Q Consensus        80 iPILGICyG~QlLa~~-------------~GG~V~~~---------~~~EyG~~~I~i~~~~-~lf~gl~~~~~~~~Vwm  136 (520)
                      .|+||||+|||||...             +.|+|.|.         +.+.-||..+...+++ +|++|+.+....+.|  
T Consensus        77 ~P~lGiCLGMQLLfe~SeE~g~~~~GLG~i~G~V~k~~~~~~~~~lk~PHmGWN~v~~~~~~C~ll~g~~~~~~~YFV--  154 (211)
T TIGR01855        77 KPVLGICLGMQLLFERSEEGGGEVPGLGLIKGKVVKLEARVSLSKLKVPHMGWNEVEPVKESCPLLKGIDKGAYFYFV--  154 (211)
T ss_pred             CCEEEEEHHHHHHHCCCCCCCCCCCCCEECCCEEEEECCCCCCCCCCCCCCCCCEEEEHHHCCCHHCCCCCCCCEEEE--
T ss_conf             968999802343001562437886653112761342056778872545756564231231155113077667815568--


Q ss_pred             ECCCHHHCCCCC-CCEEECCCCC-C-EEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             022011012444-2112323983-1-7889863500112465212221520257799875
Q gi|254780414|r  137 SHGDQVEHIPEG-FEVIASSDST-P-FAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       137 SH~D~V~~lP~g-f~viA~S~~~-~-iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                       |++++. +-++ =.++|+++.+ + .|+++  ..+++|+|||||-+| ..|.+||+||+
T Consensus       155 -HSY~~~-~~~~S~~v~a~~~YG~~F~AaV~--~~n~~G~QFHPEKS~-~~G~~lL~nf~  209 (211)
T TIGR01855       155 -HSYYAV-CEEESEAVLAKADYGEKFTAAVQ--KDNIFGTQFHPEKSG-KTGLKLLKNFL  209 (211)
T ss_pred             -EEEEEE-CCCCHHHEEEEHHCCCCEEEEEE--CCCEEEEEECCHHHH-HHHHHHHHHHH
T ss_conf             -866776-16881150112001863044665--487899972856888-89999999985


No 70 
>PRK13147 consensus
Probab=99.87  E-value=1.1e-20  Score=168.09  Aligned_cols=175  Identities=19%  Similarity=0.356  Sum_probs=116.4

Q ss_pred             EEEEEECCCCHHHHHHHHHHH----CCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC--CCCCCCC---HHHHH
Q ss_conf             699998897057889988886----59406985289898899723997999985-388-9999--9997537---68980
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRE----SKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD--IDSPQIP---KEILE   77 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRe----lgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d--~~ap~~~---~~I~~   77 (520)
                      ||.|+|+|+---+.+.|.++.    +|+.+++.- ....+++.  +.+.+||.| |.. ++..  .....++   ....+
T Consensus         2 kI~IIDyg~GNi~Sv~~al~~~~~~~gl~~~~~i-~~~~~~i~--~~d~lILPGVGsF~~~m~~L~~~~~l~~~i~~~~~   78 (211)
T PRK13147          2 RVVVIDYNGGNLASAARALEKAATRKGIDATVVI-SADPTDVR--NADRIVLPGQGAFADCAQGLAAIPGLRNAIETATA   78 (211)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEE-ECCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             8999937943699999999988753588843999-69999996--49978989866489999998863585999999997


Q ss_pred             CCCCEEEECHHHHHHHHH------------CCCEEEECCC-----CCCCEEEEEECCC-CCCCCCCCCCCCCEEEEEECC
Q ss_conf             899889977899998997------------0969998698-----6610366752388-622278726655336860022
Q gi|254780414|r   78 SNIPLLGICYGQQIMCQS------------LGGKTKNSQS-----REFGRAFIEIKKN-CSLLKGMWEKGSKQQVWMSHG  139 (520)
Q Consensus        78 ~~iPILGICyG~QlLa~~------------~GG~V~~~~~-----~EyG~~~I~i~~~-~~lf~gl~~~~~~~~VwmSH~  139 (520)
                      .+.|+||||+|||+|+..            +-|+|++.+.     +..||..+.+.++ .++++++.+...   ++..|+
T Consensus        79 ~~~piLGICLGMQlL~~~s~E~g~~~GLgli~G~v~kl~~~~~kvPhiGWn~i~~~~~~~~~~~~~~~~~~---fYFvHS  155 (211)
T PRK13147         79 AGTPFLGICVGMQLMAERGLEHERTPGFGWISGEIARMDAPGLRLPHMGWNTLDFTPGAHPLTDGLIPGDH---GYFVHS  155 (211)
T ss_pred             CCCCEEEECHHHHHHCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCEECEEEEECCCCCCHHHCCCCCCCE---EEEECC
T ss_conf             69987998367575216465379877400770289989876788876252688705786643247676886---999612


Q ss_pred             CHHHCCCCCCCEEECCCCC--CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             0110124442112323983--17889863500112465212221520257799875
Q gi|254780414|r  140 DQVEHIPEGFEVIASSDST--PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       140 D~V~~lP~gf~viA~S~~~--~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +++.. .+.-.++|.+..+  .+|+++  ..++||+|||||-+ ...|.++|+||+
T Consensus       156 Y~~~~-~~~~~~~~~~~yg~~~~s~v~--k~Ni~G~QFHPEKS-~~~Gl~ll~nFl  207 (211)
T PRK13147        156 YALRD-GADSDLVATTQYGGQVPAIVA--RGNRAGTQFHVEKS-QEVGLTILGNFL  207 (211)
T ss_pred             CCCCC-CCCCCEEEEEECCCEEEEEEE--ECCEEEEECCCHHC-CHHHHHHHHHHH
T ss_conf             34068-888768999989998999999--89999996880014-686899999986


No 71 
>TIGR01823 PabB-fungal para-aminobenzoate synthase; InterPro: IPR010117   This entry represents the fungal clade of para-aminobenzoate synthase, which acts on chorismate to form para-aminobenzoic acid (PABA), a precursor of folate..
Probab=99.86  E-value=8.1e-21  Score=168.99  Aligned_cols=193  Identities=20%  Similarity=0.277  Sum_probs=142.7

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHH---HCC-----CEEEEECCCCCH--HHHHHC--CCCEEEECCCCCCCCC-CCCCCCC
Q ss_conf             48869999889705788998888---659-----406985289898--899723--9979999853889999-9997537
Q gi|254780414|r    6 RSSKVLIIDFGSQFTQLIARRVR---ESK-----VYCEVIAFKNAL--DYFKEQ--NPQAIILSGSPASSLD-IDSPQIP   72 (520)
Q Consensus         6 ~~~~IlIlDfGSQytqLIaRriR---elg-----VyseI~P~~~~~--e~i~~~--~p~GIILSGGP~SV~d-~~ap~~~   72 (520)
                      ..-.||-||.=-.||-.+.|-|.   |..     |...++.+|..-  +.+.+.  ..++|++..||+..+. ...-.+.
T Consensus         4 ~rl~vL~ID~YDSftyNvv~lle~~~d~~PGvnav~V~tvhsD~~~sm~~l~e~l~~FdAiVvGPGPG~PN~GA~d~gI~   83 (851)
T TIGR01823         4 ARLQVLFIDAYDSFTYNVVALLEKALDVRPGVNAVSVITVHSDKFDSMDDLLELLLLFDAIVVGPGPGDPNVGAKDVGIL   83 (851)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             31441578701101689999999874158774468999970687235346888874178589888776776511444688


Q ss_pred             HHHHHCC------CCEEEECHHHHHHHHHCCCEEEECC-CCCCCEEEEEECCCCCCCCCCCC-CCCCEEEEEECCCHHHC
Q ss_conf             6898089------9889977899998997096999869-86610366752388622278726-65533686002201101
Q gi|254780414|r   73 KEILESN------IPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMWE-KGSKQQVWMSHGDQVEH  144 (520)
Q Consensus        73 ~~I~~~~------iPILGICyG~QlLa~~~GG~V~~~~-~~EyG~~~I~i~~~~~lf~gl~~-~~~~~~VwmSH~D~V~~  144 (520)
                      .++|+++      +||||||+|+|.||.+.|..|++.+ ...||+..--.+.+..+|+|+.+ .+.+..+-..|+.++..
T Consensus        84 ~~~w~l~~Gk~D~~Pv~GICLGFQslcL~qGa~i~rlpn~p~HGqV~~~~t~~~~if~g~~~GyPdtvk~trYHSLyan~  163 (851)
T TIGR01823        84 REVWELANGKLDEVPVLGICLGFQSLCLYQGADIERLPNLPLHGQVYEVKTSDAAIFEGVSSGYPDTVKSTRYHSLYANK  163 (851)
T ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHCCCCCCCCEEEEEEECCHHHHCCCCCCCCCCEEEEEEEEEEECC
T ss_conf             99997328953135511001568999985588235617886574378887401155524114788632244557887317


Q ss_pred             CCCCC------------------------CEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHH--HHHHHHHHHHHC
Q ss_conf             24442------------------------11232398-3178898635001124652122215202--577998755010
Q gi|254780414|r  145 IPEGF------------------------EVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGG--SQLIDNFVHHVA  197 (520)
Q Consensus       145 lP~gf------------------------~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G--~~iL~NFl~~Ic  197 (520)
                      .|.+-                        .+++.+++ ..+++++++++|+||||||||+..|+.|  .+|++||+ +++
T Consensus       164 ~~id~strGvdsGnPqadrfaskdldLL~~~l~ed~e~~i~Ms~~~~k~P~fGv~yHPESc~S~~~a~~kl~~nfl-~la  242 (851)
T TIGR01823       164 ESIDSSTRGVDSGNPQADRFASKDLDLLALILLEDEEDQILMSVKAKKKPIFGVQYHPESCKSEKEASVKLLKNFL-KLA  242 (851)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHHH-HHH
T ss_conf             8865332555678850123343236789988622688812200310588774565056433455457899999999-874


Q ss_pred             CC
Q ss_conf             64
Q gi|254780414|r  198 GI  199 (520)
Q Consensus       198 ~~  199 (520)
                      -.
T Consensus       243 ~~  244 (851)
T TIGR01823       243 LI  244 (851)
T ss_pred             HC
T ss_conf             01


No 72 
>PRK13172 consensus
Probab=99.86  E-value=2e-20  Score=166.13  Aligned_cols=175  Identities=21%  Similarity=0.341  Sum_probs=118.1

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCH---HHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985-388-9999-99975376---89808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPK---EILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~---~I~~~~iP   81 (520)
                      .+|.|+|+|+---+.+.|.++.+|+.+.+.   .+.+++.  +.+.|||.| |.. ++.+ -..-.++.   +..+.+.|
T Consensus         2 ~~I~IIDyG~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lIlPGVGsF~~~m~~L~~~~l~~~i~~~~~~~kp   76 (213)
T PRK13172          2 SSVSIVDYGVGNLLSVARAFQYFDASVNLV---STPEEIM--SADRLVLPGVGAFEDGMKGLTTLNFIEPIKQFARSGKP   76 (213)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHCCCC
T ss_conf             879999789429999999999869988997---7999983--38978976878469999988723863789998765995


Q ss_pred             EEEECHHHHHHHHH------------CCCEEEECCC----------CCCCEEEEEECCCC-----CCCCCCCCCCCCEEE
Q ss_conf             89977899998997------------0969998698----------66103667523886-----222787266553368
Q gi|254780414|r   82 LLGICYGQQIMCQS------------LGGKTKNSQS----------REFGRAFIEIKKNC-----SLLKGMWEKGSKQQV  134 (520)
Q Consensus        82 ILGICyG~QlLa~~------------~GG~V~~~~~----------~EyG~~~I~i~~~~-----~lf~gl~~~~~~~~V  134 (520)
                      +||||+|||+|...            +.|+|.+.+.          +.-||..+...+.+     ++|+++.....   +
T Consensus        77 iLGICLGmQlLf~~s~E~g~~~GLgli~G~v~kl~~~~~~~~~~kvPh~GWn~i~~~~~~~~~~~~l~~~~~~~~~---f  153 (213)
T PRK13172         77 FLGICLGMQMMLSKSTEFGQHEGLGLIAGEVVSVPSHGVDGQLHKIPHIGWNELVSTSEGEDWCHTILKNIPLNSS---V  153 (213)
T ss_pred             EEEEEHHHHHHHHCCCCCCCCCCCCEECCEEEECCCCCCCCCCCCCCEECHHHEECCCCCCCCCCHHHCCCCCCCE---E
T ss_conf             7998576662653864687647665755259877755666645627620144533245543334366618977861---7


Q ss_pred             EEECCCHHHCCCCCCCEEECCCC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             60022011012444211232398--317889863500112465212221520257799875
Q gi|254780414|r  135 WMSHGDQVEHIPEGFEVIASSDS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       135 wmSH~D~V~~lP~gf~viA~S~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +..|++.+.. .+.-.++|.+..  -.+.|+- ...++||+|||||-+ ...|.++|+||+
T Consensus       154 YFvHSY~~~~-~~~~~~~a~~~y~g~~~~a~i-~~~Ni~G~QFHPEKS-~~~Gl~lL~nFl  211 (213)
T PRK13172        154 YFVHSFMAMP-SNPKKRLADTLYDGQAISAVI-KDENMYGCQFHPEKS-GEVGLSIIQQFL  211 (213)
T ss_pred             EEEEEEEEEC-CCCCCEEEEEEECCEEEEEEE-ECCCEEEEECCHHHC-CHHHHHHHHHHH
T ss_conf             9998778853-888738999998999999999-889999980880223-686999999997


No 73 
>pfam02540 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is involved in the de novo synthesis of NAD and is induced by stress factors such as heat shock and glucose limitation.
Probab=99.85  E-value=4.2e-20  Score=163.88  Aligned_cols=173  Identities=21%  Similarity=0.298  Sum_probs=127.8

Q ss_pred             HHHHHHHHHHHH---CCCCEEEEECCCCHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             999999997650---4440366405640477999999862236-569999738955156278999988623698579975
Q gi|254780414|r  209 HKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIGI-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD  284 (520)
Q Consensus       209 ~~~~i~~Ir~~v---g~~kVi~~lSGGVDStV~A~Ll~kAig~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vd  284 (520)
                      ++..++-||+.+   |-++|++||||||||+|+|+|+++|+|. |+++++ ........++.+--+.+.+.+|++...+|
T Consensus         2 i~~i~~~l~dyv~k~g~~gvViGlSGGIDSav~a~La~~AlG~~~v~~v~-mP~~~ss~~s~~~A~~la~~lgi~~~~i~   80 (243)
T pfam02540         2 IERLVDFLRDYVQKSGAKGVVLGLSGGIDSAVVAYLAVKALGKENVLALI-MPSINSSEEDVQDALALAENLGINYKTID   80 (243)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEE-CCCCCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             67999999999998199919997888799999999999955974289996-47778988899999999999689269998


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             88999999668988899998875658999999997439-97099864622024542024677763034430232011320
Q gi|254780414|r  285 ASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIG-GAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM  363 (520)
Q Consensus       285 a~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~-~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~  363 (520)
                      -++.| +++....+|+..+...||..-++..-..-.+- ...+|..||-.                 ||...+|-..+.=
T Consensus        81 I~~~~-~~~~~~~~~~~~~~a~~Ni~aR~Rm~~ly~~A~~~~~lVlgT~N-----------------ksE~~~Gy~TkyG  142 (243)
T pfam02540        81 IKPIV-RAFSQLFQPAKDDLAKGNLKARIRMIILYAHANKFNRLVLGTGN-----------------KSELALGYFTKYG  142 (243)
T ss_pred             CHHHH-HHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC-----------------CCCEEEEEEEECC
T ss_conf             88999-99998853201377874557888899999862337918981687-----------------0420054323127


Q ss_pred             C-CCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             3-202237898738999999998199988942688898
Q gi|254780414|r  364 D-MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       364 ~-~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                      . .-=+.||.+|||.|||+|++.||+|++++.|.|=||
T Consensus       143 D~~~di~Pi~dL~KteV~~la~~l~vP~~ii~k~Psa~  180 (243)
T pfam02540       143 DGACDIAPIGDLYKTQVYELAKRLNVPERIIKKPPSAD  180 (243)
T ss_pred             CCCCCHHHHCCCCHHHHHHHHHHHCCCHHHHHCCCCCC
T ss_conf             77655154168818999999999498888983799988


No 74 
>PRK13151 consensus
Probab=99.85  E-value=2e-20  Score=166.13  Aligned_cols=172  Identities=24%  Similarity=0.400  Sum_probs=117.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHHHCCCCEEEE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-9999-99975376898089988997
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~~~~iPILGI   85 (520)
                      ||.|+|+|+---..+.|.++.+|+.++|.   .+.+++.  +.++|||.| |.. ++.. -..-.+...+.+.+.|+|||
T Consensus         2 kI~IiDyg~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lIlPGVGsf~~~m~~L~~~~l~~~i~~~~kpiLGI   76 (195)
T PRK13151          2 KIIIIDTACANLASLKFCLDRLGFNATIS---RDLKELE--SADKLFLPGVGTAKEAMKNLEQFNLIDFIQNTKKPLLGI   76 (195)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHCCCCEEEE
T ss_conf             89999479609999999999859987996---7999994--489699888899999999998747788898639966887


Q ss_pred             CHHHHHHHHH-----------CCCEEEECCC------CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCC
Q ss_conf             7899998997-----------0969998698------6610366752388622278726655336860022011012444
Q gi|254780414|r   86 CYGQQIMCQS-----------LGGKTKNSQS------REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEG  148 (520)
Q Consensus        86 CyG~QlLa~~-----------~GG~V~~~~~------~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~g  148 (520)
                      |+|||+|...           +.|.|++.+.      +.-||.++.  .++.+|+++. ..   .++.-|++++.  +++
T Consensus        77 CLGMQlL~~~seE~~~~gLgli~g~v~k~~~~~~~~vPhiGWn~v~--~~~~l~~~i~-~~---~fYFvHSY~~~--~~~  148 (195)
T PRK13151         77 CLGMQILGNFSEELNQETLKLIDFTTQKFKAKEGFTFPHMGWNQVH--SSHALFKGLE-GA---YFYFVHSYCVG--LGE  148 (195)
T ss_pred             EEEEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCCCCEEEHHHCC--CCCHHHCCCC-CC---EEEEEEEEECC--CCC
T ss_conf             7647876514757675762642026888646557888674112256--6770121666-76---27887304526--765


Q ss_pred             CCEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHH
Q ss_conf             211232398-317889863500112465212221520257799875501
Q gi|254780414|r  149 FEVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHV  196 (520)
Q Consensus       149 f~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~I  196 (520)
                      + .+|.++. ..+.|+-. ..++||+|||||-+ .+.|.++|+||+.+|
T Consensus       149 ~-~ia~~~y~~~f~a~v~-k~Ni~G~QFHPEKS-~~~Gl~lL~nFlk~i  194 (195)
T PRK13151        149 Y-TIADCEYSQKFSASVM-KDNFYGVQFHPERS-SEAGEILISNFIKDI  194 (195)
T ss_pred             C-EEEEEECCCEEEEEEE-ECCEEEEECCCHHC-CHHHHHHHHHHHHHC
T ss_conf             6-3789737988999999-19999992880030-587999999998752


No 75 
>PRK13144 consensus
Probab=99.85  E-value=1.5e-20  Score=167.19  Aligned_cols=166  Identities=20%  Similarity=0.315  Sum_probs=113.4

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCC---CCCCHHHHHCCCCEEEE
Q ss_conf             699998897057889988886594069852898988997239979999853889999999---75376898089988997
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS---PQIPKEILESNIPLLGI   85 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~a---p~~~~~I~~~~iPILGI   85 (520)
                      ||.|||||.---+.+.+.++.+|..+.|.   .+.+++..  .+++||.| ..|- +...   -.+...+  .+.|+|||
T Consensus         2 kI~IiDyg~GNi~Sv~~al~~~g~~~~i~---~~~~~i~~--~d~lIlPG-VGsf-~~a~~~~~~~~~~i--~~kpiLGI   72 (190)
T PRK13144          2 RVGVVDYTVGNIGSVLAALKRAGAEPVVV---KEPEEANR--VDALVLPG-VGTY-EAAYALARSFKEVI--LEKPTLAI   72 (190)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEE---CCHHHHHH--CCEEEECC-CCCH-HHHHHHHHHHHHHH--HCCCEEEE
T ss_conf             89999279368999999999849986997---89999954--89789748-8859-99999999999997--47984898


Q ss_pred             CHHHHHHHHHC-----------CCEEEECCC---CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             78999989970-----------969998698---6610366752388622278726655336860022011012444211
Q gi|254780414|r   86 CYGQQIMCQSL-----------GGKTKNSQS---REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        86 CyG~QlLa~~~-----------GG~V~~~~~---~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
                      |+|||+|....           -|+|++-+.   +.-||..+...+.+++++.    .   ..+.-|++.+. ..+...+
T Consensus        73 ClGmQlL~~~seE~~~~GLgli~G~v~kl~~~kvPh~GWn~v~~~~~~~~~~~----~---~fYFvHSY~~~-~~~~~~~  144 (190)
T PRK13144         73 CLGMQLLFESSEEGGGRGLGIFRGRVERIKARKVPHIGWSYTRVVKPLPFVEE----G---YYYYLHSYGVR-WDEDEAH  144 (190)
T ss_pred             EHHHHHHHCCCCCCCCCCEEEEEEEEEECCCCCCCEECCCEEECCCCCCCCCC----C---EEEEEEEEEEC-CCCCCCE
T ss_conf             76588664456334787630797699987888887636600034678876445----5---59999988722-6887648


Q ss_pred             EECCCC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             232398--3178898635001124652122215202577998755
Q gi|254780414|r  152 IASSDS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       152 iA~S~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      +|.++.  ..+++++  ..++||+|||||-+ .+.|.++|+||+-
T Consensus       145 ~~~~~~g~~~~s~v~--~~Ni~G~QFHPEKS-~~~Gl~lLknFl~  186 (190)
T PRK13144        145 VAYVELGRRYVAAVE--KGHILGVQFHPERS-GRAGLELIRRFLA  186 (190)
T ss_pred             EEEEECCCEEEEEEE--ECCEEEEECCCHHC-CHHHHHHHHHHHH
T ss_conf             999975997899999--59899997880021-5868999999999


No 76 
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional
Probab=99.80  E-value=1.1e-18  Score=153.69  Aligned_cols=173  Identities=20%  Similarity=0.362  Sum_probs=111.5

Q ss_pred             EEEEEECCCCHH---HHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC--CCCCCC---HHHHHCCC
Q ss_conf             699998897057---8899888865940698528989889972399799998538899999--997537---68980899
Q gi|254780414|r    9 KVLIIDFGSQFT---QLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI--DSPQIP---KEILESNI   80 (520)
Q Consensus         9 ~IlIlDfGSQyt---qLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~--~ap~~~---~~I~~~~i   80 (520)
                      +|=||.+=.-+.   +.+.|.++.+|+.+|+..-. +.+++.  +.+++||.||..+..-.  ....+.   ++..+.++
T Consensus         2 ~igvlalqG~~~~hi~sl~kAl~~lg~~~e~~~v~-~p~~l~--~~d~LILPGG~f~~~m~~L~~~gl~~~i~~~i~~g~   78 (196)
T PRK13527          2 KIGVLALQGDVEEHIDALKRALDELGINGEVVRVR-RPEDLK--DCDALIIPGGESTTIGRLMKRYGILDEIKEKIEEGL   78 (196)
T ss_pred             EEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEC-CHHHHH--CCCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCC
T ss_conf             59999724799999999999999829990599969-989983--199799899667999999888688899999997699


Q ss_pred             CEEEECHHHHHHHHHCC------------CEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCC
Q ss_conf             88997789999899709------------699986986610366752388622278726655336860022011012444
Q gi|254780414|r   81 PLLGICYGQQIMCQSLG------------GKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEG  148 (520)
Q Consensus        81 PILGICyG~QlLa~~~G------------G~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~g  148 (520)
                      |+||||+|||+|+....            |+|.+..   ||+..-.. .....+.++   ......|..|++++.+.++.
T Consensus        79 PiLGIClGmQLL~~~s~e~~~~~GLG~i~g~V~rn~---~g~q~~s~-~~~~~~~~~---~~~~~~yFVhs~~~~~~~~~  151 (196)
T PRK13527         79 PILGTCAGLILLAKEVDDEVVQPLLGLMDVTVNRNA---FGRQRDSF-EAELDLEGL---DGPFHAVFIRAPAIDEAGGD  151 (196)
T ss_pred             CEEEECHHHHHHHHHCCCCCCCCCCCCCCEEEEECC---CCCCCCCC-CCCEEECCC---CCCEEEEEEEEEEEECCCCC
T ss_conf             779970879998663156777677675754899657---88745555-166441478---99968999974235027998


Q ss_pred             CCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             2112323983178898635001124652122215202577998755010
Q gi|254780414|r  149 FEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       149 f~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                      .+++|++++.+ +|++.  .|+||+|||||.+..   ..+++||+-.+.
T Consensus       152 ~~v~a~~~~~~-~aV~k--~Ni~g~QFHPEkSgd---~~i~~~Fl~~v~  194 (196)
T PRK13527        152 VEVLAKLDDRI-VAVEQ--GNVLATAFHPELTDD---TRIHEYFLKKVV  194 (196)
T ss_pred             EEEEEEECCEE-EEEEE--CCEEEEECCCCCCCC---CHHHHHHHHHHC
T ss_conf             79999979999-99998--999999559722387---559999999971


No 77 
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional
Probab=99.80  E-value=8.7e-19  Score=154.49  Aligned_cols=170  Identities=16%  Similarity=0.300  Sum_probs=112.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC--CCCCCCH---HHHHCCCCE
Q ss_conf             86999988970578899888865940698528989889972399799998538899999--9975376---898089988
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI--DSPQIPK---EILESNIPL   82 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~--~ap~~~~---~I~~~~iPI   82 (520)
                      -||-|||+...+ +...|.++.+|+.+.+.   .+.+++..  .+++||.||-++....  ....+..   +..+.+.|+
T Consensus         2 ~~IGvl~~qGn~-rs~~~aL~~lG~~~~~v---~~~~di~~--ad~lILPGG~s~am~~ll~~~gl~~~i~~~i~~gkP~   75 (191)
T PRK13525          2 MKIGVLALQGAV-REHIAALEALGAEAVEV---RRPEDLDE--IDGLILPGGESTTMGKLLRDFGLLEPLREFIASGLPV   75 (191)
T ss_pred             CEEEEEECCCCH-HHHHHHHHHCCCCEEEE---CCHHHHHH--CCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCCCE
T ss_conf             379999647889-99999999879978998---99999953--9989978976589999999868689999999849985


Q ss_pred             EEECHHHHHHHHHC-----------CCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             99778999989970-----------9699986986610366752388622278726655336860022011012444211
Q gi|254780414|r   83 LGICYGQQIMCQSL-----------GGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        83 LGICyG~QlLa~~~-----------GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
                      ||||+|||+|+...           -|+|.+..   ||+. +.....+..+.++.   ....++.-|+.++...+++..+
T Consensus        76 LGIClGmqLL~~~~E~~~~~gLGli~g~V~Rn~---~grq-~~s~~~~~~~~~~~---~~~~~yFvhsp~~~~~~~~~~~  148 (191)
T PRK13525         76 FGTCAGMILLAKEIEGPEQEHLGLLDITVRRNA---FGRQ-VDSFEAELDIKGLG---DPFPAVFIRAPYIERVGPGVEV  148 (191)
T ss_pred             EEECHHHHEEEECCCCCCCCCCCCCCCEEEECC---CCCC-CCCCCCCCCCCCCC---CCCCEEEEECCEEEECCCCCEE
T ss_conf             762221211120233589777677883786346---4751-44442676366889---9845899708888044999489


Q ss_pred             EECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             2323983178898635001124652122215202577998755010
Q gi|254780414|r  152 IASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       152 iA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                      +|...+.++ |++  ..|+||+|||||.+.   +..|++||+ +++
T Consensus       149 ~a~~g~~~v-aV~--~~Nv~g~QFHPEkSg---~~~i~~~Fl-~~v  187 (191)
T PRK13525        149 LARVGGRIV-AVR--QGNILATSFHPELTD---DRRVHRYFL-DMV  187 (191)
T ss_pred             EEEECCEEE-EEE--ECCEEEEEECCCCCC---CCHHHHHHH-HHH
T ss_conf             999899999-999--899999980993059---837999999-999


No 78 
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional
Probab=99.77  E-value=5.1e-18  Score=149.02  Aligned_cols=166  Identities=22%  Similarity=0.375  Sum_probs=106.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC-CCC-CCCC-CCCCCCCHHHHH-CCCCEEE
Q ss_conf             69999889705788998888659406985289898899723997999985-388-9999-999753768980-8998899
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG-SPA-SSLD-IDSPQIPKEILE-SNIPLLG   84 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG-GP~-SV~d-~~ap~~~~~I~~-~~iPILG   84 (520)
                      .|.|+|||+---+.+.|.++.+|+.+.|.   .+.+++.  +.+.+||.| |.. ++.+ -..-.++..+.+ .+.|+||
T Consensus         1 MI~IIDyG~GNi~Sv~~al~~lg~~~~i~---~~~~~i~--~~d~lILPGVGsF~~am~~L~~~~l~~~i~~~~~kpiLG   75 (192)
T PRK13142          1 MIVIVDYGLGNISNVKRAIEHLGYEVVVS---NTSKIID--QAETIILPGVGHFKDAMSEIKRLNLNAILAKNTDKKMIG   75 (192)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHCCCCEEE
T ss_conf             98999769458999999999859987996---8999984--379589757687899999988758599999862898589


Q ss_pred             ECHHHHHHHHH-----------CCCEEEECCC----CCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCC
Q ss_conf             77899998997-----------0969998698----66103667523886222787266553368600220110124442
Q gi|254780414|r   85 ICYGQQIMCQS-----------LGGKTKNSQS----REFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGF  149 (520)
Q Consensus        85 ICyG~QlLa~~-----------~GG~V~~~~~----~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf  149 (520)
                      ||+|||+|...           +-|+|.+-+.    +.-||.++..  ..+++.        ..++.-|++.+.   ..-
T Consensus        76 ICLGMQlL~~~SeEg~~~GLgli~G~V~kl~~~~~vPhmGWn~v~~--~~~~~~--------~~fYFvHSY~~~---~~~  142 (192)
T PRK13142         76 ICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVS--KHPMLN--------QDVYFVHSYQAP---MSE  142 (192)
T ss_pred             EECCEEEEECCCCCCCCCCCCEEEEEEEEECCCCCCCEECCHHHCC--CCCCCC--------CCEEEEEEEECC---CCC
T ss_conf             6501014311455567677577868999836899786658156253--385423--------644799876527---875


Q ss_pred             CEEECCCC-CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHH
Q ss_conf             11232398-3178898635001124652122215202577998755
Q gi|254780414|r  150 EVIASSDS-TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVH  194 (520)
Q Consensus       150 ~viA~S~~-~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~  194 (520)
                      .++|.|+. ..+.|+-. ..++||+|||||-+ ...|.++|+||+.
T Consensus       143 ~~~a~t~yg~~f~s~v~-~~Ni~G~QFHPEKS-~~~Gl~lLknFl~  186 (192)
T PRK13142        143 NVIAYAQYGADIPAIVQ-FNNYIGIQFHPEKS-GTYGLQILRQAIQ  186 (192)
T ss_pred             CEEEEEECCCEEEEEEE-ECCEEEEECCHHHC-CHHHHHHHHHHHC
T ss_conf             78999988996999999-59999995881235-5858999999963


No 79 
>KOG3179 consensus
Probab=99.76  E-value=4.6e-18  Score=149.35  Aligned_cols=159  Identities=24%  Similarity=0.358  Sum_probs=108.3

Q ss_pred             CCCCHHHHHHHHHHHCCCEE---EEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH------HHHHCCCCEEEE
Q ss_conf             89705788998888659406---985289898899723997999985388999999975376------898089988997
Q gi|254780414|r   15 FGSQFTQLIARRVRESKVYC---EVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPK------EILESNIPLLGI   85 (520)
Q Consensus        15 fGSQytqLIaRriRelgVys---eI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~------~I~~~~iPILGI   85 (520)
                      ||. |.-.-..-+-+-|.--   +++..+-|-++ +..++.|+++||++.+.++ +++|+.+      ++...++|||||
T Consensus        23 yGg-y~nvfvsllg~ege~wd~frV~~gefP~~~-Dl~ky~gfvIsGS~~dAf~-d~dWI~KLcs~~kkld~mkkkvlGI   99 (245)
T KOG3179          23 YGG-YFNVFVSLLGDEGEQWDLFRVIDGEFPQEE-DLEKYDGFVISGSKHDAFS-DADWIKKLCSFVKKLDFMKKKVLGI   99 (245)
T ss_pred             HCC-HHHHHHHHHCCCCCEEEEEEEECCCCCCHH-HHHHHCEEEEECCCCCCCC-CCHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             157-999999986135721578998548788744-6534154999577433335-4069999999999987515664788


Q ss_pred             CHHHHHHHHHCCCEEEECCCC-CCCEEEEEECC----CCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCCCCE
Q ss_conf             789999899709699986986-61036675238----8622278726655336860022011012444211232398317
Q gi|254780414|r   86 CYGQQIMCQSLGGKTKNSQSR-EFGRAFIEIKK----NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPF  160 (520)
Q Consensus        86 CyG~QlLa~~~GG~V~~~~~~-EyG~~~I~i~~----~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~i  160 (520)
                      |+|||+||.+.||+|.+++++ +.|-..+.+.+    ....|..++..-+-..+   |.|.|.++|++++++|+|++|.+
T Consensus       100 CFGHQiiara~Gg~Vgra~KG~~~~lg~itivk~~~~~~~yFG~~~~~l~Iikc---HqDevle~PE~a~llasSe~cev  176 (245)
T KOG3179         100 CFGHQIIARAKGGKVGRAPKGPDLGLGSITIVKDAEKPEKYFGEIPKSLNIIKC---HQDEVLELPEGAELLASSEKCEV  176 (245)
T ss_pred             ECCHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCHHHCCCCHHHHHHHHH---CCCCEECCCCHHHHHCCCCCCCE
T ss_conf             211799988617811027888744434238998524616432643444218765---31014337744543000011525


Q ss_pred             EEEEECCCCEEEEEEEEHHH
Q ss_conf             88986350011246521222
Q gi|254780414|r  161 AFIADEKRKYYAVQFHPEVV  180 (520)
Q Consensus       161 aai~~~~~~iyGVQFHPEV~  180 (520)
                      +.+...+ +++++|-|||-.
T Consensus       177 e~fs~~~-~~l~fQGHPEyn  195 (245)
T KOG3179         177 EMFSIED-HLLCFQGHPEYN  195 (245)
T ss_pred             EEEEECC-EEEEECCCCHHH
T ss_conf             7898345-379962882343


No 80 
>pfam01174 SNO SNO glutamine amidotransferase family. This family and its amidotransferase domain was first described in. It is predicted that members of this family are involved in the pyridoxine biosynthetic pathway, based on the proximity and co-regulation of the corresponding genes and physical interaction between the members of pfam01174 and pfam01680.
Probab=99.73  E-value=2.7e-17  Score=143.85  Aligned_cols=157  Identities=17%  Similarity=0.265  Sum_probs=94.3

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC--CCCC----CCHHHHHCCCCEEEECHHHHHHHH
Q ss_conf             8899888865940698528989889972399799998538899999--9975----376898089988997789999899
Q gi|254780414|r   21 QLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI--DSPQ----IPKEILESNIPLLGICYGQQIMCQ   94 (520)
Q Consensus        21 qLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~--~ap~----~~~~I~~~~iPILGICyG~QlLa~   94 (520)
                      +...|.++.+|+..+++   .+.+++..  .+++||.||-+.....  ....    +...+.+.++|+||||+|||+|+.
T Consensus         9 ~sv~nal~~lG~e~~~v---~~p~di~~--ad~LILPGg~s~~~~~ll~~~gl~~~l~e~i~~~~kPiLGIClGMqLL~~   83 (188)
T pfam01174         9 EEHEEAIKKCGAENKTV---KRPEDLAQ--CDALIIPGGESTAMSLLAKRYGFYEPLYEFVHNPNKPIWGTCAGLILLSK   83 (188)
T ss_pred             HHHHHHHHHCCCCEEEE---CCHHHHHC--CCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCEEEHHHHHHHHHC
T ss_conf             99999999869987996---89999940--89899889887999999998688899999998079966333144642110


Q ss_pred             HCC-----------CEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECC-CCCCEEE
Q ss_conf             709-----------6999869866103667523886222787266553368600220110124442112323-9831788
Q gi|254780414|r   95 SLG-----------GKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASS-DSTPFAF  162 (520)
Q Consensus        95 ~~G-----------G~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S-~~~~iaa  162 (520)
                      ...           |+|++..   +|+.. .....+..|.++......+.   -|+.++...++.-.+.+.+ -+..+++
T Consensus        84 ~~e~g~~~gLGli~~~V~r~~---~g~~~-~~~~~~~~~~~~~~~~~~yF---vhs~~~~~~~~~~~v~~~~~~~~~~v~  156 (188)
T pfam01174        84 QLGNELVKTLGLLKVTVKRNA---FGRQV-DSFEKECDFKNLIPKFPGVF---IRAPVIEEILDPEVVVVLYELDGKIVV  156 (188)
T ss_pred             CCCCCCCCCCCCCCEEEEECC---CCCCC-CCCCCCCCCCCCCCCCEEEE---EECCEECCCCCCCEEEEEEECCCEEEE
T ss_conf             247786442465322687657---67546-55447863326899943999---817745104998529999957999999


Q ss_pred             EEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             9863500112465212221520257799875
Q gi|254780414|r  163 IADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       163 i~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      ++  ..++||+|||||-+.  ++..+.++|+
T Consensus       157 v~--~~Ni~g~QFHPEKS~--d~~~~~~~fl  183 (188)
T pfam01174       157 AK--QGNILATSFHPELAE--DDYRVHDWFV  183 (188)
T ss_pred             EE--ECCEEEEECCCEECC--CCCHHHHHHH
T ss_conf             99--899999951984579--9788999999


No 81 
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD+ occurs via an NAD-adenylate intermediate and requires ATP and Mg2+. The intemediate is subsequently cleaved into NAD+ and AMP. In many prokaryotes, such as E. coli , NAD synthetase consists of a single domain and is strictly ammonia dependent. In contrast, eukaryotes and other prokaryotes have an additional N-terminal amidohydrolase domain that prefer glutamine, Interestingly, NAD+ synthases in these prokaryotes, can also utilize ammonia as an amide source .
Probab=99.70  E-value=8.3e-16  Score=133.20  Aligned_cols=187  Identities=21%  Similarity=0.310  Sum_probs=130.0

Q ss_pred             CHHHHHHHHHHHHHHH---CCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCE
Q ss_conf             0678999999997650---444036640564047799999986223-656999973895515627899998862369857
Q gi|254780414|r  205 MSSYHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPL  280 (520)
Q Consensus       205 ~~~~~~~~i~~Ir~~v---g~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l  280 (520)
                      ++...+..+.-||+.+   |-++|++|||||+||+|+|+|..+|+| ++++|++...+.-.....+....+ .+.+|++.
T Consensus         3 ~~~~~~~lv~~l~~y~~~~g~~~~viGlSGGIDSav~a~La~~Alg~~~v~~v~mP~~~ss~~s~~~A~~l-a~~lgi~~   81 (248)
T cd00553           3 LEEIINALVLFLRDYLRKSGFKGVVLGLSGGIDSALVAALAVRALGRENVLALFMPSRYSSEETREDAKEL-AEALGIEH   81 (248)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHH-HHHHCCCE
T ss_conf             89999999999999999819991999588889999999999997288759998899978987589999999-99958916


Q ss_pred             EEEEHHH---HHHHHHCCCCCHHHHHHHHHHHHHHHH----HHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEE
Q ss_conf             9975889---999996689888999988756589999----999974399709986462202454202467776303443
Q gi|254780414|r  281 RVVDASE---RFIRKLKNIVDPETKRKVIGQLFIEVF----EEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSH  353 (520)
Q Consensus       281 ~~vda~~---~Fl~~L~gv~DPE~KRkiIG~~Fi~vf----~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsH  353 (520)
                      ..+|-+.   .|.+.+....+++......||.=-++-    ...|++   ..+|+-||-  +.-|...+.       -|.
T Consensus        82 ~~i~I~~~~~~~~~~~~~~~~~~~~~~~~~NiqaRlRm~~Ly~~An~---~~~lVlgTg--NksE~~~Gy-------~Tk  149 (248)
T cd00553          82 VNIDIDPAVEAFLALLGESGGSELEDLALGNIQARLRMVILYALANK---LGGLVLGTG--NKSELLLGY-------FTK  149 (248)
T ss_pred             EEECHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH---CCCEEECCC--CHHHHHHCC-------CEE
T ss_conf             87155999999999864404870556787424878889999999974---499896287--460787572-------100


Q ss_pred             ECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHH
Q ss_conf             023201132032022378987389999999981999889426888983111221000367899
Q gi|254780414|r  354 HNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI  416 (520)
Q Consensus       354 HNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~  416 (520)
                      +-.+      . -=+.|+.+|||.|||+|++.||+|++++.|.|=|+  |.-   |--.++-+
T Consensus       150 yGD~------~-~d~~Pi~~L~Kt~V~~la~~l~vp~~Ii~k~PSae--L~~---~Q~DE~~l  200 (248)
T cd00553         150 YGDG------A-ADINPIGDLYKTQVRELARYLGVPESIIDKPPSAE--LWP---GQTDEDEL  200 (248)
T ss_pred             CCCC------C-CCCCCCCCCCHHHHHHHHHHHCCHHHHHCCCCCCC--CCC---CCCCHHHC
T ss_conf             0787------7-58221368849999999999688898734799966--679---99898775


No 82 
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis. Glutamine amidotransferase (GATase) activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  This group contains proteins like Bacillus subtilus YaaE  and Plasmodium falciparum Pdx2 which are members of the triad glutamine aminotransferase family and function in a pathway for the biosynthesis of vitamin B6.
Probab=99.69  E-value=3.2e-16  Score=136.20  Aligned_cols=164  Identities=15%  Similarity=0.318  Sum_probs=97.3

Q ss_pred             EEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC--CCCCCCHH---HHHCCCCEEEEC
Q ss_conf             9988970578899888865940698528989889972399799998538899999--99753768---980899889977
Q gi|254780414|r   12 IIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI--DSPQIPKE---ILESNIPLLGIC   86 (520)
Q Consensus        12 IlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~--~ap~~~~~---I~~~~iPILGIC   86 (520)
                      ||+.-.-+ +...|.++.+|+.+.+.   .+.+++.  +.+++||.||-+.....  ....+...   ..+.+.|+||||
T Consensus         3 vl~lqGn~-~s~~~Al~~lG~~~~~~---~~p~~i~--~ad~LILPGg~s~~~~~~L~~~gl~~~i~~~i~~gkP~LGIC   76 (183)
T cd01749           3 VLALQGDF-REHIRALERLGVEVIEV---RTPEDLE--GIDGLIIPGGESTTIGKLLRRTGLLDPLREFIRAGKPVFGTC   76 (183)
T ss_pred             EEEECCCH-HHHHHHHHHCCCCEEEE---CCHHHHH--HCCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCCCEEEHH
T ss_conf             99834789-99999999879979998---9999983--189899889408999999988788899999998499847510


Q ss_pred             HHHHHHHHHC------------CCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEEC
Q ss_conf             8999989970------------9699986986610366752388622278726655336860022011012444211232
Q gi|254780414|r   87 YGQQIMCQSL------------GGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIAS  154 (520)
Q Consensus        87 yG~QlLa~~~------------GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~  154 (520)
                      +|||+|+..-            .|+|.|..   +|+..-... ....+.++.  .+.+..+..|+.++.+..+...+++.
T Consensus        77 lGMQlL~~~s~E~g~~~GLGli~g~V~rn~---~g~q~~sf~-~~l~ip~~g--~n~~~~~Fv~sp~~~~~~~~~~~~~~  150 (183)
T cd01749          77 AGLILLAKEVEDQGGQPLLGLLDITVRRNA---FGRQVDSFE-ADLDIPGLG--LGPFPAVFIRAPVIEEVGPGVEVLAE  150 (183)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCEEEECCC---CCCCCCCCC-CCCCCCCCC--CCCCCEEEECCCEEEECCCCEEEEEE
T ss_conf             778887652346788676365551996356---367666552-575278678--88766699448646005998099999


Q ss_pred             CCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             398317889863500112465212221520257799875
Q gi|254780414|r  155 SDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       155 S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .++. ++|++  ..|+||+|||||-+.   +..|++|||
T Consensus       151 ~~~~-~~aV~--~~Ni~g~QFHPEKSg---d~~i~~~fl  183 (183)
T cd01749         151 YDGK-IVAVR--QGNVLATSFHPELTD---DTRIHEYFL  183 (183)
T ss_pred             ECCE-EEEEE--ECCEEEEECCCCCCC---CCCHHHHHC
T ss_conf             8999-99999--899999947980159---864888639


No 83 
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed
Probab=99.66  E-value=1.5e-15  Score=131.34  Aligned_cols=162  Identities=27%  Similarity=0.367  Sum_probs=112.9

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC--------CHHHHHHHHHHCCCCCEEEEEHHHHHHH-
Q ss_conf             4440366405640477999999862236569999738955156--------2789999886236985799758899999-
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKN--------EVENIISLFKGYPNFPLRVVDASERFIR-  291 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRkn--------E~~~v~~~~~~~~~~~l~~vda~~~Fl~-  291 (520)
                      .++||++|+||||||||+|+||.++ |-.++++|.-+---..+        +.+..... .+++|+++.++|.++.|-+ 
T Consensus         3 sk~rV~VamSGGVDSsVaA~LL~~~-Gy~V~Gv~m~~w~~~~~~~~C~~~~d~~dA~~v-a~~LgIp~~v~d~~~~f~~~   80 (355)
T PRK00143          3 SKKRVVVGMSGGVDSSVAAALLKEQ-GYDVIGLFMKLWDDDDGSGGCCAEEDIADARAV-ADKLGIPLYVVDFAKEFWDN   80 (355)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHH-HHHCCCCEEEECHHHHHHHH
T ss_conf             8888999916789999999999977-995899999887688777899857889999999-99869857996869987678


Q ss_pred             --------HHCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCCCCEEEEECCCCCHHHHHHCCC--CCCCCEEEEEEC-CC
Q ss_conf             --------966898-8899998875658999--999997439970998646220245420246--777630344302-32
Q gi|254780414|r  292 --------KLKNIV-DPETKRKVIGQLFIEV--FEEEAKKIGGAQFLGQGTLYPDVIESISFF--GGPSSIIKSHHN-VG  357 (520)
Q Consensus       292 --------~L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~~~~~L~QGTlypDvIES~~~~--~~~~~~IKsHHN-vg  357 (520)
                              -++|.| .|-    |..|.+|+.  |-+.|+++ +++|+|-|. |.-+.+..+..  ....+.-|-+-= .-
T Consensus        81 Vi~~f~~~Y~~G~TPNPc----v~CN~~IKFg~l~~~A~~l-gad~iATGH-YAri~~~~~~~~L~r~~D~~KDQSYfL~  154 (355)
T PRK00143         81 VFDYFLDEYKAGRTPNPC----VLCNKEIKFKAFLDYALEL-GADYIATGH-YARIRDEDGRYELLRAVDPNKDQSYFLY  154 (355)
T ss_pred             HHHHHHHHHHCCCCCCCC----HHCCCCCCHHHHHHHHHHC-CCCEECCCC-EEEEEECCCEEEEEECCCCCCCCEEEEE
T ss_conf             899999999769999973----3408723399999999873-998423352-5999915981899867889887205761


Q ss_pred             CHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             011320320223789873899999999819998
Q gi|254780414|r  358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       358 glp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~  390 (520)
                      .|++..--+++-||-++.|+|||++++++|||-
T Consensus       155 ~l~~~~L~~~~FPLG~~~K~eVR~iA~~~gL~~  187 (355)
T PRK00143        155 QLTQEQLAKLLFPLGELTKPEVREIAAEIGLPT  187 (355)
T ss_pred             CCCHHHHHHEECCCCCCCHHHHHHHHHHCCCCC
T ss_conf             057988742075876773589999999758988


No 84 
>PRK00876 nadE NAD synthetase; Reviewed
Probab=99.65  E-value=3.8e-15  Score=128.49  Aligned_cols=177  Identities=24%  Similarity=0.275  Sum_probs=107.5

Q ss_pred             CCCHHHHHHHHHHHHHHH----CCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCC----HHHHHHHHH
Q ss_conf             140678999999997650----444036640564047799999986223-65699997389551562----789999886
Q gi|254780414|r  203 WVMSSYHKEIVSRIKEQV----GNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNE----VENIISLFK  273 (520)
Q Consensus       203 W~~~~~~~~~i~~Ir~~v----g~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE----~~~v~~~~~  273 (520)
                      -+++.-++..++-||++|    +.+-+++|+||||||||+|+|..+|+| +|++|++     |-..+    +.+--..+.
T Consensus        10 iD~~~e~~riv~fir~~v~~~~~~kG~VlGlSGGIDSAv~a~Lav~AlG~e~V~gl~-----MP~~~s~~~s~~~a~~la   84 (325)
T PRK00876         10 IDAAAEAERIRAFIREQVLGTLKRRGVVLGLSGGIDSSVTLALCVRALGKDRVLGLL-----MPERDSSPDSLRLGRMLA   84 (325)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEE-----CCCCCCCHHHHHHHHHHH
T ss_conf             686999999999999999851698679996876888999999999974855169997-----886568877899999999


Q ss_pred             HCCCCCEEEEEHHHH------------HHHHHCCCCCHHHHHHHHHHHHHH-----HHHHHHHHC---------------
Q ss_conf             236985799758899------------999966898889999887565899-----999999743---------------
Q gi|254780414|r  274 GYPNFPLRVVDASER------------FIRKLKNIVDPETKRKVIGQLFIE-----VFEEEAKKI---------------  321 (520)
Q Consensus       274 ~~~~~~l~~vda~~~------------Fl~~L~gv~DPE~KRkiIG~~Fi~-----vf~~~a~~~---------------  321 (520)
                      +.+|++...+|.+..            +++.+..--+|-.|.||.-.-|++     ++.-.+.+-               
T Consensus        85 ~~lGi~~~~idI~~~l~~~~~y~~~d~~i~~~~p~~~~~~~~~i~~~~~l~~~~~~~~~l~~~~~~~~~~~~~l~~~~~l  164 (325)
T PRK00876         85 ESLGVEYVVEDISPALEALGCYERRDEAIRRVVPEYGPGWKSKLVLPNFLEGDLLNVPYLVVQDPGGEVRKKRLPPADYL  164 (325)
T ss_pred             HHCCCCEEEEECHHHHHHHHHHHHHHHHHHHHCCCCCCCHHCCCCCCCHHCCCCCCCHHHHCCCCCCCCCCCCCCHHHHH
T ss_conf             98199359984489998754313568888750333242000000023111023223101210464210000135503444


Q ss_pred             ---------------------CCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             ---------------------99709986462202454202467776303443023201132032022378987389999
Q gi|254780414|r  322 ---------------------GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVR  380 (520)
Q Consensus       322 ---------------------~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR  380 (520)
                                           ....+|.-||  ++--|-.-+       -=|-+-.|+       -=+.||.+|||-|||
T Consensus       165 ~~~a~~NiKaR~RM~~lY~~A~~~n~lVlGT--~NksE~~~G-------yfTKyGDGa-------~Di~PI~~LyKtQV~  228 (325)
T PRK00876        165 QIVAATNFKQRTRKMVEYYHADRLNYAVAGT--PNRLEYDQG-------FFVKYGDGA-------ADLKPIAHLYKTQVY  228 (325)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHCCCEEECC--CCHHHHHHC-------CEEEECCCC-------CCCCCCCCCCHHHHH
T ss_conf             4555323368999999999998739877658--846556635-------147544788-------784513577589999


Q ss_pred             HHHHHHCCCHHHHCCCCCCC
Q ss_conf             99998199988942688898
Q gi|254780414|r  381 LLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       381 ~lg~~Lglp~~~~~RhPFPG  400 (520)
                      +|++.||+|++++.|-|=++
T Consensus       229 ~LA~~LgvPe~Ii~K~PSad  248 (325)
T PRK00876        229 ALAEYLGVPEEIRRRPPTTD  248 (325)
T ss_pred             HHHHHCCCCHHHHCCCCCCC
T ss_conf             99998099999936999813


No 85 
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=99.63  E-value=1.2e-15  Score=131.95  Aligned_cols=158  Identities=28%  Similarity=0.385  Sum_probs=113.5

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC--------CCHHHHHHHHHHCCCCCEEEEEHHHHHHH----
Q ss_conf             036640564047799999986223656999973895515--------62789999886236985799758899999----
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRK--------NEVENIISLFKGYPNFPLRVVDASERFIR----  291 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRk--------nE~~~v~~~~~~~~~~~l~~vda~~~Fl~----  291 (520)
                      ||++|+||||||||||+||.++ |-.++++|.-+---..        .+.+.+...- +++|+++.++|.++.|-+    
T Consensus         1 kV~v~mSGGVDSsvaA~LL~~~-G~~V~gv~m~~w~~~~~~~~C~~~~d~~dA~~va-~~LgIp~~v~d~~~ef~~~V~~   78 (349)
T cd01998           1 KVVVAMSGGVDSSVAAALLKEQ-GYEVIGVFMKNWDEDDGKGGCCSEEDLKDARRVA-DQLGIPHYVVNFEKEYWEKVFE   78 (349)
T ss_pred             CEEEECCCCHHHHHHHHHHHHC-CCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEEEECHHHHHHHHHHH
T ss_conf             9899907789999999999877-9957999999678876678988677899999999-9869967996809988688899


Q ss_pred             -----HHCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCCCCEEEEECCCCCHHHHHHCC---CCCCCCEEEEEEC-CCCH
Q ss_conf             -----966898-8899998875658999--99999743997099864622024542024---6777630344302-3201
Q gi|254780414|r  292 -----KLKNIV-DPETKRKVIGQLFIEV--FEEEAKKIGGAQFLGQGTLYPDVIESISF---FGGPSSIIKSHHN-VGGL  359 (520)
Q Consensus       292 -----~L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~~~~~L~QGTlypDvIES~~~---~~~~~~~IKsHHN-vggl  359 (520)
                           -++|.| .|-    |..|.+|+.  |-+.|+++ +++|+|-|. |.-+.+...+   .....+..|-+-= .-.|
T Consensus        79 ~f~~~Y~~G~TPNPc----v~CN~~IKF~~l~~~A~~~-g~d~iATGH-YAri~~~~~~~~~L~r~~D~~KDQSYfL~~l  152 (349)
T cd01998          79 PFLEEYKKGRTPNPD----ILCNKEIKFGALLDYAKKL-GADYIATGH-YARIEEDNNGRYRLLRGVDPNKDQSYFLSQL  152 (349)
T ss_pred             HHHHHHHCCCCCCCC----HHCCCEEEHHHHHHHHHHC-CCCEECCCC-EEEEEECCCCCEEEEECCCCCCCCCEEEECC
T ss_conf             999999748999876----2118735199999999875-998641351-4788975898489987689987820564012


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             132032022378987389999999981999
Q gi|254780414|r  360 PEHMDMKLVEPLKELFKDEVRLLGKELRLP  389 (520)
Q Consensus       360 p~~~~~~liEPl~~l~KdEVR~lg~~Lglp  389 (520)
                      ++..--+++-||-++.|+|||++++++|||
T Consensus       153 ~~~~L~~~~FPLG~~~K~eVR~iA~~~gl~  182 (349)
T cd01998         153 SQEQLSRLIFPLGDLTKPEVREIAKELGLP  182 (349)
T ss_pred             CHHHHHHEECCCCCCCHHHHHHHHHHCCCC
T ss_conf             487661038788786538999999985999


No 86 
>PRK13980 NAD synthetase; Provisional
Probab=99.62  E-value=1.9e-14  Score=123.53  Aligned_cols=175  Identities=23%  Similarity=0.314  Sum_probs=110.7

Q ss_pred             CCHHHHHHHHHHHHHHH---CCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             40678999999997650---444036640564047799999986223-65699997389551562789999886236985
Q gi|254780414|r  204 VMSSYHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFP  279 (520)
Q Consensus       204 ~~~~~~~~~i~~Ir~~v---g~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~  279 (520)
                      +.+...+..+.-||+.+   |-++|++|||||+||+|+|+|..+|+| +|++|++.-.-.=. .++.+--+.+.+.+|++
T Consensus         7 d~~~~~~~iv~~lrdy~~~~g~kg~VlGlSGGIDSavva~La~~Alg~~~v~~v~mP~~~ss-~~s~~dA~~la~~lgi~   85 (264)
T PRK13980          7 DYEKVREIIVDFIREEVEKAGFKGVVLGLSGGIDSAVVAYLAVKALGKENVLALLMPYRVSP-PEDLEDALLVAERLGIE   85 (264)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC-HHHHHHHHHHHHHHCCC
T ss_conf             89999999999999999980998099979868889999999998549660689989899998-87899999999986998


Q ss_pred             EEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH----HHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEEC
Q ss_conf             799758899999966898889999887565899999----9997439970998646220245420246777630344302
Q gi|254780414|r  280 LRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFE----EEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN  355 (520)
Q Consensus       280 l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~----~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHN  355 (520)
                      ...+|-++.|-.-.+.+.+.  .+-..||.=-++-.    ..|++   ..+|.-||  .+--|..-+.       =|.+-
T Consensus        86 ~~~i~I~~~~~~~~~~~~~~--~~~~~~NiqaR~Rm~~Ly~~An~---~~~lVlgT--gNksE~~~Gy-------~TkyG  151 (264)
T PRK13980         86 YKVIEITPIVDAFFSAVPDA--DRLRRGNIMARTRMVLLYDYANR---DNRLVLGT--SNKSELLLGY-------FTKYG  151 (264)
T ss_pred             EEEEECHHHHHHHHHHCCCC--CHHHHHHHHHHHHHHHHHHHHHH---CCCEEECC--CCHHHHHHHH-------CCCCC
T ss_conf             49982799999999863100--06688875898999999998643---39776558--8674798721-------00168


Q ss_pred             CCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             320113203202237898738999999998199988942688898
Q gi|254780414|r  356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       356 vgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                            ++. -=+.|+.+|||-|||+|++.||+|++++.|-|=||
T Consensus       152 ------D~~-~d~~Pi~dL~Kt~V~~La~~l~vP~~Ii~k~PSa~  189 (264)
T PRK13980        152 ------DGA-VDINPIGDLYKTQVRELARHLGVPEDIIEKPPSAD  189 (264)
T ss_pred             ------CCC-CCHHHHCCCCHHHHHHHHHHHCCCHHHEECCCCCC
T ss_conf             ------766-56245258739999999999399664403699977


No 87 
>pfam03054 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs.
Probab=99.61  E-value=2.4e-15  Score=129.85  Aligned_cols=160  Identities=28%  Similarity=0.395  Sum_probs=109.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCC---CC------CHHHHHHHHHHCCCCCEEEEEHHHHHHH---
Q ss_conf             03664056404779999998622365699997389551---56------2789999886236985799758899999---
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMR---KN------EVENIISLFKGYPNFPLRVVDASERFIR---  291 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllR---kn------E~~~v~~~~~~~~~~~l~~vda~~~Fl~---  291 (520)
                      ||++|+||||||||||+||.++ |-.++++|.-+---.   .+      +.+..... .+++|+++.++|.++.|-+   
T Consensus         2 kV~VamSGGVDSsVaA~LL~~~-Gy~V~Gv~m~~w~~~~~~~~~C~~~~d~~dA~~v-a~~LgIp~~v~d~~~~f~~~Vi   79 (354)
T pfam03054         2 KVVVAMSGGVDSSVAAYLLKEQ-GYEVIGVFMKNWDEEDEFGHGCCSEEDLADAQRV-CEQLGIPLYVVNFEKEYWEKVF   79 (354)
T ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHH-HHHCCCCEEEECHHHHHHHHHH
T ss_conf             6999904789999999999977-9963999999566887667889988999999999-9986997899787998758999


Q ss_pred             ------HHCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCCCCEEEEECCCCCHHHHHHCC--CCCCCCEEEEEEC-CCCH
Q ss_conf             ------966898-8899998875658999--99999743997099864622024542024--6777630344302-3201
Q gi|254780414|r  292 ------KLKNIV-DPETKRKVIGQLFIEV--FEEEAKKIGGAQFLGQGTLYPDVIESISF--FGGPSSIIKSHHN-VGGL  359 (520)
Q Consensus       292 ------~L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~~~~~L~QGTlypDvIES~~~--~~~~~~~IKsHHN-vggl  359 (520)
                            -.+|.| .|-    |..|.+|+.  |-+.|++.-+++|+|-|. |.-+.+..+.  .....+.-|-+-= .-.|
T Consensus        80 ~~fv~~Y~~G~TPNPc----v~CN~~IKFg~l~~~A~~~lGad~iATGH-YAri~~~~~~~~L~r~~D~~KDQSYfL~~l  154 (354)
T pfam03054        80 EPFLDEYKNGRTPNPD----ILCNREIKFGALLDYAKQVLGADYLATGH-YARVSLNENESELLRGKDKNKDQSYFLSGL  154 (354)
T ss_pred             HHHHHHHHCCCCCCCC----HHHCCCCCHHHHHHHHHHHCCCCCCCCCC-EEEEEECCCEEEEEECCCCCCCCCEEEECC
T ss_conf             9999999769999841----44189643899999999866998104474-289990499389998999999801786107


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             1320320223789873899999999819998
Q gi|254780414|r  360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       360 p~~~~~~liEPl~~l~KdEVR~lg~~Lglp~  390 (520)
                      ++..--+++-||-++.|+|||++++++|||-
T Consensus       155 ~q~~L~~~lFPLG~~~K~eVR~iA~~~gL~~  185 (354)
T pfam03054       155 SQEQLEKLLFPLGDLTKEEVRKIAKEAGLPT  185 (354)
T ss_pred             CHHHHHHEECCCCCCCHHHHHHHHHHCCCCC
T ss_conf             8987643182876885289999999769988


No 88 
>PRK00768 nadE NAD synthetase; Reviewed
Probab=99.60  E-value=2.7e-14  Score=122.38  Aligned_cols=187  Identities=22%  Similarity=0.217  Sum_probs=112.4

Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHCCC----------CEEE
Q ss_conf             577998755010644111406789999999976504---440366405640477999999862236----------5699
Q gi|254780414|r  186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVG---NERVICAVSGGVDSTVAAFLIYEAIGI----------NLTC  252 (520)
Q Consensus       186 ~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg---~~kVi~~lSGGVDStV~A~Ll~kAig~----------~l~~  252 (520)
                      .+|.++|     +.+|+++++..++..++-||+.+.   -+.|++|||||+||+|+|+|+.+|++.          ++++
T Consensus         6 ~~~~~~~-----~~~p~~~~~~~i~~iv~~Lrdyv~k~g~~g~VlGLSGGIDSAvta~L~~~Av~al~~~~~~~~~~~ia   80 (274)
T PRK00768          6 QQIIAEL-----GVKPTIDPEEEIRRRVDFLKDYLKKSGLKTLVLGISGGQDSTLAGRLAQLAVEELRAETGDASYQFIA   80 (274)
T ss_pred             HHHHHHC-----CCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEE
T ss_conf             9999981-----99999998999999999999999984998399818857688999999999999865304766422689


Q ss_pred             EEECCCCCCCCCHHHHHHHHHHCCCC-CEEEE---EHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH----HHHHHCCCC
Q ss_conf             99738955156278999988623698-57997---58899999966898889999887565899999----999743997
Q gi|254780414|r  253 VLVDHGFMRKNEVENIISLFKGYPNF-PLRVV---DASERFIRKLKNIVDPETKRKVIGQLFIEVFE----EEAKKIGGA  324 (520)
Q Consensus       253 vfVD~GllRknE~~~v~~~~~~~~~~-~l~~v---da~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~----~~a~~~~~~  324 (520)
                      +..-.+- ...| +...... +.++. ....+   .+-+.|++.++...++.. .-..||+=-++-.    -.|++   .
T Consensus        81 v~mP~~~-~~~~-~da~~~~-~~i~~~~~~~i~I~~~~d~~~~~l~~~~~~~~-d~~~~NiqaRiRM~~LY~~An~---~  153 (274)
T PRK00768         81 VRLPYGV-QADE-DDAQDAL-AFIQPDEVLTVNIKPAVDASVAALRAAGIELS-DFVKGNIKARERMIAQYAIAGA---R  153 (274)
T ss_pred             EECCCCC-CCCH-HHHHHHH-HHCCCCEEEEECCCHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHHHHHHHHHHHC---C
T ss_conf             7689886-5799-9999998-52276604886170999999999987277511-6788885798999999999827---8


Q ss_pred             EEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             0998646220245420246777630344302320113203202237898738999999998199988942688898
Q gi|254780414|r  325 QFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       325 ~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                      .+|.-||  ..--|..-+.       =|-+-.|+       -=+.|+.+|||-|||+|++.||+|++++.+-|=+|
T Consensus       154 g~LVlGT--gNksE~~vGY-------fTkYGDg~-------~Di~PI~dL~KteV~~lA~~LgvP~~Ii~k~PSA~  213 (274)
T PRK00768        154 GGLVVGT--DHAAEAITGF-------FTKFGDGG-------ADLLPLFGLNKRQGRALLAALGAPEHLYEKVPTAD  213 (274)
T ss_pred             CCEEECC--CCHHHHHCCC-------EEEECCCC-------CCHHHHCCCCHHHHHHHHHHHCCCHHHHCCCCCCC
T ss_conf             9988648--8640444085-------01026775-------17376325619999999999597999836898997


No 89 
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=99.53  E-value=4.1e-14  Score=121.09  Aligned_cols=186  Identities=16%  Similarity=0.260  Sum_probs=112.0

Q ss_pred             CCCCH-HHHHHHHHHHCCCEEEEECCCCCHHHHHH--CCCCEEEECCCCCCCCCCCCCCCCHHHHH----C-----CCCE
Q ss_conf             89705-78899888865940698528989889972--39979999853889999999753768980----8-----9988
Q gi|254780414|r   15 FGSQF-TQLIARRVRESKVYCEVIAFKNALDYFKE--QNPQAIILSGSPASSLDIDSPQIPKEILE----S-----NIPL   82 (520)
Q Consensus        15 fGSQy-tqLIaRriRelgVyseI~P~~~~~e~i~~--~~p~GIILSGGP~SV~d~~ap~~~~~I~~----~-----~iPI   82 (520)
                      +|.+| .-.=++-+.-.|....-+|++.+.+++..  ....||+|.||.......+-.+..+.+++    .     --||
T Consensus        16 ~~~sYIaASYVK~lEsaGArVVPI~~~~~~~~~~~l~~~INGvLfpGG~~~~~~s~y~~~~~~i~~~A~e~Nd~G~yFPi   95 (273)
T cd01747          16 TGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKSINGILFPGGAVDIDTSGYARTAKIIYNLALERNDAGDYFPV   95 (273)
T ss_pred             CCCEEEEHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             78747608989999978986998746999899999987546799678662056670899999999999998508995633


Q ss_pred             EEECHHHHHHHHHCCCE--EEECCCCCCCEEEEEECC---CCCCCCCCCCC-----CCCEEEEEECCCHHH--------C
Q ss_conf             99778999989970969--998698661036675238---86222787266-----553368600220110--------1
Q gi|254780414|r   83 LGICYGQQIMCQSLGGK--TKNSQSREFGRAFIEIKK---NCSLLKGMWEK-----GSKQQVWMSHGDQVE--------H  144 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~--V~~~~~~EyG~~~I~i~~---~~~lf~gl~~~-----~~~~~VwmSH~D~V~--------~  144 (520)
                      +|+|+|+|+|.....|.  +...-..+.-..+++.++   .+.+|.+++..     .....+..+|...|+        .
T Consensus        96 wGtCLGFelL~~~~s~~~~~l~~~~s~n~~~pL~ft~~~~~Srlf~~~~~~l~~~l~~~~~t~n~H~~gitp~~f~~~~~  175 (273)
T cd01747          96 WGTCLGFELLTYLTSGETLLLEATEATNSALPLNFTEDALQSRLFKRFPPDLLKSLATEPLTMNNHRYGISPENFTENGL  175 (273)
T ss_pred             EEEHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHCCCCHHHHCCCCCHHHHHHHHH
T ss_conf             33303099999997399612310267773301014467644637651999999998507600433054167888745688


Q ss_pred             CCCCCCEEECCCC----CCEEEEEECCCCEEEEEEEEHHH-----------CCCHHHH---HHHHHHHHHCCCC
Q ss_conf             2444211232398----31788986350011246521222-----------1520257---7998755010644
Q gi|254780414|r  145 IPEGFEVIASSDS----TPFAFIADEKRKYYAVQFHPEVV-----------HTVGGSQ---LIDNFVHHVAGIQ  200 (520)
Q Consensus       145 lP~gf~viA~S~~----~~iaai~~~~~~iyGVQFHPEV~-----------hT~~G~~---iL~NFl~~Ic~~~  200 (520)
                      +-+-|++++.+.+    .-|+.|++++.|+||+|||||..           ||..+.+   -+-||..+.|.-.
T Consensus       176 L~~~f~ilstn~D~~g~eFVStiE~k~YP~yg~QfHPEK~~FEw~~~~~i~Hs~~ai~~sq~~a~fFV~eaRkn  249 (273)
T cd01747         176 LSDFFNVLTTNDDWNGVEFISTVEAYKYPIYGVQWHPEKNAFEWKKSSSIPHSEEAIRLTQYFANFFVNEARKS  249 (273)
T ss_pred             HHHHHEEEEEEECCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             87442656877659998898863032476466740687576555776789989999999999999999999638


No 90 
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=99.52  E-value=3.4e-13  Score=114.56  Aligned_cols=161  Identities=27%  Similarity=0.388  Sum_probs=110.1

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC---CHH----HHHHHHHHCCCCCEEEEEHHHHHHHH--
Q ss_conf             440366405640477999999862236569999738955156---278----99998862369857997588999999--
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKN---EVE----NIISLFKGYPNFPLRVVDASERFIRK--  292 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRkn---E~~----~v~~~~~~~~~~~l~~vda~~~Fl~~--  292 (520)
                      ..||++|+||||||||+|.||++. |-++.++|..++.=+.+   .++    .+.. -.+.+|+++.++|-+++|.++  
T Consensus         3 ~~kV~v~mSGGVDSSVaA~lLk~Q-GyeViGl~m~~~~~~~~~~C~s~~d~~da~~-va~~LGIp~~~vdf~~~y~~~V~   80 (356)
T COG0482           3 KKKVLVGMSGGVDSSVAAYLLKEQ-GYEVIGLFMKNWDEDGGGGCCSEEDLRDAER-VADQLGIPLYVVDFEKEFWNKVF   80 (356)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEEEEEECCCCCCCCCCHHHHHHHHH-HHHHHCCCEEEECHHHHHHHHHH
T ss_conf             767999905777899999999976-9749999999641478886772567899999-99980995599846899888888


Q ss_pred             -------HCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCCCCEEEEECCCCCHHHHHHC--CCCCCCCEEEEEECC-CCH
Q ss_conf             -------66898-8899998875658999--9999974399709986462202454202--467776303443023-201
Q gi|254780414|r  293 -------LKNIV-DPETKRKVIGQLFIEV--FEEEAKKIGGAQFLGQGTLYPDVIESIS--FFGGPSSIIKSHHNV-GGL  359 (520)
Q Consensus       293 -------L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~~~~~L~QGTlypDvIES~~--~~~~~~~~IKsHHNv-ggl  359 (520)
                             ..|-| .|-    |..|.+|+.  |-+.|.++ +++|+|-|. |.-+-++..  ....+.+..|-.-=. -.+
T Consensus        81 ~~f~~~Y~~G~TPNPc----i~CN~~iKF~~~l~~a~~l-gad~iATGH-Yar~~~~~~~~~l~r~~D~~KDQsYfL~~~  154 (356)
T COG0482          81 EYFLAEYKAGKTPNPC----ILCNKEIKFKALLDYAKEL-GADYIATGH-YARQREDEGIELLLRGVDLNKDQSYFLYAL  154 (356)
T ss_pred             HHHHHHHHCCCCCCCC----HHCCHHHHHHHHHHHHHHC-CCCEEEEEE-EEEEECCCCCCCCCCCCCCCCCHHHEECCC
T ss_conf             8778998579999965----1048788999999999975-998578744-676543776000146787420300020126


Q ss_pred             -HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHH
Q ss_conf             -13203202237898738999999998199988
Q gi|254780414|r  360 -PEHMDMKLVEPLKELFKDEVRLLGKELRLPDS  391 (520)
Q Consensus       360 -p~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~  391 (520)
                       ++.+. +++-||-+|-|.|||+++.+.|||-.
T Consensus       155 ~~~ql~-~~lFPlG~l~K~evR~iA~~~gL~~a  186 (356)
T COG0482         155 SQEQLE-RLLFPLGDLEKLEVRPIAAEKGLPTA  186 (356)
T ss_pred             CHHHHH-HCCCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             887775-32256777777899999997599766


No 91 
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]
Probab=99.48  E-value=5.6e-12  Score=105.81  Aligned_cols=188  Identities=30%  Similarity=0.410  Sum_probs=140.1

Q ss_pred             HHHHHHHHHHHCCC-CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHH
Q ss_conf             99999997650444-03664056404779999998622365699997389551562789999886236985799758899
Q gi|254780414|r  210 KEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASER  288 (520)
Q Consensus       210 ~~~i~~Ir~~vg~~-kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~  288 (520)
                      .+.++.+++-.++. ||+.|.|||||||++|.+..+|+|++..|+.||...+-..|.+.....-++ .|++-.+++....
T Consensus         4 ~~Kl~~l~~~ik~~~kv~vAfSGGvDSslLa~la~~~lG~~v~AvTv~sP~~p~~e~e~A~~~A~~-iGi~H~~i~~~~~   82 (269)
T COG1606           4 LSKLERLKKAIKEKKKVVVAFSGGVDSSLLAKLAKEALGDNVVAVTVDSPYIPRREIEEAKNIAKE-IGIRHEFIKMNRM   82 (269)
T ss_pred             HHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHH-HCCCCEEEEHHHC
T ss_conf             799999999986437399996588427999999999735646999971687776660678999999-4876246550002


Q ss_pred             HHHHHCCCCCHHHHHHHHHH------HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHH
Q ss_conf             99996689888999988756------589999999974399709986462202454202467776303443023201132
Q gi|254780414|r  289 FIRKLKNIVDPETKRKVIGQ------LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH  362 (520)
Q Consensus       289 Fl~~L~gv~DPE~KRkiIG~------~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~  362 (520)
                               +||-+.+-.-+      .+.++.-++|.+. +.+..+-||=+.|+-+-                .-|+--.
T Consensus        83 ---------~~~~~~n~~~rCY~CK~~v~~~l~~~a~~~-Gyd~V~dGtNasDl~~~----------------RPG~rA~  136 (269)
T COG1606          83 ---------DPEFKENPENRCYLCKRAVYSTLVEEAEKR-GYDVVADGTNASDLFDY----------------RPGLRAL  136 (269)
T ss_pred             ---------CHHHCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCHHHHCCC----------------CCCHHHH
T ss_conf             ---------523304998735577899999999999973-99889747757873378----------------8302357


Q ss_pred             HCCCHHHHHHHH--HHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEEC--CCCCHHHHHHHHHHHHHHHH
Q ss_conf             032022378987--3899999999819998894268889831112210--00367899999999999999
Q gi|254780414|r  363 MDMKLVEPLKEL--FKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCI--GEITEERINILRESDAIYRE  428 (520)
Q Consensus       363 ~~~~liEPl~~l--~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~--g~vt~e~~~i~r~ad~i~~~  428 (520)
                      -.+.+-.||.++  -|-|+|++++.||||    ++|-=+++=|+.|+.  -|+|.|++..+-+|....++
T Consensus       137 kE~gi~sPl~e~gitk~eIre~a~~lgl~----~~~kp~~aCl~sr~p~g~ei~~e~l~kv~~ae~~l~~  202 (269)
T COG1606         137 KELGIRSPLAEFGITKKEIREIAKSLGLP----TWDKPSMACLASRIPYGEEITVEDLKKVEEAEEFLRE  202 (269)
T ss_pred             HHCCCCCHHHHHCCCHHHHHHHHHHCCCC----CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             76077771888397599999999975998----4558654332000677765668889988999999998


No 92 
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2.1.1.61 from EC) catalyses the addition of 5-methylaminomethyl-2-thiouridylate to tRNAs using S-adenosyl-L-methionine as a substrate and releasing S-adenosyl-L-homocysteine. The enzyme is cytoplasmic and is involved in tRNA processing.; GO: 0004808 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=99.47  E-value=4.3e-13  Score=113.78  Aligned_cols=162  Identities=28%  Similarity=0.409  Sum_probs=114.2

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC----------CCH-------HHHH--HHHHHCCCCCEEEE
Q ss_conf             4036640564047799999986223656999973895515----------627-------8999--98862369857997
Q gi|254780414|r  223 ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRK----------NEV-------ENII--SLFKGYPNFPLRVV  283 (520)
Q Consensus       223 ~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRk----------nE~-------~~v~--~~~~~~~~~~l~~v  283 (520)
                      +||++||||||||||+|+||++- |.++.|||.-+=.+..          ||.       +...  +..-++||+++..+
T Consensus         1 ~kv~VglSGGVDSSVsA~lL~~q-g~~v~G~ylk~W~~~~~~d~~GH~~~N~~K~~C~~~~dl~~a~~ic~~LGi~l~~~   79 (394)
T TIGR00420         1 KKVIVGLSGGVDSSVSAYLLKQQ-GYEVVGVYLKNWDEDEKNDILGHKKINENKSGCSSAEDLRDAQAICEKLGIPLEKV   79 (394)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHC-CCEEEEEEEEEEECCCCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             94899806854789999999714-96589998776512466664431656246778836887999999998559818985


Q ss_pred             EHHHHHHHH---------HCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCC--CCEEEEECCCCCH---HHHHHCC--CC
Q ss_conf             588999999---------66898-8899998875658999--999997439--9709986462202---4542024--67
Q gi|254780414|r  284 DASERFIRK---------LKNIV-DPETKRKVIGQLFIEV--FEEEAKKIG--GAQFLGQGTLYPD---VIESISF--FG  344 (520)
Q Consensus       284 da~~~Fl~~---------L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~--~~~~L~QGTlypD---vIES~~~--~~  344 (520)
                      |-.+.|.++         =+|.| .|.    |..|-||+.  |-+.+++..  +.+++|-|. |.=   .+|+.+.  ..
T Consensus        80 nf~~~Y~~~Vf~~~i~~y~~G~TPnPD----i~CN~~iKFG~~~e~~~~~~Gtg~~~~aTGH-YAr~~q~~~~~~~~~L~  154 (394)
T TIGR00420        80 NFQKEYWNKVFEPFIQEYKEGLTPNPD----ILCNKLIKFGLLLEYAKQLLGTGNDKIATGH-YARIAQEIENKSLFELL  154 (394)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCC----CCCCCCCCHHHHHHHHHHHCCCCCCEEECCH-HHHHHHHHCCCCHHHHH
T ss_conf             507887888889999987367777862----0047120037899999985289954344244-76544342131014443


Q ss_pred             CCCCEEEEEECC-CCH-HHHHCCCHHHHHHHHHHHHHHHHHHHHC--CCHH
Q ss_conf             776303443023-201-1320320223789873899999999819--9988
Q gi|254780414|r  345 GPSSIIKSHHNV-GGL-PEHMDMKLVEPLKELFKDEVRLLGKELR--LPDS  391 (520)
Q Consensus       345 ~~~~~IKsHHNv-ggl-p~~~~~~liEPl~~l~KdEVR~lg~~Lg--lp~~  391 (520)
                      -+-+..|=.-== --| ++.|. +++-||-+|-|-|||.|++.++  ||..
T Consensus       155 ~~~D~~KDQSYFL~~l~~~~~~-~~~FPlG~L~K~~vR~iA~~~~PfL~ta  204 (394)
T TIGR00420       155 RALDKNKDQSYFLYHLSQEQLA-KLLFPLGELLKPEVRQIAKNAGPFLSTA  204 (394)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHH-HHCCCCCCCCCHHHHHHHHHCCCCCCCC
T ss_conf             0467888611737640189888-7505301036778999998648632344


No 93 
>PTZ00323 NAD+ synthase; Provisional
Probab=99.44  E-value=1.2e-11  Score=103.37  Aligned_cols=183  Identities=19%  Similarity=0.184  Sum_probs=107.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCC---CCEEEEECCCCHHHHHHHHHHHHCC-CCE-----EEEEEC
Q ss_conf             5779987550106441114067899999999765044---4036640564047799999986223-656-----999973
Q gi|254780414|r  186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGN---ERVICAVSGGVDSTVAAFLIYEAIG-INL-----TCVLVD  256 (520)
Q Consensus       186 ~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~---~kVi~~lSGGVDStV~A~Ll~kAig-~~l-----~~vfVD  256 (520)
                      .+||+-+     ++++.++++..|+..+.-+|+.+..   +.|++|+|||+||+|+|+|..+|+| +|.     ++++  
T Consensus        12 ~~ii~e~-----~~~~~~dp~~eI~~rv~fLrDYv~k~GfkgvVLGlSGGIDSAl~aaLA~~Alg~env~~~r~~gv~--   84 (294)
T PTZ00323         12 QRVLEEY-----RRTRAFDPVAWIEMKCAKLNEYMRRCGLKACVTSVSGGIDSAVVLALCSRAMRMPNSPIVRNVGIC--   84 (294)
T ss_pred             HHHHHHH-----CCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEE--
T ss_conf             9999996-----888888989999999999999999829985999586369999999999998655457530356776--


Q ss_pred             CCCCCCCCHH----HHHHHHHHCCCCCEEEEEHHHH---HHH---HHCCCCCHHHHHHHHHHHHHHHHH----HHHHHC-
Q ss_conf             8955156278----9999886236985799758899---999---966898889999887565899999----999743-
Q gi|254780414|r  257 HGFMRKNEVE----NIISLFKGYPNFPLRVVDASER---FIR---KLKNIVDPETKRKVIGQLFIEVFE----EEAKKI-  321 (520)
Q Consensus       257 ~GllRknE~~----~v~~~~~~~~~~~l~~vda~~~---Fl~---~L~gv~DPE~KRkiIG~~Fi~vf~----~~a~~~-  321 (520)
                         |....+.    .-.+.. +.++.....+|-...   |..   ..-|...   ..-.-|++=-++-.    ..+... 
T Consensus        85 ---~P~~ss~~s~~~a~~~a-~~~g~~~~~~~~~~i~~~~~~~~~~~~g~~~---~d~~~gNlqAR~Rm~~~~~la~l~n  157 (294)
T PTZ00323         85 ---QPICSSAWALARGRENI-AACGATEVVVDQTELHKQLSTLVETAVGIDG---GDFARGQLRSYMRTPVGYYVAQLLS  157 (294)
T ss_pred             ---CCCCCCHHHHHHHHHHH-HHCCCCEEECCCHHHHHHHHHHHHHHCCCCC---HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---78545766598799999-9768852323607779999999998608861---0467889999998889999999860


Q ss_pred             -CCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEE-CCCCH--HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCC
Q ss_conf             -997099864622024542024677763034430-23201--13203202237898738999999998199988942688
Q gi|254780414|r  322 -GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHH-NVGGL--PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHP  397 (520)
Q Consensus       322 -~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHH-Nvggl--p~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhP  397 (520)
                       .+..+|.-||         +   .     ||-+ -||--  --+|. -=+-||++|+|-+||+|++.||+|++++.|-|
T Consensus       158 ~~g~~~LVlgT---------g---N-----kSE~~~vGY~TkYGD~a-gd~apI~DL~Kt~V~~Lar~LgiPe~ii~K~P  219 (294)
T PTZ00323        158 QEGTPAIVMGT---------G---N-----MDEDGYLGYFCKAGDGV-VDVQLISDLHKSEVFLVAEELGVPENTLQAAP  219 (294)
T ss_pred             HCCCCEEEECC---------C---C-----CCCCHHCEEEEEECCCC-CCCHHHCCCCHHHHHHHHHHCCCCHHHHCCCC
T ss_conf             04887078628---------9---7-----55421200442034775-47033046839999999998099899930898


Q ss_pred             CCC
Q ss_conf             898
Q gi|254780414|r  398 CPG  400 (520)
Q Consensus       398 FPG  400 (520)
                      =.+
T Consensus       220 SAe  222 (294)
T PTZ00323        220 SAD  222 (294)
T ss_pred             CCC
T ss_conf             976


No 94 
>COG0171 NadE NAD synthase [Coenzyme metabolism]
Probab=99.38  E-value=2.8e-11  Score=100.89  Aligned_cols=174  Identities=20%  Similarity=0.301  Sum_probs=110.7

Q ss_pred             CHHHHHHHHHHHHHHHC---CCCEEEEECCCCHHHHHHHHHHHHCC-----CCEEEEEECCCC-CCCCCHHHHHHHHHHC
Q ss_conf             06789999999976504---44036640564047799999986223-----656999973895-5156278999988623
Q gi|254780414|r  205 MSSYHKEIVSRIKEQVG---NERVICAVSGGVDSTVAAFLIYEAIG-----INLTCVLVDHGF-MRKNEVENIISLFKGY  275 (520)
Q Consensus       205 ~~~~~~~~i~~Ir~~vg---~~kVi~~lSGGVDStV~A~Ll~kAig-----~~l~~vfVD~Gl-lRknE~~~v~~~~~~~  275 (520)
                      .+..++..+.-||+.+.   -++|++|+|||+|||++++|..+|+|     .++.++...-+- .+.. .+...+..+. 
T Consensus         5 ~~~~~~~~v~fl~~~l~~~~~k~~VlGiSGGiDSa~~~~La~~A~~~~~~~~~~~av~mP~~~~~~~~-~~da~~~~~~-   82 (268)
T COG0171           5 LEEEINRLVDFLRDYLKKAGFKGVVLGLSGGIDSALVLALAVRALGKGDSKENVLAVRLPYGYTVQAD-EEDAQDLAEA-   82 (268)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCHHHEEEEECCCCCCCCCC-HHHHHHHHHH-
T ss_conf             99999999999999999739998699766681999999999998565651243266867887765347-9999999998-


Q ss_pred             CCCCEEEEEHHHHHH---HHHCCCC-CHHHHHHHHHHHHHHHH----HHHHHHCCCCEEEEECCCCCHHHHHHC-CCCCC
Q ss_conf             698579975889999---9966898-88999988756589999----999974399709986462202454202-46777
Q gi|254780414|r  276 PNFPLRVVDASERFI---RKLKNIV-DPETKRKVIGQLFIEVF----EEEAKKIGGAQFLGQGTLYPDVIESIS-FFGGP  346 (520)
Q Consensus       276 ~~~~l~~vda~~~Fl---~~L~gv~-DPE~KRkiIG~~Fi~vf----~~~a~~~~~~~~L~QGTlypDvIES~~-~~~~~  346 (520)
                      +++....++=++.+-   .++.... .++..+-..||.=-+.-    -..|++   ..+|.-||  .+..|-.- ...  
T Consensus        83 lg~~~~~i~I~~~v~~~~~~~~~~~~~~~~~~~~~~NikaR~Rm~~lY~~An~---~~~lVlGT--gn~sE~~~Gy~T--  155 (268)
T COG0171          83 LGIDYKEINIKPAVDAFLKKLLKLFLGIYLEDLALGNIKARLRMVILYAIANK---LGGLVLGT--GNKSELALGYFT--  155 (268)
T ss_pred             HCCCEEEEECHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH---CCCEEECC--CCHHHHHCCCEE--
T ss_conf             29966997528889998876666523442112777645099999999999855---59789758--848778607443--


Q ss_pred             CCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             630344302320113203202237898738999999998199988942688898
Q gi|254780414|r  347 SSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       347 ~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                          |  .-      ++ .-=+.|+.+|||-+|++|++.||+|++++.|-|=|+
T Consensus       156 ----k--yG------Dg-~~d~~Pi~~L~KtqV~~La~~l~ipe~I~~k~PTAe  196 (268)
T COG0171         156 ----K--YG------DG-AVDINPIADLYKTQVYALARHLGIPEEILKKPPTAD  196 (268)
T ss_pred             ----C--CC------CC-CCCHHHHCCCCHHHHHHHHHHCCCCHHHHCCCCCCC
T ss_conf             ----2--06------76-447054148758999999987399999963999911


No 95 
>PRK06186 hypothetical protein; Validated
Probab=99.38  E-value=7.9e-13  Score=111.92  Aligned_cols=145  Identities=14%  Similarity=0.170  Sum_probs=86.9

Q ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEE---ECCCCCCC---------------
Q ss_conf             239979999853889999999753768980899889977899998997096999---86986610---------------
Q gi|254780414|r   48 EQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK---NSQSREFG---------------  109 (520)
Q Consensus        48 ~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~---~~~~~EyG---------------  109 (520)
                      ..+++||++-||-..---++.....+..-+.++|.||||+|||++...|-=.|-   .+...|+-               
T Consensus        51 L~~~dgilv~pGfG~RG~eGki~Ai~yARen~iP~LGICLGmQ~avIEfARnvlgl~dAnS~Efd~~~~~pvi~~l~~~~  130 (229)
T PRK06186         51 LAGFDGIWCVPGSPYRNEDGALTAIRFARENGIPFLGTCGGFQHALLEYARNVLGWADAEHAETDPEASRPVIAPLSCSL  130 (229)
T ss_pred             HCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCH
T ss_conf             22599899899877765638999999998769987864277899999999986599888764557899971893688732


Q ss_pred             ---EEEEEECCCCCCCCCCCCCCCCEEEEEE--CCCHH-----HCC-CCCCCEEECCCCCCEEEEEECCCCEE-EEEEEE
Q ss_conf             ---3667523886222787266553368600--22011-----012-44421123239831788986350011-246521
Q gi|254780414|r  110 ---RAFIEIKKNCSLLKGMWEKGSKQQVWMS--HGDQV-----EHI-PEGFEVIASSDSTPFAFIADEKRKYY-AVQFHP  177 (520)
Q Consensus       110 ---~~~I~i~~~~~lf~gl~~~~~~~~VwmS--H~D~V-----~~l-P~gf~viA~S~~~~iaai~~~~~~iy-GVQFHP  177 (520)
                         ..++.+.+++.+. .+..   +..+..-  |.+.|     ..+ -.|+.+.+.++++.+++++.++.|+| |+||||
T Consensus       131 ~~~~~~~~l~~~s~~~-~iYg---~~~i~ERHRHRYEvN~~y~~~le~~Gl~~sG~~~~~~veiiEl~~Hpffvg~QfHP  206 (229)
T PRK06186        131 VEATAAIRLRPGSLIA-RAYG---TDEIEEGYHCRYGVNPEFAAALESGALRVSGWDEEGDVRAVELPGHPFFVATLFQP  206 (229)
T ss_pred             HCCCCCEEECCCCHHH-HHHC---CCHHHHHHCCCCCCCHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCEEEECCCC
T ss_conf             0387515748998399-9869---65301332345546989999999789899998899988999928998589965875


Q ss_pred             HHHCCCH-HHHHHHHHHHHHC
Q ss_conf             2221520-2577998755010
Q gi|254780414|r  178 EVVHTVG-GSQLIDNFVHHVA  197 (520)
Q Consensus       178 EV~hT~~-G~~iL~NFl~~Ic  197 (520)
                      |-+..+. -.-++..|+ .-|
T Consensus       207 Ef~Srp~~phPlF~~Fi-~AA  226 (229)
T PRK06186        207 ERAALAGRLPPLVRAFL-RAC  226 (229)
T ss_pred             CCCCCCCCCCCCHHHHH-HHH
T ss_conf             45689999881599999-998


No 96 
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase (CTP). CTP is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. CTPs produce CTP from UTP and glutamine and regulate intracellular CTP levels through interactions with four ribonucleotide triphosphates. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. CTP is derived form UTP in three separate steps involving two active sites. In one active site, the UTP O4 oxygen is activated by Mg-ATP-dependent phosphorylation, followed by displacement of the resulting 4-phosphate moiety by ammonia. At a separate site, ammonia is generated via rate limiting glutamine hydrolysis (glutaminase) activity. A gated channel that spans between the glutamine hydrolysis and amidoligase active sites provides a path for ammonia diffusion. CTPs belong to th
Probab=99.37  E-value=6e-13  Score=112.78  Aligned_cols=141  Identities=22%  Similarity=0.313  Sum_probs=83.5

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEE---ECCCCC------------------
Q ss_conf             39979999853889999999753768980899889977899998997096999---869866------------------
Q gi|254780414|r   49 QNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK---NSQSRE------------------  107 (520)
Q Consensus        49 ~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~---~~~~~E------------------  107 (520)
                      .+.+||++.||-..---++.....+...+.++|.||||+|||+++..|-=.|-   .+...|                  
T Consensus        54 ~~~dgilvpgGFG~rG~eGki~Ai~yARen~iPfLGIClGmQ~aviE~ARnvlg~~~A~s~E~~~~~~~~vi~~~~~~~~  133 (235)
T cd01746          54 KGADGILVPGGFGIRGVEGKILAIKYARENNIPFLGICLGMQLAVIEFARNVLGLPDANSTEFDPDTPHPVVDLMPEQKG  133 (235)
T ss_pred             HCCCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECHHHCC
T ss_conf             30697895788887764588999999997399725441034322689998752997767422479999877996756616


Q ss_pred             ---------CCEEEEEECCCCCCCCCCCCCCCCEEEEE--ECCCHH-----HCCC-CCCCEEECCCC-CCEEEEEECCCC
Q ss_conf             ---------10366752388622278726655336860--022011-----0124-44211232398-317889863500
Q gi|254780414|r  108 ---------FGRAFIEIKKNCSLLKGMWEKGSKQQVWM--SHGDQV-----EHIP-EGFEVIASSDS-TPFAFIADEKRK  169 (520)
Q Consensus       108 ---------yG~~~I~i~~~~~lf~gl~~~~~~~~Vwm--SH~D~V-----~~lP-~gf~viA~S~~-~~iaai~~~~~~  169 (520)
                               -|...+.+.+++.+.+ +..   ...+.-  -|.+.|     ..+- .|+.+.+.+++ ..+++++.++.|
T Consensus       134 ~~~~GgTmRLG~~~~~l~~~s~~~~-~y~---~~~i~ERHRHRYevN~~y~~~le~~Gl~~sG~~~~~~~veiiEl~~Hp  209 (235)
T cd01746         134 VKDLGGTMRLGAYPVILKPGTLAHK-YYG---KDEVEERHRHRYEVNPEYVDELEEAGLRFSGTDPDGGLVEIVELPDHP  209 (235)
T ss_pred             CHHCCCCEEEEEEEEEECCCHHHHH-HCC---CCEEEEEECCCEEECHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCC
T ss_conf             4001341342025776224306667-518---832312302355678999999986896899998999979999868998


Q ss_pred             EE-EEEEEEHHHCCCH-HHHHHHHHH
Q ss_conf             11-2465212221520-257799875
Q gi|254780414|r  170 YY-AVQFHPEVVHTVG-GSQLIDNFV  193 (520)
Q Consensus       170 iy-GVQFHPEV~hT~~-G~~iL~NFl  193 (520)
                      +| |+|||||-+.++. -.-++..|+
T Consensus       210 ffvg~QfHPEf~Srp~~phPlF~~fi  235 (235)
T cd01746         210 FFVGTQFHPEFKSRPLKPHPLFVGFV  235 (235)
T ss_pred             CEEEECCCCCCCCCCCCCCCCHHHHC
T ss_conf             47887577644689999993836439


No 97 
>KOG0623 consensus
Probab=99.33  E-value=1.2e-11  Score=103.48  Aligned_cols=172  Identities=22%  Similarity=0.378  Sum_probs=110.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCC------CCCCCCCCCCCHHHHHCCCC
Q ss_conf             869999889705788998888659406985289898899723997999985388------99999997537689808998
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA------SSLDIDSPQIPKEILESNIP   81 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~------SV~d~~ap~~~~~I~~~~iP   81 (520)
                      +-+-+||+|+-.-|.|...+|.||.....+  .++-+ |  .+.+-+|+.|=-+      +.+..+-.....+..+.+.|
T Consensus         2 ~vv~~ld~~agn~~si~nal~hlg~~i~~v--~~P~D-I--~~a~rLIfPGVGnfg~~~D~L~~~Gf~eplr~YiesgkP   76 (541)
T KOG0623           2 SVVTLLDYGAGNVRSIRNALRHLGFSIKDV--QTPGD-I--LNADRLIFPGVGNFGPAMDVLNRTGFAEPLRKYIESGKP   76 (541)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHCCCEEEEC--CCCHH-H--CCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             657998417864788999998638365542--58122-0--367437603866412788887643247899999866997


Q ss_pred             EEEECHHHHHHHHHCCCEEEECC--------------------CCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCH
Q ss_conf             89977899998997096999869--------------------8661036675238862227872665533686002201
Q gi|254780414|r   82 LLGICYGQQIMCQSLGGKTKNSQ--------------------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQ  141 (520)
Q Consensus        82 ILGICyG~QlLa~~~GG~V~~~~--------------------~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~  141 (520)
                      ++|||.|.|+|   |-|+|+..+                    ..+.||....+.+.+.+|...    ..-.++.-|++-
T Consensus        77 fmgicvGlQaL---F~gSvE~p~skGLgvipg~v~RFD~s~k~VPhIGWNsc~v~sd~effg~~----p~~~~YFVHSyl  149 (541)
T KOG0623          77 FMGICVGLQAL---FDGSVENPPSKGLGVIPGIVGRFDASAKIVPHIGWNSCQVGSDSEFFGDV----PNRHVYFVHSYL  149 (541)
T ss_pred             EEEEHHHHHHH---HCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCEEEEEEEEC
T ss_conf             47631457998---63644378867643544401103577785774563115457752002567----873499985311


Q ss_pred             HHCCC-----CCCCEEECCCC---CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHH
Q ss_conf             10124-----44211232398---31788986350011246521222152025779987550
Q gi|254780414|r  142 VEHIP-----EGFEVIASSDS---TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHH  195 (520)
Q Consensus       142 V~~lP-----~gf~viA~S~~---~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~  195 (520)
                      ..+.|     ++|+ +|.+..   ..+++|.  +.+++++|||||- ..+.|...|+|||.+
T Consensus       150 ~~ek~~~len~~wk-iat~kYG~E~Fi~ai~--knN~~AtQFHPEK-SG~aGL~vl~~FL~~  207 (541)
T KOG0623         150 NREKPKSLENKDWK-IATCKYGSESFISAIR--KNNVHATQFHPEK-SGEAGLSVLRRFLHQ  207 (541)
T ss_pred             CCCCCCCCCCCCCE-EEEECCCCHHHHHHHH--CCCEEEEECCCCC-CCCHHHHHHHHHHHC
T ss_conf             33345678987736-7640467088999986--0765457526544-550118999999851


No 98 
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. The enzyme catalyzes the reaction L-glutamine + H2O + UTP + ATP = CTP + phosphate + ADP + L-glutamate. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. This gene has been found circa 500 bp 5 upstream of enolase in both beta (Nitrosomonas europaea) and gamma (Escherichia coli) subdivisions of Proteobacterium .; GO: 0003883 CTP synthase activity, 0006221 pyrimidine nucleotide biosynthetic process.
Probab=99.33  E-value=3.6e-12  Score=107.24  Aligned_cols=140  Identities=26%  Similarity=0.386  Sum_probs=88.8

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEEE---CCCCCC------------------
Q ss_conf             99799998538899999997537689808998899778999989970969998---698661------------------
Q gi|254780414|r   50 NPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKN---SQSREF------------------  108 (520)
Q Consensus        50 ~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~~---~~~~Ey------------------  108 (520)
                      ..|||+.-||=..==-++....-+...+.+||.||||+|||+..--|-=+|..   ++.-||                  
T Consensus       373 ~~DGILVPGGFG~RG~EGKI~Ai~yAREN~iPFLGICLGmQ~A~IEFARNV~Gl~~AnStEf~~~t~~p~~~Vv~LlpEq  452 (571)
T TIGR00337       373 EVDGILVPGGFGERGVEGKIRAIKYARENNIPFLGICLGMQLAVIEFARNVLGLKGANSTEFDPETKYPKSPVVDLLPEQ  452 (571)
T ss_pred             CCCEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEHHHHHHHHHHHHHHHHCCCCCCCHHHCCCCCCCCCCCCEECCCCC
T ss_conf             06806836888976602478999998763697330217778889999765347988874124645577733111425322


Q ss_pred             ----------------------CEEEEEECCC---CCCCCCCCCCCCCEEEEEE--CCCHH-----HCCC-CCCCEEECC
Q ss_conf             ----------------------0366752388---6222787266553368600--22011-----0124-442112323
Q gi|254780414|r  109 ----------------------GRAFIEIKKN---CSLLKGMWEKGSKQQVWMS--HGDQV-----EHIP-EGFEVIASS  155 (520)
Q Consensus       109 ----------------------G~~~I~i~~~---~~lf~gl~~~~~~~~VwmS--H~D~V-----~~lP-~gf~viA~S  155 (520)
                                            |..++.+.++   +.+++ +.   ....|.--  |-+.|     ..+- .||.+.+.|
T Consensus       453 ~d~~~~~~VRt~~~~lGGTMRLG~ypc~l~~~~eWt~a~k-lY---g~~~v~ERHRHRYE~Nn~~~~~~E~~GL~vsG~S  528 (571)
T TIGR00337       453 KDQNGNKEVRTEIEDLGGTMRLGLYPCILKPGSEWTLAFK-LY---GKEEVYERHRHRYEVNNEYREELENKGLIVSGTS  528 (571)
T ss_pred             CCCCCCEECCEEECCCCCEEECCCCCEEECCCCCHHHHHH-HC---CCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEEC
T ss_conf             2446760013010138724305872217717872326755-33---7867887124441227578989985795899986


Q ss_pred             CC-CCEEEEEECCCCEE-EEEEEEHHHCCCH-HHHHHHHHH
Q ss_conf             98-31788986350011-2465212221520-257799875
Q gi|254780414|r  156 DS-TPFAFIADEKRKYY-AVQFHPEVVHTVG-GSQLIDNFV  193 (520)
Q Consensus       156 ~~-~~iaai~~~~~~iy-GVQFHPEV~hT~~-G~~iL~NFl  193 (520)
                      ++ --++.|+-++.|+| |.|||||-+..++ +..+|.-|+
T Consensus       529 ~dg~l~EiiE~~~HP~FvA~QFHPEF~Srp~~p~plF~Gfv  569 (571)
T TIGR00337       529 PDGRLVEIIELPDHPFFVACQFHPEFTSRPNRPHPLFLGFV  569 (571)
T ss_pred             CCCCEEEEEEECCCCEEEEEECCCCCCCCCCCCCCCCHHHH
T ss_conf             99838999984797868886226751167788887505532


No 99 
>KOG2805 consensus
Probab=99.32  E-value=1.7e-11  Score=102.40  Aligned_cols=164  Identities=28%  Similarity=0.377  Sum_probs=106.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCC---------CCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-
Q ss_conf             4403664056404779999998622365699997389---------551562789999886236985799758899999-
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHG---------FMRKNEVENIISLFKGYPNFPLRVVDASERFIR-  291 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~G---------llRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-  291 (520)
                      -++|++|+||||||+|+|.||+++ |-+.+++|.-|=         --+...-+.+...-+ +++++++.|+..+.+.+ 
T Consensus         5 ~~~VvvamSgGVDSsVaa~Ll~~~-g~~v~gv~M~nWd~~de~~s~cp~e~D~~da~~Vc~-~LnI~~~~Vnf~kEYW~~   82 (377)
T KOG2805           5 PDRVVVAMSGGVDSSVAARLLAAR-GYNVTGVFMKNWDSLDEFGSQCPAERDWKDAKRVCK-QLNIPLHQVNFVKEYWND   82 (377)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHC-CCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHH-HHCCEEEEEEEHHHHHHH
T ss_conf             654899953771189999999741-887169966220122235668981120899999998-709702787437999999


Q ss_pred             ----H----HCCCC-CHHHHHHHHHHHHHHH--HHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCC--C
Q ss_conf             ----9----66898-8899998875658999--99999743997099864622024542024677763034430232--0
Q gi|254780414|r  292 ----K----LKNIV-DPETKRKVIGQLFIEV--FEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVG--G  358 (520)
Q Consensus       292 ----~----L~gv~-DPE~KRkiIG~~Fi~v--f~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvg--g  358 (520)
                          -    -.|-| .|.    |-.+.+|+.  |-+.|.+--+.+|||-|.-.--+.|-..  .+.++.--|.+-+-  .
T Consensus        83 Vfs~~L~~Y~~G~TPNPD----I~CN~~IKFg~~~~~a~en~~~d~latGHYAr~~~~~~~--~~~~~l~~~~d~~KDQt  156 (377)
T KOG2805          83 VFSPFLEEYENGRTPNPD----ILCNKHIKFGKFFKHAIENLGYDWLATGHYARVVLEDED--NAESHLLISKDMVKDQT  156 (377)
T ss_pred             HHHHHHHHHHCCCCCCCC----CCCCCEEECCHHHHHHHHHCCCCEEEEEEEEEEECCCCC--CCCEEEEECCCCCCCCE
T ss_conf             999998887658999997----134451421178999987558873774212144037556--76235761256667732


Q ss_pred             --H--HHHHCC-CHHHHHHHHHHHHHHHHHHHHCCCHHHHCC
Q ss_conf             --1--132032-022378987389999999981999889426
Q gi|254780414|r  359 --L--PEHMDM-KLVEPLKELFKDEVRLLGKELRLPDSFVER  395 (520)
Q Consensus       359 --l--p~~~~~-~liEPl~~l~KdEVR~lg~~Lglp~~~~~R  395 (520)
                        |  ...-++ +++-||-.|-|+|||+|+++.|+|  +..+
T Consensus       157 ~FL~~in~~~L~r~lfPlg~~~K~eVk~lA~~~gf~--~aeK  196 (377)
T KOG2805         157 YFLSTINQTQLKRLLFPLGCLTKSEVKKLAKQAGFP--NAEK  196 (377)
T ss_pred             EEEECCCHHHHHHHHCCCCCCCHHHHHHHHHHCCCC--CCCC
T ss_conf             676303699998620667656779999999865986--4568


No 100
>PRK05380 pyrG CTP synthetase; Validated
Probab=99.29  E-value=4.6e-12  Score=106.41  Aligned_cols=144  Identities=22%  Similarity=0.333  Sum_probs=87.8

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEE---ECCCCCCCE---------------
Q ss_conf             39979999853889999999753768980899889977899998997096999---869866103---------------
Q gi|254780414|r   49 QNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK---NSQSREFGR---------------  110 (520)
Q Consensus        49 ~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~---~~~~~EyG~---------------  110 (520)
                      .+.+||++.||-.+=--++.....+..-+.+||.||||+|||++...|-=.|.   .+...||..               
T Consensus       342 ~~~dGIlVPGGFG~RGiEGKI~Ai~yARen~IPfLGICLGMQ~avIEfARNVlgl~dAnStEfd~~t~~pVI~lm~eq~~  421 (534)
T PRK05380        342 KDVDGILVPGGFGERGIEGKILAIRYARENNIPFLGICLGMQLAVIEFARNVLGLEDANSTEFDPDTPHPVIDLMPEQKD  421 (534)
T ss_pred             HCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCEEEECHHHCC
T ss_conf             31882995787665431568999999998199811011223788999999845899973253589999986998823137


Q ss_pred             ------------EEEEECCCCCCCCCCCCCCCCEEEEEE--CCCHH-----HCC-CCCCCEEECCCC-CCEEEEEECCCC
Q ss_conf             ------------667523886222787266553368600--22011-----012-444211232398-317889863500
Q gi|254780414|r  111 ------------AFIEIKKNCSLLKGMWEKGSKQQVWMS--HGDQV-----EHI-PEGFEVIASSDS-TPFAFIADEKRK  169 (520)
Q Consensus       111 ------------~~I~i~~~~~lf~gl~~~~~~~~VwmS--H~D~V-----~~l-P~gf~viA~S~~-~~iaai~~~~~~  169 (520)
                                  ....+.+++..+ .+..  ....+.--  |.+.|     ..+ -.|+.+.+.|.+ .-++.++.++.|
T Consensus       422 ~~~~GGTMRLG~y~~~l~~gS~a~-~~Yg--~~~~I~ERHRHRYEvN~~y~~~le~~Gl~~sG~s~d~~lvEiiEl~~Hp  498 (534)
T PRK05380        422 VSDLGGTMRLGAYPCKLKPGTLAA-EIYG--KTEVIYERHRHRYEVNNKYREQLEKAGLVFSGTSPDGRLVEIIELPDHP  498 (534)
T ss_pred             CCCCCCEEECCCEEEEECCCCHHH-HHHC--CCCEECCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCC
T ss_conf             765666045164456756888999-9858--9981666456420018999999997897999998999878999868998


Q ss_pred             EE-EEEEEEHHHCCCH-HHHHHHHHHHH
Q ss_conf             11-2465212221520-25779987550
Q gi|254780414|r  170 YY-AVQFHPEVVHTVG-GSQLIDNFVHH  195 (520)
Q Consensus       170 iy-GVQFHPEV~hT~~-G~~iL~NFl~~  195 (520)
                      +| |+|||||-...+. ..-++..|+..
T Consensus       499 fFvg~QfHPEfkSrP~~PhPlF~~fI~A  526 (534)
T PRK05380        499 WFVGVQFHPEFKSRPRRPHPLFAGFVKA  526 (534)
T ss_pred             EEEEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             0899657766578999998369999999


No 101
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway. It belongs to the Adenosine Nucleotide Hydrolysis suoerfamily and predicted to bind to Adenosine nucleotide.
Probab=99.27  E-value=1.7e-11  Score=102.38  Aligned_cols=153  Identities=22%  Similarity=0.349  Sum_probs=102.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC----HHHHHHHHHH-CCCCCEEEEEHHHHHHHHHCCCCC
Q ss_conf             03664056404779999998622365699997389551562----7899998862-369857997588999999668988
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE----VENIISLFKG-YPNFPLRVVDASERFIRKLKNIVD  298 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE----~~~v~~~~~~-~~~~~l~~vda~~~Fl~~L~gv~D  298 (520)
                      ||++++||||||+|||.|+.|. |-++++++.+++..-..+    ..++.+.+.. .++.++..+..-...+..+.+-..
T Consensus         1 kvl~L~SGGiDS~VAa~ll~kr-G~~V~~l~f~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~g~   79 (177)
T cd01712           1 KALALLSGGIDSPVAAWLLMKR-GIEVDALHFNSGPFTSEKAREKVEDLARKLARYSPGHKLVVIIFTFFVQKEIYGYGK   79 (177)
T ss_pred             CEEEEECCCCHHHHHHHHHHHC-CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCC
T ss_conf             9899957781699999999987-998999999899988889999999999999994899628999453899999997088


Q ss_pred             HHHHHHHHHHH-HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHH
Q ss_conf             89999887565-89999999974399709986462202454202467776303443023201132032022378987389
Q gi|254780414|r  299 PETKRKVIGQL-FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKD  377 (520)
Q Consensus       299 PE~KRkiIG~~-Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~Kd  377 (520)
                       +.-+-+.-+- +.+..++.|+++ ++++++-|       ||-+..  .|.|.+   |-...-....+.++-||-.+-|+
T Consensus        80 -~~npcv~ckr~m~r~a~~~A~~~-ga~~IvTG-------e~lGQv--asqt~~---nl~~i~~~~~~~ilRPL~~~dK~  145 (177)
T cd01712          80 -EKYRCILCKRMMYRIAEKLAEEL-GADAIVTG-------ESLGQV--ASQTLE---NLLVISSGTDLPILRPLIGFDKE  145 (177)
T ss_pred             -CCCCCEEHHHHHHHHHHHHHHHC-CCCEEEEC-------CCHHHH--HHHHHH---HHHHHHHHHCCCCCCCCCCCCHH
T ss_conf             -88986362999999999999986-99899866-------522204--476899---99999874256421488899989


Q ss_pred             HHHHHHHHHCCCHH
Q ss_conf             99999998199988
Q gi|254780414|r  378 EVRLLGKELRLPDS  391 (520)
Q Consensus       378 EVR~lg~~Lglp~~  391 (520)
                      |+|++++++|+-+-
T Consensus       146 EI~~~A~~igt~~~  159 (177)
T cd01712         146 EIIGIARRIGTYDI  159 (177)
T ss_pred             HHHHHHHHHCCHHH
T ss_conf             99999998096744


No 102
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]
Probab=99.26  E-value=1.4e-11  Score=102.99  Aligned_cols=141  Identities=22%  Similarity=0.333  Sum_probs=86.1

Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEE---ECCCCCCCE-----------------
Q ss_conf             979999853889999999753768980899889977899998997096999---869866103-----------------
Q gi|254780414|r   51 PQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK---NSQSREFGR-----------------  110 (520)
Q Consensus        51 p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~---~~~~~EyG~-----------------  110 (520)
                      .+||++.||-..=--++.....+...+.++|.||||+|||+....|--+|.   .+...|+..                 
T Consensus       344 ~dgIlVPGGFG~RG~eGkI~Ai~yAREn~iP~lGIClGmQ~aviE~ARnv~Gl~~AnS~Efdp~t~~pVv~l~~eq~~~~  423 (533)
T COG0504         344 VDGILVPGGFGYRGVEGKIAAIRYARENNIPFLGICLGMQLAVIEFARNVLGLEGANSTEFDPDTKYPVVDLMPEQKDVV  423 (533)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCCCCCCC
T ss_conf             88799689877675588999999998669986888566789999999985197657643548899986588335423677


Q ss_pred             ----------EEEEECCCCCCCCCCCCCCCCEEEEEE--CCCHH-----HCCC-CCCCEEECCCC-CCEEEEEECCCCEE
Q ss_conf             ----------667523886222787266553368600--22011-----0124-44211232398-31788986350011
Q gi|254780414|r  111 ----------AFIEIKKNCSLLKGMWEKGSKQQVWMS--HGDQV-----EHIP-EGFEVIASSDS-TPFAFIADEKRKYY  171 (520)
Q Consensus       111 ----------~~I~i~~~~~lf~gl~~~~~~~~VwmS--H~D~V-----~~lP-~gf~viA~S~~-~~iaai~~~~~~iy  171 (520)
                                ....+..++ +...+..   ...|+--  |.+.|     ..+- .|+++.+.|.+ ..+++++..+.|+|
T Consensus       424 ~lGGTmRLG~y~~~l~~gT-~a~~lY~---~~~v~ERHRHRYEvN~~y~~~le~~Gl~~sg~s~d~~lvEivE~~~hpfF  499 (533)
T COG0504         424 DLGGTMRLGAYPCRLKPGT-LAAKLYG---KDEIYERHRHRYEVNNDYRDQLEKAGLVFSGTSPDGGLVEIVELPDHPFF  499 (533)
T ss_pred             CCCCEEECCCEEEECCCCC-HHHHHHC---CCCEEEECCCHHHCCHHHHHHHHHCCEEEEEECCCCCEEEEEECCCCCEE
T ss_conf             6775004166101127886-8998738---77140021531330889999998689699998689986899983899648


Q ss_pred             -EEEEEEHHHCCCH-HHHHHHHHHHH
Q ss_conf             -2465212221520-25779987550
Q gi|254780414|r  172 -AVQFHPEVVHTVG-GSQLIDNFVHH  195 (520)
Q Consensus       172 -GVQFHPEV~hT~~-G~~iL~NFl~~  195 (520)
                       |+|||||-+..+. ..-++..|+.-
T Consensus       500 v~~QfHPEf~SrP~~phPlf~~fv~A  525 (533)
T COG0504         500 VATQFHPEFKSRPLRPHPLFVGFVKA  525 (533)
T ss_pred             EEECCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             98746631347899998347999999


No 103
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232   This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily ..
Probab=99.25  E-value=1.9e-09  Score=87.80  Aligned_cols=224  Identities=24%  Similarity=0.295  Sum_probs=152.3

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECC-CCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHH
Q ss_conf             99999976504440366405640477999999862236569999738-95515627899998862369857997588999
Q gi|254780414|r  211 EIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDH-GFMRKNEVENIISLFKGYPNFPLRVVDASERF  289 (520)
Q Consensus       211 ~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~-GllRknE~~~v~~~~~~~~~~~l~~vda~~~F  289 (520)
                      ..-..++++..+++||.|.|||||||.+|+++....|-+..||+|-+ -+.-.-|-++-...=+. +|++...|.--..-
T Consensus         4 ~L~~fl~~kf~nk~~~IAySGGvDS~lla~v~~~v~g~~~lait~~sP~~sp~~el~~A~~~A~~-~g~~he~~~~d~~~   82 (263)
T TIGR00268         4 NLRNFLKEKFKNKKVLIAYSGGVDSSLLAAVCSDVAGTEVLAITVVSPSISPRRELEDAKAIAKE-IGVKHELVKIDKMA   82 (263)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHH-HCCCEEEECCCCCC
T ss_conf             88889876764081699951746589999999875310113578762775735448999999988-08301211001236


Q ss_pred             HHHHCCCC-CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHH
Q ss_conf             99966898-88999988756589999999974399709986462202454202467776303443023201132032022
Q gi|254780414|r  290 IRKLKNIV-DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV  368 (520)
Q Consensus       290 l~~L~gv~-DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~li  368 (520)
                      -.   .-+ ++|+.==--=+.|.+...++|.+. +.++...||=|.|+-+.-.  |              +--.-.+...
T Consensus        83 n~---~f~~N~~~RCY~CK~~~~~~L~~~a~~~-gy~~V~dGtN~dDL~~~RP--G--------------~~A~~E~~g~  142 (263)
T TIGR00268        83 NP---NFRANVEERCYFCKKKVLSILVKLAEKR-GYDVVVDGTNADDLEDHRP--G--------------LRAVKELNGV  142 (263)
T ss_pred             CC---CCCCCCCCCCHHHHHHHHHHHHHHHHHC-CCCEEEECCCCCCCCCCCC--H--------------HHHHHHCCCC
T ss_conf             85---0016885444154888999989999863-9957982346200023675--1--------------3567660788


Q ss_pred             -HHHHHH--HHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEEC--CCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             -378987--3899999999819998894268889831112210--00367899999999999999998646533322010
Q gi|254780414|r  369 -EPLKEL--FKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCI--GEITEERINILRESDAIYREEIHKAGIYRKIWQAF  443 (520)
Q Consensus       369 -EPl~~l--~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~--g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~q~~  443 (520)
                       =|+.+|  -|.|||++++.||+|=   |--|= -|=|+-|+.  -||+.|+|..+-+|..+|++.              
T Consensus       143 ~SP~aef~I~K~eir~ia~~lg~~~---~DKP~-~~CL~sR~p~g~EI~~ekL~~v~eaE~~~l~~--------------  204 (263)
T TIGR00268       143 YSPWAEFGITKKEIREIAKSLGLSF---YDKPS-EACLASRFPFGEEIDVEKLKKVDEAEEIVLRR--------------  204 (263)
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCC---CCCCC-CCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH--------------
T ss_conf             6872002568799999999748898---88866-21021047687510489877699999999998--------------


Q ss_pred             EEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             455686324215998541447999632168775587101898999987557
Q gi|254780414|r  444 TVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIR  494 (520)
Q Consensus       444 avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta~~~~~~~~~l~~is~~  494 (520)
                         +-.+.|=|    |.|..+.++              ++|-|-|+++-+.
T Consensus       205 ---~g~~qvRV----R~y~nlAvi--------------E~~~~~l~kl~~~  234 (263)
T TIGR00268       205 ---AGVKQVRV----RNYDNLAVI--------------EVAEDELSKLLNE  234 (263)
T ss_pred             ---HCCCCEEE----ECCCCEEEE--------------EECHHHHHHHHHH
T ss_conf             ---35660576----526765799--------------6285889999863


No 104
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI). ThiI is required for thiazole synthesis, required for thiamine biosynthesis.
Probab=99.25  E-value=1.5e-10  Score=95.67  Aligned_cols=156  Identities=24%  Similarity=0.306  Sum_probs=111.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHH----HHHHC---CCCCEEEEEHHHHHHHHHC
Q ss_conf             4403664056404779999998622365699997389551562789999----88623---6985799758899999966
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIIS----LFKGY---PNFPLRVVDASERFIRKLK  294 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~----~~~~~---~~~~l~~vda~~~Fl~~L~  294 (520)
                      .+||++++|||+||.|||.|+.|. |-++++++.+++...-.+..+...    .+++.   ..+++++||..+....-..
T Consensus         3 ~gk~l~LlSGGiDSpVAa~lmmkR-G~~V~~vhf~~~p~~~~~~~~k~~~l~~~l~~y~~~~~~~l~vv~~~~~~~~i~~   81 (197)
T pfam02568         3 QGKVLALLSGGIDSPVAAYLMMRR-GCRVVALHFINEPGTSEEAIEKVRKLAELLAEYGTSCEGKLVVVDFTKVQKEIIE   81 (197)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHC-CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHH
T ss_conf             771898866871299999999987-9979999987999998999999999999999737887544999574999999996


Q ss_pred             CCCCHHHHHHHHHHHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHH
Q ss_conf             89888999988756589-99999997439970998646220245420246777630344302320113203202237898
Q gi|254780414|r  295 NIVDPETKRKVIGQLFI-EVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKE  373 (520)
Q Consensus       295 gv~DPE~KRkiIG~~Fi-~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~  373 (520)
                      ...+..  |-++-+.|+ +..++.|++. +++++.-|       ||-+...  |.|+.   |....-....+-++.||--
T Consensus        82 ~~~~~~--~cv~cKr~M~r~A~~iA~~~-ga~~IVTG-------EsLGQVa--SQTl~---nl~~i~~~~~~pilRPLig  146 (197)
T pfam02568        82 KAPEKY--RCVLCKRCMYRAAEKVAEEE-GADALVTG-------ESLGQVA--SQTLD---NLRVISAATNLPILRPLIG  146 (197)
T ss_pred             CCCCCC--EEHHHHHHHHHHHHHHHHHC-CCCEEEEC-------CCHHHHH--HCCCC---HHHHHHHHHCCCCCCCCCC
T ss_conf             289876--54569999999999999984-99899847-------3031210--04531---0699987624853134346


Q ss_pred             HHHHHHHHHHHHHCCCHHHH
Q ss_conf             73899999999819998894
Q gi|254780414|r  374 LFKDEVRLLGKELRLPDSFV  393 (520)
Q Consensus       374 l~KdEVR~lg~~Lglp~~~~  393 (520)
                      +=|+|++++++++|.=+--+
T Consensus       147 ~DK~EIi~~Ar~IGt~~~s~  166 (197)
T pfam02568       147 LDKEEIINLAKEIGTYEISI  166 (197)
T ss_pred             CCHHHHHHHHHHHCCHHHHC
T ss_conf             99999999999948677662


No 105
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]
Probab=99.24  E-value=5e-10  Score=91.86  Aligned_cols=158  Identities=25%  Similarity=0.286  Sum_probs=113.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCC-CEEEEEECCCCCCCC--CHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCC
Q ss_conf             440366405640477999999862236-569999738955156--27899998862369857997588999999668988
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGI-NLTCVLVDHGFMRKN--EVENIISLFKGYPNFPLRVVDASERFIRKLKNIVD  298 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~-~l~~vfVD~GllRkn--E~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~D  298 (520)
                      +++|+.|+|||.||++++.++++.-+. ++.+++||||+.-..  +.+.+ +.+.+.+++++++.+....+......-..
T Consensus        21 ~~~ilVavSGGkDS~~ll~~L~~l~~~~~~~a~~Vd~~~~~~~~~~~~~~-~~~~~~~~~~~~v~~~~~~~~~~~~~~~~   99 (298)
T COG0037          21 EYKILVAVSGGKDSLALLHLLKELGRRIEVEAVHVDHGLRGYSDQEAELV-EKLCEKLGIPLIVERVTDDLGRETLDGKS   99 (298)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHH-HHHHHHCCCCEEEEEHHHHHHHCCCCCCC
T ss_conf             78589993787899999999998422573899997089886432899999-99999649984886204543100246767


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC---CCCCCCEEEEEECCCCHHHHH---CC-CHHHHH
Q ss_conf             89999887565899999999743997099864622024542024---677763034430232011320---32-022378
Q gi|254780414|r  299 PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF---FGGPSSIIKSHHNVGGLPEHM---DM-KLVEPL  371 (520)
Q Consensus       299 PE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~---~~~~~~~IKsHHNvgglp~~~---~~-~liEPl  371 (520)
                      |+..   -+..=-..|.+.|++. +++.++.|.--.|.+|..--   .|+.....+      +.|...   .. .++.||
T Consensus       100 ~c~~---c~~~R~~~l~~~a~~~-g~~~i~tgH~~dD~~et~lm~l~~g~~~~~l~------~~~~~~~~~~~~~~iRPL  169 (298)
T COG0037         100 ICAA---CRRLRRGLLYKIAKEL-GADKIATGHHLDDQAETFLMNLLRGSGLRGLR------GMPPKRPFEGGLLIIRPL  169 (298)
T ss_pred             HHHH---HHHHHHHHHHHHHHHC-CCCEEEECCCHHHHHHHHHHHHHCCCCHHHHH------CCCCCCCCCCCCEEECCC
T ss_conf             8799---9999999999999985-99989856784689999999986175224564------088524457886454757


Q ss_pred             HHHHHHHHHHHHHHHCCCH
Q ss_conf             9873899999999819998
Q gi|254780414|r  372 KELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       372 ~~l~KdEVR~lg~~Lglp~  390 (520)
                      ....+.|++......|||-
T Consensus       170 ~~~~~~ei~~~~~~~~l~~  188 (298)
T COG0037         170 LYVREKEIELYAKEKGLPY  188 (298)
T ss_pred             CCCCHHHHHHHHHHCCCCE
T ss_conf             4688999999999759987


No 106
>pfam01171 ATP_bind_3 PP-loop family. This family of proteins belongs to the PP-loop superfamily.
Probab=99.21  E-value=2.3e-10  Score=94.25  Aligned_cols=152  Identities=30%  Similarity=0.409  Sum_probs=102.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH---CCCCEEEEEECCCCC--CCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCC
Q ss_conf             0366405640477999999862---236569999738955--15627899998862369857997588999999668988
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEA---IGINLTCVLVDHGFM--RKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVD  298 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kA---ig~~l~~vfVD~Gll--RknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~D  298 (520)
                      ||++|+|||+||++++.++++.   .+-++++++||||+-  ...|.+.|.+..+ .+|+++.+..-..   ....+..-
T Consensus         1 ki~vavSGG~DS~~Ll~~l~~~~~~~~~~~~~~hvnh~lr~~s~~~~~~v~~~~~-~~~i~~~i~~~~~---~~~~~~~~   76 (182)
T pfam01171         1 KILVAVSGGPDSMALLYLLKKLKPKFGIDLTAAHVDHGLREESDREAQFVKELCR-QLNIPLEVLRVDV---AKKSGLNL   76 (182)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHH-HCCCCEEEEEEEC---CCCCCCCH
T ss_conf             9999967859999999999999997599789999879986540589999999999-8599759999734---76678777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC---CCCCCCEEEEEECCCCHHHHH---CCCHHHHHH
Q ss_conf             89999887565899999999743997099864622024542024---677763034430232011320---320223789
Q gi|254780414|r  299 PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF---FGGPSSIIKSHHNVGGLPEHM---DMKLVEPLK  372 (520)
Q Consensus       299 PE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~---~~~~~~~IKsHHNvgglp~~~---~~~liEPl~  372 (520)
                      .+.-|++ -   .+.|.+.+++. ++.+++.|.-.-|.+|+---   .|+...      +..|+|...   ...++-||-
T Consensus        77 e~~aR~~-R---y~~l~~~a~~~-~~~~i~lgHh~DD~~ET~lm~l~rG~~~~------gl~gm~~~~~~~~~~iiRPLl  145 (182)
T pfam01171        77 EEAAREA-R---YDFFEEIAKKN-GAEVLLTAHHADDQAETFLMRLLRGSGLA------GLAGIAPVRPLAGGRIVRPLL  145 (182)
T ss_pred             HHHHHHH-H---HHHHHHHHHHH-CCCEEEEECCCCHHHHHHHHHHHCCCCCC------CCCCCCCCCCCCCCEEECCCC
T ss_conf             5789999-9---99999989861-76648874342329999999997289811------033887513468943870211


Q ss_pred             HHHHHHHHHHHHHHCCCH
Q ss_conf             873899999999819998
Q gi|254780414|r  373 ELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       373 ~l~KdEVR~lg~~Lglp~  390 (520)
                      .+.|+|.++..+..+||-
T Consensus       146 ~~~k~ei~~~a~~~~l~~  163 (182)
T pfam01171       146 KVTKSEIEEYLKEHGIPW  163 (182)
T ss_pred             CCCHHHHHHHHHHCCCCE
T ss_conf             488999999999869936


No 107
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domainhas  a strongly conserved motif SGGKD at the N terminus.
Probab=99.16  E-value=3.8e-10  Score=92.71  Aligned_cols=155  Identities=23%  Similarity=0.348  Sum_probs=97.8

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH-----CCCCEEEEEECCCCCCCCCH--HHHHHHHHHCCCCCEEEEEHHHHHHHHHCCC
Q ss_conf             0366405640477999999862-----23656999973895515627--8999988623698579975889999996689
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEA-----IGINLTCVLVDHGFMRKNEV--ENIISLFKGYPNFPLRVVDASERFIRKLKNI  296 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kA-----ig~~l~~vfVD~GllRknE~--~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv  296 (520)
                      ||++|+|||+||+|++.|+++-     .+-++++++||||+ |.+..  ++..+.+...+++++..+...+..    ...
T Consensus         1 kilva~SGG~DS~~Ll~ll~~~~~~~~~~~~l~~~hvnh~~-r~~s~~~~~~v~~~~~~~~i~~~~~~~~~~~----~~~   75 (185)
T cd01993           1 RILVALSGGKDSLVLLHVLKKLQRRYPYGFELEALTVDEGI-PGYRDESLEVVERLAEELGIELEIVSFKEEY----TDD   75 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC-CCCCHHHHHHHHHHHHHCCCCEEEEEEEECC----CCC
T ss_conf             98999658499999999999988864889569999956998-8888999999999899629935998764036----763


Q ss_pred             CCHHHHHH-H---H-HHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC---CCCCCCEEEEEECCCCHHHH-H---C
Q ss_conf             88899998-8---7-565899999999743997099864622024542024---67776303443023201132-0---3
Q gi|254780414|r  297 VDPETKRK-V---I-GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF---FGGPSSIIKSHHNVGGLPEH-M---D  364 (520)
Q Consensus       297 ~DPE~KRk-i---I-G~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~---~~~~~~~IKsHHNvgglp~~-~---~  364 (520)
                      ...++.+. -   . ++.=-..|.+.+++. ++.+|+-|.=.-|.+|..--   .|+.....+      +.|.. .   .
T Consensus        76 ~~~~~~~~~~~c~~c~r~Rr~~l~~~~~~~-~~~~i~~gHh~dD~~ET~l~~l~rg~~~~~~~------~~~~~~~~~~~  148 (185)
T cd01993          76 IEVKKRGGKSPCSLCGVLRRGLLNKIAKEL-GADKLATGHNLDDEAETLLMNLLRGGILRLMR------PGPILYLDEGD  148 (185)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHHHHHHCCCCHHHCC------CCCCCCCCCCC
T ss_conf             899998640634689999999999999981-99889753307689999999998489700056------76633356898


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             20223789873899999999819998
Q gi|254780414|r  365 MKLVEPLKELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       365 ~~liEPl~~l~KdEVR~lg~~Lglp~  390 (520)
                      .+++-||-++-|+|.++..++.+||-
T Consensus       149 i~iiRPLL~~~k~ei~~y~~~~~l~~  174 (185)
T cd01993         149 VTRIRPLVYVREKEIVLYAELNGLPF  174 (185)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCE
T ss_conf             47995498898999999999879987


No 108
>PRK01175 phosphoribosylformylglycinamidine synthase subunit I; Provisional
Probab=99.15  E-value=1.5e-09  Score=88.54  Aligned_cols=189  Identities=20%  Similarity=0.286  Sum_probs=116.7

Q ss_pred             CCCEEEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHCCCCEEEECCCCCC--CCCCCC-------CCCCH-
Q ss_conf             4886999988-970578899888865940698528989-88997239979999853889--999999-------75376-
Q gi|254780414|r    6 RSSKVLIIDF-GSQFTQLIARRVRESKVYCEVIAFKNA-LDYFKEQNPQAIILSGSPAS--SLDIDS-------PQIPK-   73 (520)
Q Consensus         6 ~~~~IlIlDf-GSQytqLIaRriRelgVyseI~P~~~~-~e~i~~~~p~GIILSGGP~S--V~d~~a-------p~~~~-   73 (520)
                      +++||+||-| ||.--.-.++.++..|.-++.+..+.. ...-...++++|++.||=+-  +...++       |.+.+ 
T Consensus         2 ~~PkvaIl~fpGsNcd~e~~~Af~~aG~~~~~v~~~dl~~~~~~L~~~~~lv~pGGFSyGD~l~aG~~~a~~~~~~~~~~   81 (255)
T PRK01175          2 ESPKVGVLRMEGTNNETEVFKSVRRSGGEPEYVHINDLAAGRKSVSDYDCLIIPGGFSAGDYIRAGAIFAARLKAVLGKD   81 (255)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99869999658648199999999985996389986523367666555548997377676433575188999867999999


Q ss_pred             --HHHHCCCCEEEECHHHHHHHHH--CCC-----EEEECCCCCC--CEEEEEECCCCCC-CCCCCCCCCCEEEEEECCCH
Q ss_conf             --8980899889977899998997--096-----9998698661--0366752388622-27872665533686002201
Q gi|254780414|r   74 --EILESNIPLLGICYGQQIMCQS--LGG-----KTKNSQSREF--GRAFIEIKKNCSL-LKGMWEKGSKQQVWMSHGDQ  141 (520)
Q Consensus        74 --~I~~~~iPILGICyG~QlLa~~--~GG-----~V~~~~~~Ey--G~~~I~i~~~~~l-f~gl~~~~~~~~VwmSH~D~  141 (520)
                        +.++.+.||||||=|+|+|.+.  +-|     ...+.....|  -+..+.+.+++++ ++++.  .....+|.+|++.
T Consensus        82 i~~f~~~g~~vLGICNGfQiL~e~gLLPg~~~~~~L~~N~s~rF~~r~v~l~v~~~~~~f~~~~~--~~~l~ipvAHgEG  159 (255)
T PRK01175         82 IREFIDSGRPIIGICNGFQVLMELGLIPAERPEIALTNNESNRFECRYTYIKMTSEKCIFVKNLG--KGVFQVPVAHAEG  159 (255)
T ss_pred             HHHHHHCCCCEEEECCHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCHHHHHCCC--CCEEEEEEECCCC
T ss_conf             99999679967998016899997587789998802024799987867879999448346664148--9779987553768


Q ss_pred             H---------HCCCC-CCCEEEC------------CCCC---CEEEEEECCCCEEEEEEEEHHHC-------------CC
Q ss_conf             1---------01244-4211232------------3983---17889863500112465212221-------------52
Q gi|254780414|r  142 V---------EHIPE-GFEVIAS------------SDST---PFAFIADEKRKYYAVQFHPEVVH-------------TV  183 (520)
Q Consensus       142 V---------~~lP~-gf~viA~------------S~~~---~iaai~~~~~~iyGVQFHPEV~h-------------T~  183 (520)
                      =         .++-+ +-.++-.            +.|+   .||+|.+++.+++|++=|||=.-             ..
T Consensus       160 rf~~~~~~~l~~l~~n~qi~~rY~d~~G~~~~yp~NPNGS~~~IAGI~n~~GrvlgmMPHPER~~~~~q~~~~~~~~~~g  239 (255)
T PRK01175        160 RVAVSEDSVLKRLYENDQIVFRYVDENGVYDGYPWNPNGSIDNIAGITNETGNVIGLMPHPERIYYGYQAMYNERRKDYG  239 (255)
T ss_pred             CEEECCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHCEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             55758989999998589658999669986457888998797672086789999988789963256465588786667778


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             0257799875501
Q gi|254780414|r  184 GGSQLIDNFVHHV  196 (520)
Q Consensus       184 ~G~~iL~NFl~~I  196 (520)
                      .|..|++|.+--+
T Consensus       240 ~g~~~F~nav~~~  252 (255)
T PRK01175        240 TGKIFFRSLVNYL  252 (255)
T ss_pred             CHHHHHHHHHHHH
T ss_conf             6999999999999


No 109
>PRK03619 phosphoribosylformylglycinamidine synthase subunit I; Provisional
Probab=99.13  E-value=2.4e-09  Score=86.98  Aligned_cols=180  Identities=21%  Similarity=0.325  Sum_probs=115.4

Q ss_pred             EEEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCC--CCCCCCC----CCCHH---HHHC
Q ss_conf             6999988-97057889988886594069852898988997239979999853889--9999997----53768---9808
Q gi|254780414|r    9 KVLIIDF-GSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPAS--SLDIDSP----QIPKE---ILES   78 (520)
Q Consensus         9 ~IlIlDf-GSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~S--V~d~~ap----~~~~~---I~~~   78 (520)
                      ||+||-| ||.=-.-.++.++..|..++.+-++.  +  ...+++++++.||=+-  +...++.    .+.++   ..+.
T Consensus         2 kvaIl~~pGsNcd~e~~~Af~~~G~~~~~v~~~d--~--~L~~~~~lv~pGGFSyGD~L~aGaia~~~~i~~~i~~f~~~   77 (223)
T PRK03619          2 KIAVITFPGTNCDVDMAHAIRLAGAEPVYVWHTD--T--DLDGVDAVVLPGGFSYGDYLRCGAIAAFAPVMQAVVEAAEK   77 (223)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCCCCEEEEEECC--C--CCCCCCEEEECCCCCCCCCCCCCHHHHHCHHHHHHHHHHHC
T ss_conf             6999971764949999999998699569998447--9--87645389983500565345533476527899999999867


Q ss_pred             CCCEEEECHHHHHHHHH--CCCEEEECCCCCC--CEEEEEECC-CCCCCCCCCCCCCCEEEEEECCCH--------HHCC
Q ss_conf             99889977899998997--0969998698661--036675238-862227872665533686002201--------1012
Q gi|254780414|r   79 NIPLLGICYGQQIMCQS--LGGKTKNSQSREF--GRAFIEIKK-NCSLLKGMWEKGSKQQVWMSHGDQ--------VEHI  145 (520)
Q Consensus        79 ~iPILGICyG~QlLa~~--~GG~V~~~~~~Ey--G~~~I~i~~-~~~lf~gl~~~~~~~~VwmSH~D~--------V~~l  145 (520)
                      +.|+||||=|+|+|+..  +-|...+.....|  -+..+++.+ +++.++++ +......+|.+|++.        +.++
T Consensus        78 g~~vLGICNGfQiL~e~gLlPgaL~~N~s~rF~~r~v~lkv~~~~s~f~~~~-~~g~~l~ipVAHgEGr~~~~~~~l~~l  156 (223)
T PRK03619         78 GKPVLGICNGFQILLEAGLLPGALTRNENLKFICRDVKLRVENNDTAFTSRY-EKGEVIRIPIAHGEGNYYADEETLKEL  156 (223)
T ss_pred             CCCEEEECHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCHHCCC-CCCCEEEEEEECCCCCEECCHHHHHHH
T ss_conf             9977998727898986477886210269998798656788658984010378-999889887244875335599999999


Q ss_pred             CC-CCCEEECC----CCC---CEEEEEECCCCEEEEEEEEHHHC-----CCHHHHHHHHHH
Q ss_conf             44-42112323----983---17889863500112465212221-----520257799875
Q gi|254780414|r  146 PE-GFEVIASS----DST---PFAFIADEKRKYYAVQFHPEVVH-----TVGGSQLIDNFV  193 (520)
Q Consensus       146 P~-gf~viA~S----~~~---~iaai~~~~~~iyGVQFHPEV~h-----T~~G~~iL~NFl  193 (520)
                      -+ +-.++-+.    .|+   .||+|.+++.+++|++=|||=.-     +..|..|++|-+
T Consensus       157 ~~~~qi~~~Y~d~~NPNGS~~~IAGI~~~~GrvlgmMPHPERa~~~~~g~~dG~~~f~s~v  217 (223)
T PRK03619        157 EGNGQVVFRYVDETNPNGSVNDIAGICNENGNVLGLMPHPERAVEALLGSDDGLKLFKSAL  217 (223)
T ss_pred             HHCCCEEEEECCCCCCCCCHHHHHEEECCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             9789789998999999889646528587999998888996446355447861499999999


No 110
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This domain has  a strongly conserved motif SGGXD at the N terminus.
Probab=99.08  E-value=6.1e-10  Score=91.30  Aligned_cols=150  Identities=28%  Similarity=0.391  Sum_probs=100.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHC---CCCEEEEEECCCCCCCC---CHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCC
Q ss_conf             03664056404779999998622---36569999738955156---2789999886236985799758899999966898
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAI---GINLTCVLVDHGFMRKN---EVENIISLFKGYPNFPLRVVDASERFIRKLKNIV  297 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAi---g~~l~~vfVD~GllRkn---E~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~  297 (520)
                      ||++|+|||+||.+++.++++..   +-++++++||||+ |.+   |.+.|.+..+ .+++++.+.+....   . +.-.
T Consensus         1 ki~vavSGG~DS~~Ll~~l~~~~~~~~~~l~a~hvdh~l-r~~s~~~~~~v~~~~~-~~~i~~~i~~~~~~---~-~~~~   74 (185)
T cd01992           1 KILVAVSGGPDSMALLHLLSELKPRLGLRLVAVHVDHGL-RPESDEEAAFVADLCA-KLGIPLYILVVALA---P-KPGG   74 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCC-CCCCHHHHHHHHHHHH-HCCCCEEEEEEEEC---C-CCCC
T ss_conf             999996784999999999999999749948999981898-8888899999999999-85998899997753---6-7899


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC---CCCCCCEEEEEECCCCHHHHH---CCCHHHHH
Q ss_conf             889999887565899999999743997099864622024542024---677763034430232011320---32022378
Q gi|254780414|r  298 DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF---FGGPSSIIKSHHNVGGLPEHM---DMKLVEPL  371 (520)
Q Consensus       298 DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~---~~~~~~~IKsHHNvgglp~~~---~~~liEPl  371 (520)
                      ..|+.-+..-   .+.|.+.+++. +..+++-|.=.-|.+|+---   .|+...      ...|+|...   ..+++-||
T Consensus        75 ~~e~~aR~~R---y~~l~~~~~~~-~~~~i~lgHh~dD~~ET~lm~l~rg~~~~------gl~gm~~~~~~~~~~iiRPL  144 (185)
T cd01992          75 NLEAAAREAR---YDFFAEIAKEH-GADVLLTAHHADDQAETVLMRLLRGSGLR------GLAGMPARIPFGGGRLIRPL  144 (185)
T ss_pred             CHHHHHHHHH---HHHHHHHHHHH-CCCCEEECCCHHHHHHHHHHHHHCCCCCC------CCCCCCCCCCCCCCEEEEHH
T ss_conf             9999999999---99999999873-54504203630368999999987189964------15277841357995287157


Q ss_pred             HHHHHHHHHHHHHHHCCC
Q ss_conf             987389999999981999
Q gi|254780414|r  372 KELFKDEVRLLGKELRLP  389 (520)
Q Consensus       372 ~~l~KdEVR~lg~~Lglp  389 (520)
                      -.+.|+|.++..+..+||
T Consensus       145 L~~~k~ei~~~~~~~~i~  162 (185)
T cd01992         145 LGITRAEIEAYLRENGLP  162 (185)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             785399999999984995


No 111
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase. Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase (FGAR-AT). FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, Pi, and glutamate in the fourth step of the purine biosynthetic pathway. FGAR-AT is a glutamine amidotransferase. Glutamine amidotransferase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. FGAR-AT belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site
Probab=99.05  E-value=1.3e-08  Score=81.88  Aligned_cols=180  Identities=22%  Similarity=0.318  Sum_probs=107.3

Q ss_pred             EEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCCCHH-HHHHCCCCEEEECCCCCCCCC---C-----CCCCCCHHH---H
Q ss_conf             999988-97057889988886594069852898988-997239979999853889999---9-----997537689---8
Q gi|254780414|r   10 VLIIDF-GSQFTQLIARRVRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASSLD---I-----DSPQIPKEI---L   76 (520)
Q Consensus        10 IlIlDf-GSQytqLIaRriRelgVyseI~P~~~~~e-~i~~~~p~GIILSGGP~SV~d---~-----~ap~~~~~I---~   76 (520)
                      |+||-| ||.=-.-.++.++..|..++.+.++...+ .....+++++++.||=+ --|   .     .+|.+.+.+   .
T Consensus         1 VaVl~~pGsNcd~e~~~Af~~aG~~~~~V~~~dl~~~~~~L~~~~~lv~pGGFS-yGD~l~ag~~~a~s~~~~~~l~~f~   79 (238)
T cd01740           1 VAVLRFPGSNCDRDMAYAFELAGFEAEDVWHNDLLAGRKDLDDYDGVVLPGGFS-YGDYLRAGAIAAASPLLMEEVKEFA   79 (238)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEEECCCCC-CCCCCCHHHHHHHCCCHHHHHHHHH
T ss_conf             989991884988999999998699269998101656646611075899868667-7666555678874811308999975


Q ss_pred             HCCCCEEEECHHHHHHHHH--CCCEEEECCCCCC------CEEEEEECC-CCCCCCCCCCCCCCEEEEEECCCH------
Q ss_conf             0899889977899998997--0969998698661------036675238-862227872665533686002201------
Q gi|254780414|r   77 ESNIPLLGICYGQQIMCQS--LGGKTKNSQSREF------GRAFIEIKK-NCSLLKGMWEKGSKQQVWMSHGDQ------  141 (520)
Q Consensus        77 ~~~iPILGICyG~QlLa~~--~GG~V~~~~~~Ey------G~~~I~i~~-~~~lf~gl~~~~~~~~VwmSH~D~------  141 (520)
                      +.+.|+||||=|+|+|.+.  +.|...+.....|      -+..+.+.+ ++..++++ .......+|.+|++.      
T Consensus        80 ~~g~~vLGICNGfQiL~~lGllpg~~~~n~~~~~~~~~~~r~v~l~v~~~~s~f~~~~-~~g~~l~ipvaHgEGr~~~~~  158 (238)
T cd01740          80 ERGGLVLGICNGFQILVELGLLPGALIRNKGLKFICRWQNRFVTLRVENNDSPFTKGY-MEGEVLRIPVAHGEGRFYADD  158 (238)
T ss_pred             CCCCEEEEECHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCHHHHCC-CCCCEEEEEEECCCEEEECCH
T ss_conf             4897489853056788870677850014877654675600579999789998677165-789888888753723597182


Q ss_pred             --HHCCCCCCCEE-------------ECCCCC---CEEEEEECCCCEEEEEEEEHHHC----------CCHHHHHHHH
Q ss_conf             --10124442112-------------323983---17889863500112465212221----------5202577998
Q gi|254780414|r  142 --VEHIPEGFEVI-------------ASSDST---PFAFIADEKRKYYAVQFHPEVVH----------TVGGSQLIDN  191 (520)
Q Consensus       142 --V~~lP~gf~vi-------------A~S~~~---~iaai~~~~~~iyGVQFHPEV~h----------T~~G~~iL~N  191 (520)
                        +.++-+.-.++             -.+.|+   .||+|.+.+.+++|++-|||-.-          ...|.+|++|
T Consensus       159 ~~l~~l~~~~~i~~~~~~~~~~~~~yP~NPNGS~~~IAGI~s~~GrvlgmMPHPER~~~~~q~~~~~~~~~g~~~F~n  236 (238)
T cd01740         159 ETLAELEENGQIAQYVDDDGNVTERYPANPNGSLDGIAGICNEDGRVLGMMPHPERAVEPWQWERLLGGSDGLKLFRN  236 (238)
T ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHCEEEEECCCCCEEEECCCHHHHCCCCCCCCCCCCCCHHHHHHH
T ss_conf             878999867956999957998022688899888202127887999999974785773065556567889818999975


No 112
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]
Probab=98.98  E-value=4.4e-08  Score=78.01  Aligned_cols=184  Identities=21%  Similarity=0.330  Sum_probs=119.0

Q ss_pred             CCEEEEEECCCCHHHH-HHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCC--CCCCCCC----CCCCH---HHH
Q ss_conf             8869999889705788-998888659406985289898899723997999985388--9999999----75376---898
Q gi|254780414|r    7 SSKVLIIDFGSQFTQL-IARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA--SSLDIDS----PQIPK---EIL   76 (520)
Q Consensus         7 ~~~IlIlDfGSQytqL-IaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~--SV~d~~a----p~~~~---~I~   76 (520)
                      ..||+|+-|-..-.+. .++.++.+|...+.+.++...   ...+++++++-||=+  -+...++    +.+.+   +.+
T Consensus         2 ~~kvaVi~fpGtN~d~d~~~A~~~aG~~~~~V~~~d~~---~~~~~d~vv~pGGFSyGDyLr~Gaiaa~~~v~~~v~~~a   78 (231)
T COG0047           2 RPKVAVLRFPGTNCDYDMAAAFERAGFEAEDVWHSDLL---LGRDFDGVVLPGGFSYGDYLRAGAIAAIAPVMDEVREFA   78 (231)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEECC---CCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             95699997078684599999999849982499855035---677746899748877643357326775578999999998


Q ss_pred             HCCCCEEEECHHHHHHHHH--CCCEEEECCCCCC--CEEEEEECCCCCCCCCCCCCCCCEEEEEECCCH--------HHC
Q ss_conf             0899889977899998997--0969998698661--036675238862227872665533686002201--------101
Q gi|254780414|r   77 ESNIPLLGICYGQQIMCQS--LGGKTKNSQSREF--GRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQ--------VEH  144 (520)
Q Consensus        77 ~~~iPILGICyG~QlLa~~--~GG~V~~~~~~Ey--G~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~--------V~~  144 (520)
                      +.+.|+||||=|+|+|..+  +-|...+.....|  -+..+++.++..+|..-.+......+--+|++.        ..+
T Consensus        79 ~~g~~vLGICNGfQiL~e~gLlPGal~~N~s~~F~cr~v~l~V~~~~t~ft~~~~~g~~i~ipVAHgEGr~~~~~~~l~~  158 (231)
T COG0047          79 EKGKPVLGICNGFQILSEAGLLPGALTRNESLRFECRWVYLRVENNNTPFTSGYEGGEVIPIPVAHGEGRYYADDETLAE  158 (231)
T ss_pred             HCCCEEEEECCHHHHHHHCCCCCCCEECCCCCCEEEEEEEEEEECCCCHHHHHCCCCCEEEEEEEECCEEEECCHHHHHH
T ss_conf             68971999853508989727577610247898458898999993589877873578855987777056247716788998


Q ss_pred             CCCC-CCEEECCC-----------CC---CEEEEEECCCCEEEEEEEEHHHC-----CCHHHHHHHHHH
Q ss_conf             2444-21123239-----------83---17889863500112465212221-----520257799875
Q gi|254780414|r  145 IPEG-FEVIASSD-----------ST---PFAFIADEKRKYYAVQFHPEVVH-----TVGGSQLIDNFV  193 (520)
Q Consensus       145 lP~g-f~viA~S~-----------~~---~iaai~~~~~~iyGVQFHPEV~h-----T~~G~~iL~NFl  193 (520)
                      +-++ -.++-..+           |+   .||++.+++.++.|++=|||=..     ++.|..|+++.+
T Consensus       159 l~~ngqvvfrY~d~~G~~~~~~NPNGS~~~IaGI~n~~G~V~gmMPHPERa~~~~~g~~Dg~~lF~s~~  227 (231)
T COG0047         159 LEENGQVVFRYVDNNGETEEYANPNGSVNGIAGITNEDGNVLGMMPHPERASESLLGGEDGLRLFRSAR  227 (231)
T ss_pred             HHHCCEEEEEEECCCCCEEEEECCCCCHHHCEEEECCCCCEEEECCCCHHHHHCCCCCCHHHHHHHHHH
T ss_conf             754897999993699854033479899666205776999789864894443320268713899999999


No 113
>PRK13981 NAD synthetase; Provisional
Probab=98.95  E-value=1.7e-08  Score=80.97  Aligned_cols=161  Identities=19%  Similarity=0.251  Sum_probs=93.1

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH---HHHHHHH
Q ss_conf             650444036640564047799999986223-656999973895515627899998862369857997588---9999996
Q gi|254780414|r  218 EQVGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS---ERFIRKL  293 (520)
Q Consensus       218 ~~vg~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~---~~Fl~~L  293 (520)
                      .+.|-++|++|||||+||+++|++...|+| +|+++|..-.-. --.++.+--..+.+.+|+....++=+   +.|++.|
T Consensus       277 ~k~gf~~vviGLSGGiDSaL~aaiA~dALG~~nV~~v~MPs~~-tS~~s~~dA~~La~~LGi~~~~i~I~~~~~~~~~~l  355 (543)
T PRK13981        277 RKNGFPGVVLGLSGGIDSALVAAIAVDALGAENVRAVMMPSRY-TSDESLDDAAALARNLGVRYDIIPIEPAFEAFEAAL  355 (543)
T ss_pred             HHHCCCEEEEECCCCHHHHHHHHHHHHHHCHHHEEEEECCCCC-CCHHHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHHH
T ss_conf             8608974999767883599999999985383437886458777-866569999999999599748751499999999974


Q ss_pred             CCCCCHHHHHHHHHHHHHH------HHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCH
Q ss_conf             6898889999887565899------9999997439970998646220245420246777630344302320113203202
Q gi|254780414|r  294 KNIVDPETKRKVIGQLFIE------VFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL  367 (520)
Q Consensus       294 ~gv~DPE~KRkiIG~~Fi~------vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~l  367 (520)
                      +..-+-...  =+-.+-|+      +....+++.   -.|+-||  -|.=|.+-+.    .|         |-.+|.. -
T Consensus       356 ~~~f~~~~~--dvt~ENiQAR~R~~iLm~laN~~---g~lvl~T--gnkSE~avGy----~T---------lyGD~~g-~  414 (543)
T PRK13981        356 APLFAGTEP--DITEENLQSRIRGTLLMALSNKF---GSLVLTT--GNKSEMAVGY----AT---------LYGDMAG-G  414 (543)
T ss_pred             HHHHCCCCC--CCCHHHHHHHHHHHHHHHHHHCC---CCEEECC--CCHHHHHHCH----HH---------HCCCCCC-C
T ss_conf             044168766--65223454888999999987338---9679647--8672787474----65---------3376556-7


Q ss_pred             HHHHHHHHHHHHHHHHHHHC-----------CCHHHHCCCCCCC
Q ss_conf             23789873899999999819-----------9988942688898
Q gi|254780414|r  368 VEPLKELFKDEVRLLGKELR-----------LPDSFVERHPCPG  400 (520)
Q Consensus       368 iEPl~~l~KdEVR~lg~~Lg-----------lp~~~~~RhPFPG  400 (520)
                      +-|+++++|-+|+.|.+.+.           ||++++.+.|=|-
T Consensus       415 ~avi~dv~KT~V~~L~r~~n~~~~~~~~~~vip~~ii~k~pSaE  458 (543)
T PRK13981        415 FAPIKDVYKTLVYRLCRWRNTNHPGGPDGEVIPERIITKPPSAE  458 (543)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCC
T ss_conf             43036865999999999986536456666756187668898977


No 114
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6.3.5.1 from EC) catalyzes the last step in the biosynthesis of nicotinamide adenine dinucleotide and is induced by stress factors such as heat shock and glucose limitation. The three-dimensional structure of NH3-dependent NAD+ synthetase from Bacillus subtilis, in its free form and in complex with ATP shows that the enzyme consists of a tight homodimer with alpha/beta subunit topology .; GO: 0003952 NAD+ synthase (glutamine-hydrolyzing) activity, 0005524 ATP binding, 0009435 NAD biosynthetic process.
Probab=98.95  E-value=2.7e-08  Score=79.51  Aligned_cols=170  Identities=25%  Similarity=0.286  Sum_probs=113.6

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHH--------HHHHHHHHHHCC-CCEEEEEECCCCC-CCCCHHHHHHHHHHCCCCCEE
Q ss_conf             999997650444036640564047--------799999986223-6569999738955-156278999988623698579
Q gi|254780414|r  212 IVSRIKEQVGNERVICAVSGGVDS--------TVAAFLIYEAIG-INLTCVLVDHGFM-RKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       212 ~i~~Ir~~vg~~kVi~~lSGGVDS--------tV~A~Ll~kAig-~~l~~vfVD~Gll-RknE~~~v~~~~~~~~~~~l~  281 (520)
                      ....+.+..|-+.|++|+|||+||        +++|+|..+++| ++.+.+.+-++-- -+...+....+.+. ++++-.
T Consensus        16 ~~~~~~~~~~~~g~v~GlsGG~ds~l~g~l~~~~v~~~~~~~~~~~~~~~~~~p~~~~~~~~d~~~a~~~~~~-~~~~~~   94 (286)
T TIGR00552        16 LRGYVKKSPGAKGVVLGLSGGVDSTLAGKLCQAVVAALCVEALGKEQNHALLLPHSNTTPEDDVQDALALAEP-LGINYK   94 (286)
T ss_pred             HHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCHHHHEEEEECCCCCCCHHHHHHHHHHHHH-CCCCCE
T ss_conf             8888763257650467304762035677899999999998504611420332146678841217999998874-054421


Q ss_pred             EEEHHHHHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCC
Q ss_conf             9758899999966--898889999887565899999999743-9970998646220245420246777630344302320
Q gi|254780414|r  282 VVDASERFIRKLK--NIVDPETKRKVIGQLFIEVFEEEAKKI-GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG  358 (520)
Q Consensus       282 ~vda~~~Fl~~L~--gv~DPE~KRkiIG~~Fi~vf~~~a~~~-~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgg  358 (520)
                      .++-...+-....  ...++..-.-.-|+.--+.-....-.+ +...+|.-||=--  .|-..+       --|-+..||
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~gn~~~r~r~~~~y~~a~~~~~lv~gt~n~--~e~~~G-------y~t~~Gdg~  165 (286)
T TIGR00552        95 TIDIAPIAASFQAQTETGDPLADFLAEGNLKARLRMALLYAHANKHNLLVLGTGNK--SELLLG-------YFTKYGDGG  165 (286)
T ss_pred             ECCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCH--HHHHHH-------HHHHCCCCC
T ss_conf             11304677887764203443331023322247889999988731016356404613--445432-------001014420


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHHCC-----CHHHHCCCCC
Q ss_conf             113203202237898738999999998199-----9889426888
Q gi|254780414|r  359 LPEHMDMKLVEPLKELFKDEVRLLGKELRL-----PDSFVERHPC  398 (520)
Q Consensus       359 lp~~~~~~liEPl~~l~KdEVR~lg~~Lgl-----p~~~~~RhPF  398 (520)
                             -=+-|+.+|||.||++|.+.||+     |+.++.|-|-
T Consensus       166 -------~d~~p~~~l~k~~~~~l~~~l~~~~~~~P~~~~~k~P~  203 (286)
T TIGR00552       166 -------CDILPLGGLFKTEVYELAKRLGVEQTIIPEEIIEKPPT  203 (286)
T ss_pred             -------HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCC
T ss_conf             -------00345532237889999998175310146667337887


No 115
>PRK08349 hypothetical protein; Validated
Probab=98.89  E-value=7.9e-09  Score=83.34  Aligned_cols=178  Identities=21%  Similarity=0.318  Sum_probs=120.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCC---CCEEEEEHHHHH---HHHHCCCC
Q ss_conf             036640564047799999986223656999973895515627899998862369---857997588999---99966898
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPN---FPLRVVDASERF---IRKLKNIV  297 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~---~~l~~vda~~~F---l~~L~gv~  297 (520)
                      ||++.+|||.||.|||.++-|- |-+++|+|.++|---...+.++.+.+++..+   ..+.++|..+.+   +.++....
T Consensus         2 Kvl~LlSGGiDSPVAa~~mmKR-G~~V~~lhf~~~~~~~~kv~~~~~~L~~~~~~~~~~~~iv~~~~~~~~i~~~i~~~~   80 (198)
T PRK08349          2 KVVALLSSGIDSPVAIYLMLSR-GVEIYPLHFRQDEKKEHKARELVEILQEIHGGKVKDPVIVDAYEVQGPVFEKLREIG   80 (198)
T ss_pred             EEEEEECCCCCHHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCC
T ss_conf             4999965884389999999977-997999986387788999999999999970888752899772253289999998607


Q ss_pred             CHHHHHHHH-HHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHH
Q ss_conf             889999887-5658999999997439970998646220245420246777630344302320113203202237898738
Q gi|254780414|r  298 DPETKRKVI-GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFK  376 (520)
Q Consensus       298 DPE~KRkiI-G~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~K  376 (520)
                      + +.=|-++ .+.+.++.++.|++. ++..|.-|       ||-+...  |.|+.   |-.-.-....+-++-||--+=|
T Consensus        81 ~-~~~~~vl~rr~M~riA~~iA~~~-g~~aivTG-------EsLGQVA--SQTl~---NL~~i~~~~~~pVlRPLig~DK  146 (198)
T PRK08349         81 K-EKWTCLFCKYTMYRVAERYAHEI-GAKAIVTG-------DSLGQVA--SQTLD---NLMVISTATDLPILRPLIGLDK  146 (198)
T ss_pred             C-CCCEEHHHHHHHHHHHHHHHHHC-CCCEEEEC-------CHHHHHH--HHHHH---HHHHHHHHHCCCCCCCCCCCCH
T ss_conf             7-65130999999999999999985-99889845-------2167888--99998---8999987506766477667998


Q ss_pred             HHHHHHHHHHCCCHHHHCCCCCCCC-CCEEEECCCCCHHHHHHHHH
Q ss_conf             9999999981999889426888983-11122100036789999999
Q gi|254780414|r  377 DEVRLLGKELRLPDSFVERHPCPGP-GLAIRCIGEITEERINILRE  421 (520)
Q Consensus       377 dEVR~lg~~Lglp~~~~~RhPFPGP-GLaiRi~g~vt~e~~~i~r~  421 (520)
                      +|.-++++.+|.-+--+  +| +.. +++=+  --+|+-+++.+++
T Consensus       147 ~EII~~Ar~IGTye~S~--~~-~~cC~~~pk--~P~t~~~~~~i~~  187 (198)
T PRK08349        147 EEIVRIAKEIGTFEISI--EP-EPPCPFVPK--FPVVRAGLGEFEK  187 (198)
T ss_pred             HHHHHHHHHHCCHHHHC--CC-CCCCEEECC--CCCCCCCHHHHHH
T ss_conf             99999999819553432--89-977441089--8826889999999


No 116
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional
Probab=98.86  E-value=6.7e-08  Score=76.70  Aligned_cols=153  Identities=18%  Similarity=0.237  Sum_probs=99.3

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHH---HC-CCCEEEEEECCCCCCCCCHH--HHHHHHHHCCCCCEEEEEHHHHHHHHH
Q ss_conf             0444036640564047799999986---22-36569999738955156278--999988623698579975889999996
Q gi|254780414|r  220 VGNERVICAVSGGVDSTVAAFLIYE---AI-GINLTCVLVDHGFMRKNEVE--NIISLFKGYPNFPLRVVDASERFIRKL  293 (520)
Q Consensus       220 vg~~kVi~~lSGGVDStV~A~Ll~k---Ai-g~~l~~vfVD~GllRknE~~--~v~~~~~~~~~~~l~~vda~~~Fl~~L  293 (520)
                      --+++|++|+|||+||++.-.+|++   .. |-++++++||||| |..-.+  +-++.+-..+++++.+.+-.-   +. 
T Consensus        11 ~~~~~ilvavSGG~DS~~LL~~L~~l~~~~~~~~l~~~HvnHgl-~~~ad~~~~fv~~~c~~~~ip~~~~~~~v---~~-   85 (433)
T PRK10660         11 LESRQILVAFSGGLDSTVLLHQLVQWRTQNPGVTLRAIHIHHGL-SPNADSWVKHCEQVCQQWQVPLVVERVQL---AQ-   85 (433)
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCC-CCCHHHHHHHHHHHHHHCCCCEEEEEEEE---CC-
T ss_conf             99998999972809999999999999986689828999971897-92669999999999997599789999872---79-


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC--CCCC-CCEEEEEECCCCHHHHH---CCCH
Q ss_conf             6898889999887565899999999743997099864622024542024--6777-63034430232011320---3202
Q gi|254780414|r  294 KNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF--FGGP-SSIIKSHHNVGGLPEHM---DMKL  367 (520)
Q Consensus       294 ~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~--~~~~-~~~IKsHHNvgglp~~~---~~~l  367 (520)
                      .|..=-|.=|+.    =.+.|++.+++   ..+||-|.=--|-+|..-.  ..|. ..      -..|+|...   +.++
T Consensus        86 ~~~~~E~aAR~~----RY~~f~~~~~~---~~~l~tAHh~dDQaETvLlrL~RGsG~~------GL~gm~~~r~~~~~~l  152 (433)
T PRK10660         86 EGLGIEAAARQA----RYQAFARTLLP---GEVLVTAQHLDDQCETFLLALKRGSGPA------GLSAMAEVSPFAGTQL  152 (433)
T ss_pred             CCCCHHHHHHHH----HHHHHHHHHHH---CCEEEECCCCCHHHHHHHHHHHCCCCCC------CCCCCCCCCCCCCCEE
T ss_conf             997699999999----99999998743---8879962456519999999986589964------4567752244789707


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             23789873899999999819998
Q gi|254780414|r  368 VEPLKELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       368 iEPl~~l~KdEVR~lg~~Lglp~  390 (520)
                      +-||=.+-|+|..+-.++.|||.
T Consensus       153 iRPLL~~~r~eI~~Y~~~~~l~~  175 (433)
T PRK10660        153 LRPLLARTRGELEQWAQAHGLRW  175 (433)
T ss_pred             ECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             73744665999999999849980


No 117
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I; InterPro: IPR010075   In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain. This entry describes the PurQ protein of Bacillus subtilis (where PurL, PurQ, and PurS are required for phosphoribosylformylglycinamidine synthase activity) and functionally equivalent proteins from other bacteria and archaea.; GO: 0004642 phosphoribosylformylglycinamidine synthase activity, 0006189 'de novo' IMP biosynthetic process, 0005737 cytoplasm.
Probab=98.84  E-value=3.3e-08  Score=78.88  Aligned_cols=182  Identities=23%  Similarity=0.352  Sum_probs=115.5

Q ss_pred             EEEEEECCCCH-HHHHHHHHH-HCCCEEEEE----CCC-CC-HHH-HHHCCCCEEEECCCCCCCCCC---------C---
Q ss_conf             69999889705-788998888-659406985----289-89-889-972399799998538899999---------9---
Q gi|254780414|r    9 KVLIIDFGSQF-TQLIARRVR-ESKVYCEVI----AFK-NA-LDY-FKEQNPQAIILSGSPASSLDI---------D---   67 (520)
Q Consensus         9 ~IlIlDfGSQy-tqLIaRriR-elgVyseI~----P~~-~~-~e~-i~~~~p~GIILSGGP~SV~d~---------~---   67 (520)
                      ||+||=|...- -.=..+.++ .+||-.|++    =|+ .. ++. -.-+++++|||.||=+  |-+         -   
T Consensus         2 kvAV~~FPGtNCd~D~~~A~~k~~Gv~~~~Vhikqw~~D~~r~~~~rsvfD~D~VvlPGGFS--yGDYLRaGAIAa~rvk   79 (264)
T TIGR01737         2 KVAVIRFPGTNCDRDTVYALEKLLGVDAEIVHIKQWYEDKSRLSDQRSVFDYDAVVLPGGFS--YGDYLRAGAIAALRVK   79 (264)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECHHHHCCCCCCCEEEEEEEEEECCCCC--HHHHHHHHHHHHHHCC
T ss_conf             68999779998408999999971499837998652100004787664178733488668777--2357779999987503


Q ss_pred             CCCCCHHH---HHCCCCEEEECHHHHHHHHH--CCC-------------EEEECCCCCC--CEEEEEECCCCCCCCCCCC
Q ss_conf             97537689---80899889977899998997--096-------------9998698661--0366752388622278726
Q gi|254780414|r   68 SPQIPKEI---LESNIPLLGICYGQQIMCQS--LGG-------------KTKNSQSREF--GRAFIEIKKNCSLLKGMWE  127 (520)
Q Consensus        68 ap~~~~~I---~~~~iPILGICyG~QlLa~~--~GG-------------~V~~~~~~Ey--G~~~I~i~~~~~lf~gl~~  127 (520)
                      +| +.++|   -+.|.||||||=|+|+|..+  +=|             ...+....-|  -+..+.+.++...|....+
T Consensus        80 ~p-~~~~V~~~A~~G~pVLGiCNGFQIL~E~GLLpGfDeDkPlaekPemAL~~N~~~rFisr~v~LrV~n~~T~FT~~y~  158 (264)
T TIGR01737        80 SP-IMQEVREFAEKGKPVLGICNGFQILVEAGLLPGFDEDKPLAEKPEMALLPNASLRFISRWVYLRVENADTAFTKKYK  158 (264)
T ss_pred             HH-HHHHHHHHHHCCCEEEEEECHHHHHHHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCEEEEEEEEEEECCCHHHHCCC
T ss_conf             08-89999999955982899766479999976248988788743571224420588974532036899856783663579


Q ss_pred             CCCCEEEEEECCCH---HH---------CCCCCCCEE------------ECCCCC---CEEEEEECCCCEEEEEEEEHH-
Q ss_conf             65533686002201---10---------124442112------------323983---178898635001124652122-
Q gi|254780414|r  128 KGSKQQVWMSHGDQ---VE---------HIPEGFEVI------------ASSDST---PFAFIADEKRKYYAVQFHPEV-  179 (520)
Q Consensus       128 ~~~~~~VwmSH~D~---V~---------~lP~gf~vi------------A~S~~~---~iaai~~~~~~iyGVQFHPEV-  179 (520)
                      ...-..+---|++-   +.         ++-.+=+|+            ..+.|+   .||+|.|++.+++|++=|||= 
T Consensus       159 kGev~~~PiAHgEGrYy~~sGke~e~~~~l~~n~qivFrY~d~~G~~~e~~NPNGS~~nIAGi~N~~gnV~GmMPHPERA  238 (264)
T TIGR01737       159 KGEVIRVPIAHGEGRYYADSGKEDETLAELESNDQIVFRYCDEDGDVSEEVNPNGSVDNIAGIVNEEGNVLGMMPHPERA  238 (264)
T ss_pred             CCCEEEEEEEECCCCEECCCCCCHHHHHHHHHCCEEEEEEECCCCCEECCCCCCCCCCCEEEEECCCCCEEEECCCHHHH
T ss_conf             88788765442587266268997579999854791899976799853245478976467105780898778718980787


Q ss_pred             ----HC-----CCHHHHHHHHHH
Q ss_conf             ----21-----520257799875
Q gi|254780414|r  180 ----VH-----TVGGSQLIDNFV  193 (520)
Q Consensus       180 ----~h-----T~~G~~iL~NFl  193 (520)
                          .-     +..|..||+-|+
T Consensus       239 ~~~~lg~r~eG~~DG~~Lf~~l~  261 (264)
T TIGR01737       239 SEKLLGSRREGADDGLKLFESLV  261 (264)
T ss_pred             HHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             64540688756377999999999


No 118
>PRK13794 hypothetical protein; Provisional
Probab=98.82  E-value=2.7e-08  Score=79.50  Aligned_cols=178  Identities=17%  Similarity=0.219  Sum_probs=106.6

Q ss_pred             CCCHHHHHHHHHHHHHHHCC--CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCE
Q ss_conf             14067899999999765044--4036640564047799999986223656999973895515627899998862369857
Q gi|254780414|r  203 WVMSSYHKEIVSRIKEQVGN--ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPL  280 (520)
Q Consensus       203 W~~~~~~~~~i~~Ir~~vg~--~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l  280 (520)
                      --++++..+.++-||+.+.+  ..|....|||=||||+..|..||+|+.+..+|+|||+= .-|+.+-.+.+.+++|+++
T Consensus       224 ~~l~~~e~eAv~fir~~~~~~~~pv~VSfSGGKDS~v~L~La~ka~~~~~~vvF~DTglE-fPeT~e~ve~v~~~~gv~i  302 (473)
T PRK13794        224 NVLDKVERNSIGFMRNTIVKIGKPPSVAYSGGKDSLATLLLALKAFGNEFPVLFADTGLE-FPETLENVEDVEELYGLEI  302 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCC-CHHHHHHHHHHHHHHCCCE
T ss_conf             999999999999999999866998399706868999999999986089716999608887-6769999999999859878


Q ss_pred             EEEEHHHHHHHHHCCCCCHHHHHHHHHHH-HHHHHHHHHHHC-CC--CEEEEECCCCCHHHHHHCCCCCC----CCEEEE
Q ss_conf             99758899999966898889999887565-899999999743-99--70998646220245420246777----630344
Q gi|254780414|r  281 RVVDASERFIRKLKNIVDPETKRKVIGQL-FIEVFEEEAKKI-GG--AQFLGQGTLYPDVIESISFFGGP----SSIIKS  352 (520)
Q Consensus       281 ~~vda~~~Fl~~L~gv~DPE~KRkiIG~~-Fi~vf~~~a~~~-~~--~~~L~QGTlypDvIES~~~~~~~----~~~IKs  352 (520)
                      +..++.+ |...++.-.=|-...+=-... =+.-..+..++. .+  ..|.+|-     --||.+....+    ...|..
T Consensus       303 i~~~~~~-fw~~~~~~GpP~rd~RWCc~v~Kl~pl~~~l~~~~~~~~l~~vG~R-----~~ES~~Rak~prv~~n~~i~~  376 (473)
T PRK13794        303 IRTSSGE-FWEKLEEYGPPARDNRWCSEVCKLSPLGKLIDEKYEGECLSFVGQR-----KYESFNRSKKPRIWRNPTIKK  376 (473)
T ss_pred             EEECCCC-HHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECC-----HHHHHHHHCCCCCCCCCCCCC
T ss_conf             9915644-7788886199976660213226378999999974899718998521-----687687504874123788767


Q ss_pred             EECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCC
Q ss_conf             30232011320320223789873899999999819998894268889
Q gi|254780414|r  353 HHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCP  399 (520)
Q Consensus       353 HHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFP  399 (520)
                      .-            .+-|+.+---=||=.-=..=++|-+=++++=|-
T Consensus       377 qi------------~~~PI~~Wtal~VwLYI~~~~lp~NpLY~~Gf~  411 (473)
T PRK13794        377 QM------------LAAPILNWTAMHVWIYLFREKAPYNVLYEQGFD  411 (473)
T ss_pred             CE------------EEECHHCCHHHHHHHHHHHCCCCCCHHHHCCCC
T ss_conf             15------------761431051879999998758998858876875


No 119
>PRK13795 hypothetical protein; Provisional
Probab=98.79  E-value=4.7e-08  Score=77.76  Aligned_cols=99  Identities=25%  Similarity=0.264  Sum_probs=79.8

Q ss_pred             CCCHHHHHHHHHHHHHHHC--CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCE
Q ss_conf             1406789999999976504--44036640564047799999986223656999973895515627899998862369857
Q gi|254780414|r  203 WVMSSYHKEIVSRIKEQVG--NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPL  280 (520)
Q Consensus       203 W~~~~~~~~~i~~Ir~~vg--~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l  280 (520)
                      --++++..+.++-||+.+.  +..|..+.|||=||+|+..|..||++ ++..+|+||||== -|+.+-.+.+++.+|+++
T Consensus       224 ~~l~~~e~eAv~fir~~~~~~~~pv~VsfSGGKDS~v~L~La~ka~~-~~~~~f~dTglEf-PeT~e~v~~~~~~~gi~~  301 (630)
T PRK13795        224 KHLEEKEKEAVNFIREVAEKYNLPVVVSFSGGKDSLVVLDLAAEALR-KFKAFFNNTGLEF-PETVENVKEVAEEYGVEL  301 (630)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC-CEEEEEECCCCCC-HHHHHHHHHHHHHHCCCE
T ss_conf             99999999999999987875489759952686899999999998549-8289995077676-469999999999869818


Q ss_pred             EEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             99758899999966898889999
Q gi|254780414|r  281 RVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       281 ~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
                      ..++|.+.|...++-..=|-.-.
T Consensus       302 ~~~~a~~~fw~~~~~~GpP~rd~  324 (630)
T PRK13795        302 IVADAGDAFWRAIEKFGPPARDY  324 (630)
T ss_pred             EEECCCHHHHHHHHHCCCCCCCC
T ss_conf             99656367888888749996556


No 120
>KOG2387 consensus
Probab=98.75  E-value=8.8e-09  Score=82.98  Aligned_cols=133  Identities=22%  Similarity=0.343  Sum_probs=71.3

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEE---ECCCCCC------------------
Q ss_conf             9979999853889999999753768980899889977899998997096999---8698661------------------
Q gi|254780414|r   50 NPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK---NSQSREF------------------  108 (520)
Q Consensus        50 ~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~---~~~~~Ey------------------  108 (520)
                      ..+||++.||-.+---++.....++.-+.++|.||||+|||+-+..|--+|-   .+..-||                  
T Consensus       363 ~adGilvPGGFG~RGveG~i~Aak~ARen~iP~LGiCLGmQ~AvIEfaRnvLg~~dAnStEF~p~~~~~vVi~MPE~~~~  442 (585)
T KOG2387         363 SADGILVPGGFGDRGVEGKILAAKWARENKIPFLGICLGMQLAVIEFARNVLGLKDANSTEFDPETKNPVVIFMPEHNKT  442 (585)
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCC
T ss_conf             48828967866544305789999998764997576311126999999998617777873224878898679987688744


Q ss_pred             --------CEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHH-----HCC-CCCCCEEECCCCC-CEEEEEECCCCEE-E
Q ss_conf             --------0366752388622278726655336860022011-----012-4442112323983-1788986350011-2
Q gi|254780414|r  109 --------GRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQV-----EHI-PEGFEVIASSDST-PFAFIADEKRKYY-A  172 (520)
Q Consensus       109 --------G~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V-----~~l-P~gf~viA~S~~~-~iaai~~~~~~iy-G  172 (520)
                              |........+++..+.+........--.-|.+.|     ..+ -.|+.-++..+++ .++.++-++.|+| |
T Consensus       443 ~mGgtMRLG~R~t~f~~~~s~~~kLYG~~~~V~ERHRHRyEVNP~~v~~le~~Gl~FvGkd~~g~rmeI~El~~HP~fVg  522 (585)
T KOG2387         443 HMGGTMRLGSRRTVFQDKDSKLRKLYGNVEFVDERHRHRYEVNPEMVKQLEQAGLSFVGKDVTGKRMEIIELESHPFFVG  522 (585)
T ss_pred             CCCCEEEECCCCEEEECCCHHHHHHHCCCHHHHHHHHCCEECCHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCCEEE
T ss_conf             44644662464116505715789875795046565411011488999999866968985168885788998079872565


Q ss_pred             EEEEEHHHCC
Q ss_conf             4652122215
Q gi|254780414|r  173 VQFHPEVVHT  182 (520)
Q Consensus       173 VQFHPEV~hT  182 (520)
                      +|||||...-
T Consensus       523 ~QfHPE~~sr  532 (585)
T KOG2387         523 VQFHPEFKSR  532 (585)
T ss_pred             ECCCHHHHCC
T ss_conf             3137777458


No 121
>PRK01565 thiamine biosynthesis protein ThiI; Provisional
Probab=98.62  E-value=5.2e-07  Score=70.32  Aligned_cols=156  Identities=24%  Similarity=0.375  Sum_probs=108.7

Q ss_pred             HC-CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCH-HHHHH---HHHH-CCCCCEEEEEHHHHHHHHH
Q ss_conf             04-44036640564047799999986223656999973895515627-89999---8862-3698579975889999996
Q gi|254780414|r  220 VG-NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEV-ENIIS---LFKG-YPNFPLRVVDASERFIRKL  293 (520)
Q Consensus       220 vg-~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~-~~v~~---~~~~-~~~~~l~~vda~~~Fl~~L  293 (520)
                      +| .+||++.||||.||.|||.++-|- |-+++++|.+++=.--.++ +.|.+   .+.+ ..++++.+||-.+. ...+
T Consensus       173 vGt~Gk~l~LlSGGIDSPVAa~~mmkR-G~~v~~v~f~~~p~t~~~a~~kv~~l~~~L~~y~~~~kl~~v~f~~~-~~~i  250 (399)
T PRK01565        173 VGTSGKALLLLSGGIDSPVAGYLAMKR-GVEIEAVHFHSPPYTSERAKEKVIDLARILAKYGGRIKLHVVPFTEI-QEEI  250 (399)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHC-CCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH-HHHH
T ss_conf             677785799861787539999999855-98799999868998778999999999999997288855999663999-9999


Q ss_pred             CCCCCHHHHHHHHHH-HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             689888999988756-5899999999743997099864622024542024677763034430232011320320223789
Q gi|254780414|r  294 KNIVDPETKRKVIGQ-LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       294 ~gv~DPE~KRkiIG~-~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      ..-. ||.=|-++-+ .++++.++.|++. ++.-|.-|       ||-+...  |.|+.   |-.-.-....+-++-||-
T Consensus       251 ~~~~-~~~~~~vl~RR~M~riA~~iA~~~-~~~alvTG-------ESLGQVA--SQTl~---Nl~~i~~~~~~pVlRPLI  316 (399)
T PRK01565        251 KKKV-PESYLMTLMRRFMMRIADKIAEKR-GALAIVTG-------ESLGQVA--SQTLE---SMQAINAVTNLPVLRPLI  316 (399)
T ss_pred             HHCC-CCCEEEHHHHHHHHHHHHHHHHHC-CCCEEEEC-------CHHHHHH--HHHHH---HHHHHHHHCCCCCCCCCC
T ss_conf             8608-800385999999999999999985-99789824-------1355676--75567---788887521775446655


Q ss_pred             HHHHHHHHHHHHHHCCCHH
Q ss_conf             8738999999998199988
Q gi|254780414|r  373 ELFKDEVRLLGKELRLPDS  391 (520)
Q Consensus       373 ~l~KdEVR~lg~~Lglp~~  391 (520)
                      -+=|+|.-++++++|.=+-
T Consensus       317 g~DK~EII~~Ar~IGTye~  335 (399)
T PRK01565        317 GMDKEEIIEIAKEIGTYDI  335 (399)
T ss_pred             CCCHHHHHHHHHHCCCCHH
T ss_conf             7898999999987096011


No 122
>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an 
Probab=98.61  E-value=3.5e-06  Score=64.42  Aligned_cols=127  Identities=27%  Similarity=0.352  Sum_probs=93.0

Q ss_pred             CCCCCC-HHHHHHHHHHHHHHHCCC-CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCC
Q ss_conf             411140-678999999997650444-036640564047799999986223656999973895515627899998862369
Q gi|254780414|r  200 QDNWVM-SSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPN  277 (520)
Q Consensus       200 ~~~W~~-~~~~~~~i~~Ir~~vg~~-kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~  277 (520)
                      +-+|+- +.-+++.++++|++=++. -+|+++|||.|||.+|.++.+-.|=|-.+|.+|+|+...--.+++.++.++ +|
T Consensus        35 ~i~w~~r~~~l~~l~~~~r~~~~~~YDCiv~vSGGkDS~y~~~~l~~~~gl~pL~vt~d~~~~t~~g~~Ni~~l~~~-lg  113 (343)
T TIGR03573        35 KIDWDEREKELEELVDKIKKKGGGRYDCIIGVSGGKDSTYQAHVLKKKLGLNPLLVTVDPGWNTELGVKNLNNLIKK-LG  113 (343)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHH-CC
T ss_conf             89868899999999999971489988689868877289999999999829925999835987798999999999983-69


Q ss_pred             CCEEEEEH-----HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             85799758-----8999999668988899998875658999999997439970998646
Q gi|254780414|r  278 FPLRVVDA-----SERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       278 ~~l~~vda-----~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
                      +..+.+-+     .+.+...|+.+-||+.-=-.   .+...-.+.|.+. ++.+...|.
T Consensus       114 vD~i~~~~n~~~~k~l~k~~~~~~gd~~~~~~~---~i~~~~~~iA~k~-~IplIi~Ge  168 (343)
T TIGR03573       114 FDLHTITINPETFRKLQRAYFKKVGDPEWPQDH---AIFASVYQVALKF-NIPLIIWGE  168 (343)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHCCCHHHHHHH---HHHHHHHHHHHHC-CCCEEEECC
T ss_conf             985874699999999999999866894699999---9999999999981-999899756


No 123
>PRK08557 hypothetical protein; Provisional
Probab=98.60  E-value=4.5e-07  Score=70.76  Aligned_cols=185  Identities=18%  Similarity=0.164  Sum_probs=113.4

Q ss_pred             CCHHHHHHHHHHHHHHHCCC-----CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCC
Q ss_conf             40678999999997650444-----0366405640477999999862236569999738955156278999988623698
Q gi|254780414|r  204 VMSSYHKEIVSRIKEQVGNE-----RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNF  278 (520)
Q Consensus       204 ~~~~~~~~~i~~Ir~~vg~~-----kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~  278 (520)
                      -++++..+.++-||+.+..-     .|....|||=||||++.|..+|+ +++..+|+|||+= .-|+-+-.+-+.+.+++
T Consensus       160 ~l~~~e~~Av~fir~~~~k~~~~~~pV~VSfSGGKDS~a~L~La~~a~-~~~~vvF~DTGlE-fPeT~eyve~~~~~~~~  237 (420)
T PRK08557        160 RLDEMVENSIEILQDYVEKYKRKGYAINASFSGGKDSAVSTLLSKEVI-PDLDVVFIDTGLE-YPETLNYVKDFAKKYDI  237 (420)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHC-CCCEEEEECCCCC-CHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999716679746996068789999999999854-8816999628877-72389999999998099


Q ss_pred             CEEEEEHHHHHHHHHCCCCCHHHHHHHHHHH-HHHHHHHHHHHC-CCCE-EEEECCCCCHHHHHHCCCCCCCCEEEEEEC
Q ss_conf             5799758899999966898889999887565-899999999743-9970-998646220245420246777630344302
Q gi|254780414|r  279 PLRVVDASERFIRKLKNIVDPETKRKVIGQL-FIEVFEEEAKKI-GGAQ-FLGQGTLYPDVIESISFFGGPSSIIKSHHN  355 (520)
Q Consensus       279 ~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~-Fi~vf~~~a~~~-~~~~-~L~QGTlypDvIES~~~~~~~~~~IKsHHN  355 (520)
                      ++..++ ++.|...+..-.=|-.-.+=.... =+.-..+..++. ++.. ...+|-=   --||.+...  ..  ...-|
T Consensus       238 ~l~~~~-~~~fw~~~~~~GpP~rd~RWCc~v~Kl~Pl~~~i~~~~~~~~vl~~~G~R---~~ES~~R~~--~~--~~~~~  309 (420)
T PRK08557        238 NLDTVD-GDNFWDNLEKEGIPTKDNRWCNSACKLMPLKRYLKKKYGNKKVLTIDGSR---KYESFTRAN--LD--YERKS  309 (420)
T ss_pred             CEEEEC-CHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEC---HHHHHHHHC--CC--CCCCC
T ss_conf             679965-46689887754999766725074310178999999857898759999701---454076605--87--41347


Q ss_pred             CCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             32011320320223789873899999999819998894268889831
Q gi|254780414|r  356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPG  402 (520)
Q Consensus       356 vgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPG  402 (520)
                       +-.|..   -.+-|+.+---=||=.-=..=|+|-+=++++=|--=|
T Consensus       310 -~~v~~q---~~~~PI~~Wsa~~VwLYI~~~~l~~NplY~~Gf~RvG  352 (420)
T PRK08557        310 -GFIDFQ---TNVFPILDWNSLDIWSYIFSNDILYNPMYDKGFERIG  352 (420)
T ss_pred             -CCCCCC---EEEEHHHCCCHHHHHHHHHHCCCCCCHHHHCCCCCCC
T ss_conf             -776665---0353153260769999999759999848866876367


No 124
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional
Probab=98.57  E-value=7.7e-07  Score=69.09  Aligned_cols=165  Identities=15%  Similarity=0.319  Sum_probs=94.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC--CCCCCCHHHHH--CCCCEE
Q ss_conf             86999988970578899888865940698528989889972399799998538899999--99753768980--899889
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI--DSPQIPKEILE--SNIPLL   83 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~--~ap~~~~~I~~--~~iPIL   83 (520)
                      -||-||..-.-+..- .+.++.+|+.+..+-   ..+++.  +.+|+|+.||-++....  ....+...+.+  .+.|||
T Consensus         3 ~kIGVLaLQG~~~eH-~~~l~~lg~~~~~Vr---~~~dL~--~idgLIiPGGESTti~~ll~~~~L~~~l~~~~~~~Pv~   76 (179)
T PRK13526          3 QKVGVLAIQGGYQKH-ADMFKSLGVEVKLVK---FNNDFD--SIDRLVIPGGESTTLLNLLNKHQIFDKLYNFCSSKPVF   76 (179)
T ss_pred             EEEEEEEECCCHHHH-HHHHHHCCCCEEEEC---CHHHHH--CCCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCCEE
T ss_conf             389999962887999-999998799689971---788860--07758975997789999976755499999998589908


Q ss_pred             EECHHHHHHHHHCC------CEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCCCCEEECCCC
Q ss_conf             97789999899709------699986986610366752388622278726655336860022011012444211232398
Q gi|254780414|r   84 GICYGQQIMCQSLG------GKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDS  157 (520)
Q Consensus        84 GICyG~QlLa~~~G------G~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~viA~S~~  157 (520)
                      |.|-|+-+||+.-+      -+|.|..   ||+..=....+-. +.+     ..+..-.--.=.|.++.++-+++|+-++
T Consensus        77 GTCAGlILLak~~~~lg~ldi~V~RNa---yGrQ~~SFe~~~~-~~~-----~~~~avFIRAP~I~~vg~~V~vLa~~~~  147 (179)
T PRK13526         77 GTCAGSIILSKGEGYLNLLDLEVQRNA---YGRQVDSFVADIS-FND-----KNITGVFIRAPKFIVVGNQVDILSKYQN  147 (179)
T ss_pred             EECCEEEEEECCCCCCCCEEEEEEECC---CCCCCCEEEEECC-CCC-----CCEEEEEECCCCEEECCCCCEEEEEECC
T ss_conf             861206898269876671358998255---4574320587136-589-----9536999827518880899589999899


Q ss_pred             CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             317889863500112465212221520257799875
Q gi|254780414|r  158 TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       158 ~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .+++.   ++.++.|.-||||.+..   ..+-+-|+
T Consensus       148 ~~V~v---rqgn~la~sFHPELt~D---~r~H~yFl  177 (179)
T PRK13526        148 SPVLL---RQANILVSSFHPELTQD---PTVHEYFL  177 (179)
T ss_pred             EEEEE---EECCEEEEEECCCCCCC---CHHHHHHH
T ss_conf             88999---98999999828875487---77999974


No 125
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    The only examples in which the wobble position of a tRNA must discriminate between G and A of mRNA are AUA (Ile) vs. AUG (Met) and UGA (stop) vs. UGG (Trp). In all bacteria, the wobble position of the tRNA(Ile) recognizing AUA is lysidine, a lysine derivative of cytidine. This domain is found, apparently, in all bacteria in a single copy. Eukaryotic sequences appear to be organellar. The domain architecture of this protein is variable; some, including characterised proteins of Escherichia coli and Bacillus subtilis known to be tRNA(Ile)-lysidine synthetase, include a conserved 50-residue domain that many other members lack. This protein belongs to the ATP-binding PP-loop family. It appears in the literature and protein databases as TilS, YacA, and putative cell cycle protein MesJ (a misnomer).; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0016879 ligase activity forming carbon-nitrogen bonds, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=98.55  E-value=1.3e-06  Score=67.37  Aligned_cols=156  Identities=26%  Similarity=0.372  Sum_probs=104.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHH---CCCC-------EEEEEECCCCC--CCC-CHHHHHHHHHHCCCCCEEEEE-HHHHH
Q ss_conf             0366405640477999999862---2365-------69999738955--156-278999988623698579975-88999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEA---IGIN-------LTCVLVDHGFM--RKN-EVENIISLFKGYPNFPLRVVD-ASERF  289 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kA---ig~~-------l~~vfVD~Gll--Rkn-E~~~v~~~~~~~~~~~l~~vd-a~~~F  289 (520)
                      ++++|+|||+||.+..-+|.+-   ++.+       +.+++||||+=  -.. |.+.|.+..+ ..++++.+.. ..-.=
T Consensus         1 ~~lvAvSGG~DS~aLL~~L~~~~~~~~~~~~~~~~~~~a~h~nH~lR~~s~~~~~~~v~~~c~-~~~~~~~~~~~~~~~~   79 (204)
T TIGR02432         1 KILVAVSGGVDSMALLHLLLKLQPKLKISWQIKDFKLIAAHVNHGLRPESAQEEAEFVQQFCE-KLNIPLEIKKLVDVKA   79 (204)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHH-HCCCCEEEEEEECCCC
T ss_conf             978886286427999999999766327877887506899996177884158999999999999-6189569984212411


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHCC--CCCCCCEEEEEECCCC---HHHH-
Q ss_conf             9996689888999988756589999999974399-7099864622024542024--6777630344302320---1132-
Q gi|254780414|r  290 IRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGG-AQFLGQGTLYPDVIESISF--FGGPSSIIKSHHNVGG---LPEH-  362 (520)
Q Consensus       290 l~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~-~~~L~QGTlypDvIES~~~--~~~~~~~IKsHHNvgg---lp~~-  362 (520)
                      .. ....+.-|+.=+..-   .+.|++.+++. + +++|+-|.=--|-+|..--  ..|+  .++   .-.|   .+.. 
T Consensus        80 ~~-~~~~~~~E~~AR~~R---Y~~f~~~~~~~-~~~~~i~tAHh~dDq~ET~L~rL~RG~--~~~---Gl~g~~~~~~~~  149 (204)
T TIGR02432        80 LA-KGKKKNLEEAAREAR---YAFFEEIAKKH-GKADYILTAHHADDQAETILMRLLRGS--GLR---GLSGMPEIRPLG  149 (204)
T ss_pred             CC-CCCCCCHHHHHHHHH---HHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHHHCC--CCC---HHHHHCCCCCCC
T ss_conf             01-224767789999999---99999999972-994089972483227999999875168--700---011101336633


Q ss_pred             -----HCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             -----0320223789873899999999819998
Q gi|254780414|r  363 -----MDMKLVEPLKELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       363 -----~~~~liEPl~~l~KdEVR~lg~~Lglp~  390 (520)
                           -...++=||=...|+|..+-.++-+||-
T Consensus       150 ~~g~~~~~~~~RPLL~~~k~ei~~y~~~~~l~~  182 (204)
T TIGR02432       150 SLGWYKGGQIIRPLLNISKSEIEEYLKENGLPY  182 (204)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCE
T ss_conf             244225632770775677899999999668965


No 126
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily  including N type ATP PPases and ATP sulphurylases. The domain forms a apha/beta/apha fold which  binds to Adenosine group..
Probab=98.55  E-value=1.4e-07  Score=74.48  Aligned_cols=102  Identities=31%  Similarity=0.344  Sum_probs=75.5

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCC-CCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             366405640477999999862236569999738955-1562789999886236985799758899999966898889999
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFM-RKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~Gll-RknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
                      |++++|||+||+|+|.+++++ |.++.++++|+|.+ |.++.++..+.                                
T Consensus         1 ~~v~~sgG~ds~~~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~a~~--------------------------------   47 (103)
T cd01986           1 VLVAFSGGKDSSVAAALLKKL-GYQVIAVTVDHGISPRLEDAKEIAKE--------------------------------   47 (103)
T ss_pred             CEEEECCCCHHHHHHHHHHHC-CCCEEEEEEECCCCCHHHHHHHHHHH--------------------------------
T ss_conf             989742882219999999986-98628999853766278899999999--------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             887565899999999743997099864622024542024677763034430232011320320223789
Q gi|254780414|r  304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       304 kiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                           .+.+...+.+.+ .+++.++.|+.+.|+...+....     .  ++|+.+.+.......+|||.
T Consensus        48 -----~~~~~~~~~a~~-~~~~~i~~G~~~~~~~~~~~~~~-----~--~~~~~~~~~~~~~~~~~pl~  103 (103)
T cd01986          48 -----AREEAAKRIAKE-KGAETIATGTRRDDVANRALGLT-----A--LLNLTVTLSGAGIQSLEPLI  103 (103)
T ss_pred             -----HHHHHHHHHHHH-CCCHHHCCCCCHHHHHHHHHHHH-----H--HHHEEEEECCCCCCCCCCCC
T ss_conf             -----999999999886-17214304753167788776189-----8--86304785145501035679


No 127
>PRK01269 thiamine biosynthesis protein ThiI; Provisional
Probab=98.54  E-value=7.5e-07  Score=69.18  Aligned_cols=158  Identities=21%  Similarity=0.332  Sum_probs=107.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--HHHHHHHHHH----CCCCCEEEEEHHHHHHHHHCC
Q ss_conf             4403664056404779999998622365699997389551562--7899998862----369857997588999999668
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE--VENIISLFKG----YPNFPLRVVDASERFIRKLKN  295 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE--~~~v~~~~~~----~~~~~l~~vda~~~Fl~~L~g  295 (520)
                      .++|++.+|||.||.|||.++-|- |-+.+++|.+-|=-. .|  .+++...+.+    ...+.++.||..+..-.-+..
T Consensus       177 qGkvL~LlSGGiDSPVAa~~mmKR-G~~v~~l~F~lg~~~-~e~~V~~va~~L~~~~~~~~~vr~~~V~f~~v~~eI~~~  254 (483)
T PRK01269        177 QEDVLSLISGGFDSGVASYMLMRR-GSRVHYCFFNLGGAA-HEIGVKQVAHYLWNRYGSSHRVRFISVDFEPVVGEILEK  254 (483)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHC-CCEEEEEEECCCCHH-HHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHH
T ss_conf             786899952788838889999845-987999995799868-899999999999997388887089997679999999873


Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHH
Q ss_conf             988899998875-6589999999974399709986462202454202467776303443023201132032022378987
Q gi|254780414|r  296 IVDPETKRKVIG-QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKEL  374 (520)
Q Consensus       296 v~DPE~KRkiIG-~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l  374 (520)
                      +  |+.-+-++- +.++++.++.|++. ++.-|.-|       ||-+...  |.|+.   |-.-.-....+-++-||--+
T Consensus       255 v--~~~~~~vv~KR~M~R~A~~iA~~~-g~~ALVTG-------ESLGQVA--SQTL~---NL~~i~~~~~~pVlRPLIg~  319 (483)
T PRK01269        255 V--DNGQMGVVLKRMMLRAASKVAERY-GIQALVTG-------EALGQVS--SQTLT---NLRLIDNVTDTLILRPLIAM  319 (483)
T ss_pred             C--CHHHEEHHHHHHHHHHHHHHHHHC-CCCEEEEC-------CCHHHHH--HHHHH---HHHHHHHHCCCCEECCCCCC
T ss_conf             8--763443999999999999999985-99889855-------5034567--76787---88998874077400476679


Q ss_pred             HHHHHHHHHHHHCCCHHHHCCCC
Q ss_conf             38999999998199988942688
Q gi|254780414|r  375 FKDEVRLLGKELRLPDSFVERHP  397 (520)
Q Consensus       375 ~KdEVR~lg~~Lglp~~~~~RhP  397 (520)
                      -|+|.-++++++|--+ +-.+.|
T Consensus       320 DK~eII~~Ar~IGTye-~s~~~p  341 (483)
T PRK01269        320 DKEDIIDLARQIGTED-FAKTMP  341 (483)
T ss_pred             CHHHHHHHHHHHCHHH-HHCCCC
T ss_conf             8899999999839287-760368


No 128
>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=98.53  E-value=4.7e-07  Score=70.66  Aligned_cols=144  Identities=23%  Similarity=0.283  Sum_probs=87.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             03664056404779999998622365699997389551562789999886236985799758899999966898889999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
                      |+++.+|||.||||+++.+.+. |..++++++|-|---.-|.+.... +.++++-. .+|-.                 |
T Consensus         1 kavvllSGGlDSt~~l~~~~~~-g~~v~~l~~dYGQr~~~E~~~a~~-i~~~l~~~-~~VP~-----------------R   60 (169)
T cd01995           1 KAVVLLSGGLDSTTCLAWAKKE-GYEVHALSFDYGQRHAKEEEAAKL-IAEKLGPS-TYVPA-----------------R   60 (169)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCHHHHHHHHHH-HHHHHCCC-CEECC-----------------C
T ss_conf             9899907878899999999984-996999997569854999999999-99996899-46528-----------------3


Q ss_pred             HHHHHHHHHHHHHHHHHCC--CCEE-EEEC--CCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHH
Q ss_conf             8875658999999997439--9709-9864--622024542024677763034430232011320320223789873899
Q gi|254780414|r  304 KVIGQLFIEVFEEEAKKIG--GAQF-LGQG--TLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDE  378 (520)
Q Consensus       304 kiIG~~Fi~vf~~~a~~~~--~~~~-L~QG--TlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdE  378 (520)
                      .   -.|+-+---.|..++  .+.+ ..++  +.|||-=..         -|++-.+.-.+-.....+++-||.++-|.|
T Consensus        61 N---~ifls~A~~~A~~~g~~~v~~G~~~~d~~~ypDc~~~---------F~~a~~~~~~~~~~~~v~i~aP~~~~~K~e  128 (169)
T cd01995          61 N---LIFLSIAAAYAEALGAEAIIIGVNAEDYSGYPDCRPE---------FIEAMNKALNLGTENGIKIHAPLIDLSKAE  128 (169)
T ss_pred             H---HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHH---------HHHHHHHHHHHCCCCCCEEEECCCCCCHHH
T ss_conf             8---9999999999998299968999824775689998699---------999999999830879858984333598999


Q ss_pred             HHHHHHHHCCCHHHHCCCCCC
Q ss_conf             999999819998894268889
Q gi|254780414|r  379 VRLLGKELRLPDSFVERHPCP  399 (520)
Q Consensus       379 VR~lg~~Lglp~~~~~RhPFP  399 (520)
                      +-++|.+||+|-+..|-=--|
T Consensus       129 iv~~g~~lgv~~~~T~SCy~g  149 (169)
T cd01995         129 IVRLGGELGVPLELTWSCYNG  149 (169)
T ss_pred             HHHHHHHCCCCHHHCCCCCCC
T ss_conf             999998849979982157799


No 129
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]
Probab=98.50  E-value=6.3e-06  Score=62.57  Aligned_cols=167  Identities=20%  Similarity=0.288  Sum_probs=111.1

Q ss_pred             HC-CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHH------HCCCCCEEEEEHHHHHHHH
Q ss_conf             04-4403664056404779999998622365699997389551562789999886------2369857997588999999
Q gi|254780414|r  220 VG-NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFK------GYPNFPLRVVDASERFIRK  292 (520)
Q Consensus       220 vg-~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~------~~~~~~l~~vda~~~Fl~~  292 (520)
                      || .+|++|.||||.||-|||.|+-|- |-..+++|.+++=-...+..+-...++      ....+.+..+|..+..-.-
T Consensus       172 vGt~Gk~l~LlSGGIDSPVA~~l~mkR-G~~v~~v~f~~~p~~~~~a~~k~~~l~~~~~~~~~~~~~~~~v~f~~v~~~i  250 (383)
T COG0301         172 VGTQGKVLLLLSGGIDSPVAAWLMMKR-GVEVIPVHFGNPPYTSEKAREKVVALALLRLTSYGGKVRLYVVPFTEVQEEI  250 (383)
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHC-CCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHH
T ss_conf             566774899970787749999999856-9877999972799851889999999986430246872289997629999999


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             66898889999887565899999999743997099864622024542024677763034430232011320320223789
Q gi|254780414|r  293 LKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       293 L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      +..+.+ ...=-.--+.|+++.++.|.+. ++.-+.-|       ||-+...  |.|.   +|-.-.-....+-++-||-
T Consensus       251 ~~~~~~-~y~~v~~rR~M~riA~~iae~~-g~~aIvtG-------EsLGQVA--SQTl---~nL~~i~~~t~~pIlRPLI  316 (383)
T COG0301         251 LEKVPE-SYRCVLLKRMMYRIAEKLAEEF-GAKAIVTG-------ESLGQVA--SQTL---ENLRVIDSVTNTPVLRPLI  316 (383)
T ss_pred             HHHCCC-CCEEHHHHHHHHHHHHHHHHHH-CCEEEEEC-------CCCHHHH--HHHH---HHHHHHHHCCCCCEECCCC
T ss_conf             863675-3020478999999999999983-98399836-------8610466--7678---8899998155874231445


Q ss_pred             HHHHHHHHHHHHHHCCCHHHHCCCCCCCCCC
Q ss_conf             8738999999998199988942688898311
Q gi|254780414|r  373 ELFKDEVRLLGKELRLPDSFVERHPCPGPGL  403 (520)
Q Consensus       373 ~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGL  403 (520)
                      -+-|+|.-++++++|..+--+  +|+...+.
T Consensus       317 ~~DK~eIi~~Ar~IgT~eiSi--~p~e~cc~  345 (383)
T COG0301         317 GLDKEEIIEIARRIGTYEISI--EPPEDCCV  345 (383)
T ss_pred             CCCHHHHHHHHHHHCCHHHHC--CCCCCCCC
T ss_conf             799899999999829744313--57888857


No 130
>pfam04204 HTS Homoserine O-succinyltransferase.
Probab=98.48  E-value=3.9e-06  Score=64.12  Aligned_cols=160  Identities=22%  Similarity=0.301  Sum_probs=100.1

Q ss_pred             CHHHHHHCCCCEEEECCCCCCC--CCCCCCCC-CHHHHH---C-CCCEEEECHHHHH-HHHHCCCEEEECCCCCCCEEEE
Q ss_conf             9889972399799998538899--99999753-768980---8-9988997789999-8997096999869866103667
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASS--LDIDSPQI-PKEILE---S-NIPLLGICYGQQI-MCQSLGGKTKNSQSREFGRAFI  113 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV--~d~~ap~~-~~~I~~---~-~iPILGICyG~Ql-La~~~GG~V~~~~~~EyG~~~I  113 (520)
                      ++++++..+++|+|++|-|-.-  +++-..+- ..+|++   . -...|.||+|.|. |-+.+|=.-...+.+-+|...-
T Consensus        90 ~f~~ik~~~~DGlIITGAPvE~l~FeeV~YW~El~~I~dWs~~~v~Stl~iCWaAqAaL~~~ygI~K~~l~~KlfGVf~h  169 (298)
T pfam04204        90 TFDEIKDEKFDGLIITGAPVEHLPFEDVDYWEELTEIMDWSKTNVTSTLHICWGAQAALYHFYGIPKHLLPEKLFGVFRH  169 (298)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             19999658875699728987778855374199999999999862544045749999999998199800178745885123


Q ss_pred             EE-CCCCCCCCCCCCCCCCEEEEEECCCHH--HC--CCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHH
Q ss_conf             52-388622278726655336860022011--01--24442112323983178898635001124652122215202577
Q gi|254780414|r  114 EI-KKNCSLLKGMWEKGSKQQVWMSHGDQV--EH--IPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL  188 (520)
Q Consensus       114 ~i-~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~--lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~i  188 (520)
                      .+ ..+++++.|+.+   .+.+-.|-.-.+  ..  -.++++++|.|+..-+..+..++.+..=+|-|||-.-    ..+
T Consensus       170 ~~~~~~~pLlrGfdd---~f~~PhSR~t~i~~~~i~~~~~L~iLa~s~~~G~~l~~~~d~r~vf~~GH~EYd~----~TL  242 (298)
T pfam04204       170 RVLDPHSPLLRGFDD---EFYAPHSRHTEVRREDIEAVPGLEILAESEEAGVYLVASKDGRQVFVTGHPEYDA----DTL  242 (298)
T ss_pred             CCCCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHCCCCCEEEECCCCCCEEEEECCCCCEEEEECCCCCCH----HHH
T ss_conf             457899801047876---5306742334699889713788479867787761799828988688827866675----489


Q ss_pred             HHHHHHHHCCCCCCCCCHHH
Q ss_conf             99875501064411140678
Q gi|254780414|r  189 IDNFVHHVAGIQDNWVMSSY  208 (520)
Q Consensus       189 L~NFl~~Ic~~~~~W~~~~~  208 (520)
                      .+-+..++.+-...--+.||
T Consensus       243 ~~EY~RD~~~g~~~~~P~NY  262 (298)
T pfam04204       243 KDEYERDLAKGLDIPIPENY  262 (298)
T ss_pred             HHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999769998999888


No 131
>pfam06508 ExsB ExsB. This family includes putative transcriptional regulators from Bacteria and Archaea.
Probab=98.47  E-value=8.7e-07  Score=68.75  Aligned_cols=107  Identities=23%  Similarity=0.306  Sum_probs=69.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHH---HHHCCCCC--
Q ss_conf             0366405640477999999862236569999738955156278999988623698579975889999---99668988--
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFI---RKLKNIVD--  298 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl---~~L~gv~D--  298 (520)
                      ||++.+|||+||||++.+..+. |++++|+++|.|..-.-|.+.-.+ +.+++|++.+++|-+....   ++|-+-..  
T Consensus         1 Kavvl~SGG~DSt~~l~~a~~~-~~~v~ait~dYGQ~~~~Ei~~A~~-ia~~l~i~h~vidl~~l~~~~~saL~~~~~~v   78 (137)
T pfam06508         1 KAVVLLSGGLDSTTCLAWAKKE-GYEVYALTFDYGQRHSKELECAKK-IAKALGVEHKIVDLDFLKQIGGSALTDDSIEV   78 (137)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCEEEEEEECCCCCHHHHHHHHHH-HHHHCCCCCEEECCCHHHHHCCCCCCCCCCCC
T ss_conf             9899917878999999999986-996899981478873999999999-99982997503033024441655223688555


Q ss_pred             HHH-------------HHHHHHHHHHHHHHHHHHHCCCCEEEEECC------CCCHH
Q ss_conf             899-------------998875658999999997439970998646------22024
Q gi|254780414|r  299 PET-------------KRKVIGQLFIEVFEEEAKKIGGAQFLGQGT------LYPDV  336 (520)
Q Consensus       299 PE~-------------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT------lypDv  336 (520)
                      |+.             -|.+   .|+-+.-..|..+ ++..++-|+      .|||-
T Consensus        79 p~~~~~~~~~~~t~VP~RN~---iflsiA~a~A~~~-g~~~I~~G~~~~D~~~YPDc  131 (137)
T pfam06508        79 PDSELESEEIPNTYVPGRNL---IFLSIAASYAEAI-GANDIFIGVNEEDFSGYPDC  131 (137)
T ss_pred             CCCCCCCCCCCCCEEECCHH---HHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCC
T ss_conf             66543456787765636549---9999999999986-99979995655756889998


No 132
>PRK05368 homoserine O-succinyltransferase; Provisional
Probab=98.40  E-value=4.6e-06  Score=63.59  Aligned_cols=149  Identities=21%  Similarity=0.269  Sum_probs=95.6

Q ss_pred             CHHHHHHCCCCEEEECCCCCCC--CCCCCCCC-CHHHHH----CCCCEEEECHHHHHHH-HHCCCEEEECCCCCCCEEEE
Q ss_conf             9889972399799998538899--99999753-768980----8998899778999989-97096999869866103667
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASS--LDIDSPQI-PKEILE----SNIPLLGICYGQQIMC-QSLGGKTKNSQSREFGRAFI  113 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV--~d~~ap~~-~~~I~~----~~iPILGICyG~QlLa-~~~GG~V~~~~~~EyG~~~I  113 (520)
                      ++++++..+++|+|++|-|---  +++-..+- -.+|++    .-...|.||+|.|... +.+|=.-...+.+-+|...-
T Consensus        91 ~f~~ik~~~~DGlIITGAPvE~l~Fe~V~YW~El~~I~dws~~~v~stl~iCWaA~AaL~~~ygI~K~~l~~K~fGVf~h  170 (302)
T PRK05368         91 TFEDIKDQKFDGLIVTGAPVELLPFEDVDYWDELREILDWAKTHVTSTLFICWAAQAALYHLYGIPKYTLPEKLSGVFEH  170 (302)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHCCCCEECCCCEEEEECC
T ss_conf             49999658776699728987778855374199999999999862652256749999999997099710068735875122


Q ss_pred             EE-CCCCCCCCCCCCCCCCEEEEEE-CCCHH--HCC--CCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHH
Q ss_conf             52-3886222787266553368600-22011--012--444211232398317889863500112465212221520257
Q gi|254780414|r  114 EI-KKNCSLLKGMWEKGSKQQVWMS-HGDQV--EHI--PEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ  187 (520)
Q Consensus       114 ~i-~~~~~lf~gl~~~~~~~~VwmS-H~D~V--~~l--P~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~  187 (520)
                      .+ ..+++|+.|+.+   .+.+--| |. .|  .++  .++++++|.|+..-+..+..++.+..=+|-|||-.-    ..
T Consensus       171 ~~~~~~~pL~rGfdd---~f~~PhSR~t-ei~~~~i~~~~~L~ILa~s~e~G~~l~~s~~~r~vfi~GH~EYd~----~T  242 (302)
T PRK05368        171 RVLVPHHPLLRGFDD---SFLVPHSRYT-EVREEDIRAATGLEILAESEEAGVYLFASKDKRIVFVTGHPEYDA----DT  242 (302)
T ss_pred             CCCCCCCHHHCCCCC---CCCCCCCCCC-CCCHHHHHHCCCCEEEECCCCCCCEEEECCCCCEEEEECCCCCCH----HH
T ss_conf             346899800137876---5306741223-689999950889679863677771699828988688827866675----48


Q ss_pred             HHHHHHHHHCC
Q ss_conf             79987550106
Q gi|254780414|r  188 LIDNFVHHVAG  198 (520)
Q Consensus       188 iL~NFl~~Ic~  198 (520)
                      +.+-+..++.+
T Consensus       243 L~~EY~RD~~~  253 (302)
T PRK05368        243 LAREYFRDLGR  253 (302)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999976


No 133
>PRK08576 hypothetical protein; Provisional
Probab=98.38  E-value=2.7e-06  Score=65.16  Aligned_cols=177  Identities=19%  Similarity=0.171  Sum_probs=95.6

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEH
Q ss_conf             67899999999765044403664056404779999998622365699997389551562789999886236985799758
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDA  285 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda  285 (520)
                      +.|.+..++-++ ++++..||...|||=|||++-.|..||++ ++..||||||+==..-.+.|.+ +.+++|++++..++
T Consensus       220 ~~~e~~s~~fL~-~~~~~~iiVp~SGGKDStA~LlLA~ea~~-dv~aVfvDTGlEfPeT~eyVe~-va~klGv~lv~a~~  296 (439)
T PRK08576        220 EAFEKASIEFLE-KFGEYTIIVPWSGGKDSTAALLLALKAFD-EVTAVYVDTGYEMPLTDEYVEK-VAEKLGVDLIRAGV  296 (439)
T ss_pred             HHHHHHHHHHHH-HCCCCCEEEECCCCHHHHHHHHHHHHHHC-CEEEEEEECCCCCHHHHHHHHH-HHHHHCCEEEEECC
T ss_conf             999999999999-62898889956887799999999998618-8369997079865758999999-99985976999478


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCC
Q ss_conf             89999996689888999988756589999999974399709986462202454202467776303443023201132032
Q gi|254780414|r  286 SERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM  365 (520)
Q Consensus       286 ~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~  365 (520)
                      ..-|  .+.+--=|-..++=....=++-..+.+++..+ ..+.+|-   ---||.... ...-++..--++|+..     
T Consensus       297 d~~~--~i~~~G~Pt~d~RWCtk~KL~PL~~~i~~~~~-~l~~vG~---R~~ES~~R~-~~~~v~~rn~~vg~~~-----  364 (439)
T PRK08576        297 DVPM--PIEGYGLPTHENRWCTKMKVEALYEAIRELSN-PLLVVGD---RDGESARRR-LRPPVRERETDFGKIL-----  364 (439)
T ss_pred             CCCC--HHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC-CEEEECC---CHHHHHHHH-CCCCEEECCCCCCCCE-----
T ss_conf             8642--21047999766633102002558999996489-7699527---256547761-1896355047777726-----


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCC
Q ss_conf             022378987389999999981999889426888
Q gi|254780414|r  366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPC  398 (520)
Q Consensus       366 ~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPF  398 (520)
                       -+-|+++----+|-.-=..-|+|-+=++.+=|
T Consensus       365 -~~~PIk~Wsa~~VwLYI~~~gip~NPLY~kGF  396 (439)
T PRK08576        365 -VVMPLKFWSGAMVQLYILMNGIELNPLYYEGF  396 (439)
T ss_pred             -EEECHHHCCHHHHHHHHHHCCCCCCHHHHCCC
T ss_conf             -67234307699999999975999984787477


No 134
>PRK11106 queuosine biosynthesis protein QueC; Provisional
Probab=98.30  E-value=1.3e-06  Score=67.58  Aligned_cols=157  Identities=21%  Similarity=0.268  Sum_probs=94.2

Q ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CHHHHHHHHHHCCCCC-EEEEEHHH---HHHHHHCCC-
Q ss_conf             40366405640477999999862236569999738955156-2789999886236985-79975889---999996689-
Q gi|254780414|r  223 ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKN-EVENIISLFKGYPNFP-LRVVDASE---RFIRKLKNI-  296 (520)
Q Consensus       223 ~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRkn-E~~~v~~~~~~~~~~~-l~~vda~~---~Fl~~L~gv-  296 (520)
                      +|+++.+|||.||||++++..+. |++++++.+|-|- |.. |-+.-.. +.+++|+. -.++|-+-   ..-++|-.- 
T Consensus         2 kkavVLlSGGlDStt~L~~a~~~-~~~v~alsfdYGQ-rh~~El~~A~~-ia~~~gv~~h~vidl~~l~~~~~SaLt~~~   78 (231)
T PRK11106          2 KRAVVVFSGGQDSTTCLIQALQQ-YDEVHCITFDYGQ-RHRAEIDVARE-LALKLGARAHKVLDVTLLNELAVSSLTRDS   78 (231)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCC-CCHHHHHHHHH-HHHHCCCCCEEEECCHHHHHHCCCCCCCCC
T ss_conf             80899907878999999999981-9949999877786-71999999999-999859840067532777775235667778


Q ss_pred             -CCHHHH--HHHHHHH--------HHHHHHHHHHHCCCCEEEEECC------CCCHH----HHHHCCCCCCCCEEEEEEC
Q ss_conf             -888999--9887565--------8999999997439970998646------22024----5420246777630344302
Q gi|254780414|r  297 -VDPETK--RKVIGQL--------FIEVFEEEAKKIGGAQFLGQGT------LYPDV----IESISFFGGPSSIIKSHHN  355 (520)
Q Consensus       297 -~DPE~K--RkiIG~~--------Fi~vf~~~a~~~~~~~~L~QGT------lypDv----IES~~~~~~~~~~IKsHHN  355 (520)
                       .-|+..  ..-+-.|        |+.+.--.|..++ ++.+.-|.      .|||-    |++-..      .+    |
T Consensus        79 i~vp~~~~~~~~~p~T~VP~RN~ifLsiAaa~Ae~~g-a~~I~~G~~~~D~sgYPDCr~eFi~a~~~------al----~  147 (231)
T PRK11106         79 IPVPDYEPEADGLPNTFVPGRNILFLTLAAIYAYQVK-AEAVITGVCETDFSGYPDCRDEFVKALNH------AV----V  147 (231)
T ss_pred             CCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCHHHHHHHHH------HH----H
T ss_conf             7777765444578764671672999999999999859-99599804655668899898999999999------99----8


Q ss_pred             CCCHHHHHCCCHHHHHHHHHHHHHHHHH---HHHCCCHHHHCCC
Q ss_conf             3201132032022378987389999999---9819998894268
Q gi|254780414|r  356 VGGLPEHMDMKLVEPLKELFKDEVRLLG---KELRLPDSFVERH  396 (520)
Q Consensus       356 vgglp~~~~~~liEPl~~l~KdEVR~lg---~~Lglp~~~~~Rh  396 (520)
                      .| .  .-+.+|.-||.+|-|-|+-+||   ..||+|-+..|-=
T Consensus       148 ~g-~--~~~i~i~aPl~~l~K~eiv~l~~~~~~L~~p~~~TwSC  188 (231)
T PRK11106        148 LG-M--AKDIRFETPLMWLDKAETWALADYYGQLDLVRHETLTC  188 (231)
T ss_pred             HC-C--CCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             51-7--89819983777788889999998616668650235527


No 135
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold.   The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase acti
Probab=98.29  E-value=2.3e-05  Score=58.57  Aligned_cols=164  Identities=21%  Similarity=0.224  Sum_probs=103.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHH----HCCCC
Q ss_conf             0366405640477999999862236--56999973895515627899998862369857997588999999----66898
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGI--NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRK----LKNIV  297 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~--~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~----L~gv~  297 (520)
                      +++++.|||-||||+..|+.+|...  .+.-+|+|||.. -.|..+-.+.+.+.+++++..+-....+...    ..+-.
T Consensus         1 ~~~vsfSGGKDS~vll~L~~~~~~~~~~~~vvf~DTg~e-~pet~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (173)
T cd01713           1 NVVVSFSGGKDSTVLLHLALKALPELKPVPVIFLDTGYE-FPETYEFVDRVAERYGLPLVVVRPPDSPAEGLALGLKGFP   79 (173)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCC-CHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCCC
T ss_conf             959996464999999999999665558837999688898-9899999999998739907999689728999986135779


Q ss_pred             CHHHHHHHHHH-HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHH
Q ss_conf             88999988756-58999999997439970998646220245420246777630344302320113203202237898738
Q gi|254780414|r  298 DPETKRKVIGQ-LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFK  376 (520)
Q Consensus       298 DPE~KRkiIG~-~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~K  376 (520)
                      .|...+.--.. .-++-+.+..++. +.....-|+=..   ||...  .......+..+   .+   +.-.+-||.+.-.
T Consensus        80 ~~~~~~~~c~~~~K~~P~~~~~~~~-~~~~~~~GiR~~---Es~~R--~~~~~~~~~~~---~~---~~~~~~Pi~~Wt~  147 (173)
T cd01713          80 LPSPDRRWCCRILKVEPLRRALKEL-GVVAWITGIRRD---ESARR--ALLPVVWTDDG---KG---GILKVNPLLDWTY  147 (173)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCC---CCHHH--CCCCCCCCCCC---CC---CEEEEECHHHCCH
T ss_conf             9832268898888078999999832-982899941214---62444--43762343268---89---9899932285999


Q ss_pred             HHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             999999998199988942688898
Q gi|254780414|r  377 DEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       377 dEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                      ++|-+.=+..|+|-.-++.+-|.-
T Consensus       148 ~dVw~yi~~~~l~~~~LY~~gy~s  171 (173)
T cd01713         148 EDVWAYLARHGLPYNPLYDQGYRS  171 (173)
T ss_pred             HHHHHHHHHCCCCCCCHHHCCCCC
T ss_conf             999999998399999178758987


No 136
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family. This domain is found in phosphoadenosine phosphosulfate (PAPS) reductase enzymes or PAPS sulfotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP). It is also found in NodP nodulation protein P from Rizobium which has ATP sulfurylase activity (sulfate adenylate transferase).
Probab=98.29  E-value=1.7e-05  Score=59.48  Aligned_cols=165  Identities=19%  Similarity=0.144  Sum_probs=108.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHH
Q ss_conf             03664056404779999998622365699997389551562789999886236985799758899999966898889999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR  303 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KR  303 (520)
                      +|+++.|||=||||+.-|+.++ +..+..+|+|+|.. -.|..+-.+.+.+.++++++++.+...+...+..-..|...-
T Consensus         1 ~v~vsfSGGKDS~vlL~L~~~~-~~~~~vvf~Dtg~e-fpet~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (174)
T pfam01507         1 ELVVSFSGGKDSLVLLHLASKA-FPPGPVIFIDTGYE-FPETYEFVDELEEKYGLNLKVYRPEDSFAEGINPEGIPSKLW   78 (174)
T ss_pred             CEEEEECCHHHHHHHHHHHHHH-CCCCCEEEEECCCC-CHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCCCHHHC
T ss_conf             9999957609999999999984-89975799978998-689999999999984981899808677987763127950114


Q ss_pred             HHHHHHH--HHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             8875658--99999999743997099864622024542024677763034430232011320320223789873899999
Q gi|254780414|r  304 KVIGQLF--IEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRL  381 (520)
Q Consensus       304 kiIG~~F--i~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~  381 (520)
                      .--...+  ++-+.+..++.+. ..+..|+=.-   ||.+..  ... +.+-.+  +.|..++   +-|+-+--.++|-+
T Consensus        79 ~~~~~~~~K~~p~~~~l~~~~~-~~~i~GiR~~---Es~~R~--~~~-~~~~~~--~~~~~~~---~~PI~~Wt~~DVw~  146 (174)
T pfam01507        79 EDCPCRLRKVEPLKRALKKLDF-DAWFTGLRRD---ESPSRA--KLP-IVSIDG--DFPKVIK---VFPLLNWTETDVWQ  146 (174)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCC-CEEEEEEECC---CHHHHH--HCC-EEEEEC--CCCCEEE---EECHHHCCHHHHHH
T ss_conf             5452146651799999986599-6899951002---445664--071-674305--7888599---95005299999999


Q ss_pred             HHHHHCCCHHHHCCCCCCCCC
Q ss_conf             999819998894268889831
Q gi|254780414|r  382 LGKELRLPDSFVERHPCPGPG  402 (520)
Q Consensus       382 lg~~Lglp~~~~~RhPFPGPG  402 (520)
                      -=+..|||..-++.+=|+=-|
T Consensus       147 yi~~~~lp~npLYd~Gy~siG  167 (174)
T pfam01507       147 YILANNVPYNPLYDQGYRSIG  167 (174)
T ss_pred             HHHHCCCCCCCHHHCCCCCCC
T ss_conf             999839999956875999879


No 137
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism]
Probab=98.28  E-value=5e-05  Score=56.18  Aligned_cols=169  Identities=16%  Similarity=0.333  Sum_probs=90.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCC-CEEEEECCCCCHHHHHHCCCCEEEECCCCCCCC-----CCCCCCCCHHHHHCCCCE
Q ss_conf             69999889705788998888659-406985289898899723997999985388999-----999975376898089988
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESK-VYCEVIAFKNALDYFKEQNPQAIILSGSPASSL-----DIDSPQIPKEILESNIPL   82 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelg-VyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~-----d~~ap~~~~~I~~~~iPI   82 (520)
                      +|-||-+-.-+..- .+.++.++ +.  ++.- ...+++.  ..+|+||.||-+...     +.+-...-++....+.|+
T Consensus         2 ~IGVLalQG~v~EH-~~~l~~~~~~e--~~~V-k~~~dL~--~~d~LIiPGGESTTi~rL~~~~gl~e~l~~~~~~G~Pv   75 (194)
T COG0311           2 KIGVLALQGAVEEH-LEALEKAGGAE--VVEV-KRPEDLE--GVDGLIIPGGESTTIGRLLKRYGLLEPLREFIADGLPV   75 (194)
T ss_pred             EEEEEEECCCHHHH-HHHHHHHCCCC--EEEE-CCHHHHC--CCCEEEECCCCHHHHHHHHHHCCCHHHHHHHHHCCCCE
T ss_conf             47999850468999-99998605873--5997-1778855--37678954950789999998738489999999769964


Q ss_pred             EEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCC-----------CCCCCCCCCCCCEEEEEECCCHHHCCCCCCCE
Q ss_conf             9977899998997096999869866103667523886-----------22278726655336860022011012444211
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNC-----------SLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEV  151 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~-----------~lf~gl~~~~~~~~VwmSH~D~V~~lP~gf~v  151 (520)
                      ||-|-||=+||+..-+.   ....-.|..++.+..|.           --++++.......-|+- -.-.|+++-++-++
T Consensus        76 ~GTCAGlIlLakei~~~---~~~~~Lg~mdi~V~RNAfGRQ~dSFe~~~di~~~~~~~~~~avFI-RAP~I~~vg~~V~v  151 (194)
T COG0311          76 FGTCAGLILLAKEILDG---PEQPLLGLLDVTVRRNAFGRQVDSFETELDIEGFGLPFPFPAVFI-RAPVIEEVGDGVEV  151 (194)
T ss_pred             EEECHHHHHHHHHHCCC---CCCCCCCEEEEEEECCCCCCCCCCCEEEEEEECCCCCCCCEEEEE-ECCEEEHHCCCCEE
T ss_conf             77514256534655089---877521227899981365543123010678641367776239999-86402000676067


Q ss_pred             EECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             232398317889863500112465212221520257799875
Q gi|254780414|r  152 IASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       152 iA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      +|+-++-++++-   +.|+.+.-||||.+...   .+-+-|+
T Consensus       152 La~l~~~iVav~---qgn~LatsFHPELT~D~---r~Heyf~  187 (194)
T COG0311         152 LATLDGRIVAVK---QGNILATSFHPELTDDT---RLHEYFL  187 (194)
T ss_pred             EEECCCEEEEEE---ECCEEEEECCCCCCCCC---CHHHHHH
T ss_conf             666088799998---67889985175435874---0999999


No 138
>PRK00509 argininosuccinate synthase; Provisional
Probab=98.26  E-value=1.9e-05  Score=59.15  Aligned_cols=103  Identities=27%  Similarity=0.364  Sum_probs=75.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHH-----HCCC
Q ss_conf             44036640564047799999986223656999973895515627899998862369857997588999999-----6689
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRK-----LKNI  296 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~-----L~gv  296 (520)
                      .+||++|.|||-|+||+...|.+--|-.++|+.+|.|-  ..|.+.+.+--.+..-.+..++|+.+.|.+.     +++-
T Consensus         2 ~kKVvLAySGGLDTSv~l~wL~e~yg~eVia~~~d~Gq--~~d~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~p~I~an   79 (398)
T PRK00509          2 VKKVVLAYSGGLDTSVIIKWLKEEYGCEVVAFTADVGQ--GEELEPIREKALASGASEIYVEDLREEFVRDYVFPAIRAN   79 (398)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCC--HHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCC
T ss_conf             85499990898459999999987539889999997988--7788999999998299789996309999999999999608


Q ss_pred             CCHHH--------HHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             88899--------998875658999999997439970998646
Q gi|254780414|r  297 VDPET--------KRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       297 ~DPE~--------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
                      .--|.        -|-.|.+.-+++    |++. +++++|.|-
T Consensus        80 a~Yeg~YpL~tslaRplia~~~ve~----A~~~-ga~aiaHG~  117 (398)
T PRK00509         80 ALYEGKYPLGTALARPLIAKKLVEI----ARKE-GADAVAHGC  117 (398)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHH----HHHC-CCEEEEECC
T ss_conf             5455854552203188999999999----9971-985998545


No 139
>PRK10696 C32 tRNA thiolase; Provisional
Probab=98.21  E-value=4.4e-05  Score=56.58  Aligned_cols=166  Identities=19%  Similarity=0.313  Sum_probs=103.2

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHH-----CCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             9999999976504440366405640477999999862-----23656999973895515627899998862369857997
Q gi|254780414|r  209 HKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA-----IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV  283 (520)
Q Consensus       209 ~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kA-----ig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~v  283 (520)
                      +-++|.+-.-.--.++|+.|||||-||.+...+|+.-     +.=.+.++.||+|.=-. +..-..+.++ .+|++..++
T Consensus        26 vgkAI~dy~MIedGDRVlVglSGGKDS~~LL~iL~~Lq~~api~FeLvAv~lD~~~pGf-~~~~L~~yl~-~lGvp~~i~  103 (311)
T PRK10696         26 VGEAIADFNMIEEGDRIMVCLSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPGF-PEHILPEYLE-KLGVEYKIV  103 (311)
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCC-CHHHHHHHHH-HCCCCCEEE
T ss_conf             99999985877899999998267888999999999999858998559999837899998-8068899999-749970799


Q ss_pred             EHHHHHHHHHCCCCCHHHHH--HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHC---CCCCCCCEEEEEECCCC
Q ss_conf             58899999966898889999--88756589999999974399709986462202454202---46777630344302320
Q gi|254780414|r  284 DASERFIRKLKNIVDPETKR--KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESIS---FFGGPSSIIKSHHNVGG  358 (520)
Q Consensus       284 da~~~Fl~~L~gv~DPE~KR--kiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~---~~~~~~~~IKsHHNvgg  358 (520)
                      .....-.  .+.. .||.|-  ---++.=-..+.+.|+++ ++.-+|-|.=.-|++|+--   ..+|.   +|+      
T Consensus       104 ~~d~~~i--v~~~-~~egks~CslCsRlRRg~Ly~~A~e~-G~nKIALGHH~DDi~ETfLMNlf~gG~---Lkt------  170 (311)
T PRK10696        104 EENTYGI--VKEK-IPEGKTTCSLCSRLRRGILYRTATEL-GATKIALGHHRDDILQTLFLNMFYGGK---MKG------  170 (311)
T ss_pred             EEEHHHH--HHHH-CCCCCCHHHHHHHHHHHHHHHHHHHC-CCCEEEECCCHHHHHHHHHHHHHHCCC---CCC------
T ss_conf             8407679--9875-43688637899999999999999986-998798606505589999999996687---636------


Q ss_pred             HHHHH-----CCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             11320-----32022378987389999999981999
Q gi|254780414|r  359 LPEHM-----DMKLVEPLKELFKDEVRLLGKELRLP  389 (520)
Q Consensus       359 lp~~~-----~~~liEPl~~l~KdEVR~lg~~Lglp  389 (520)
                      +|..+     +..+|-||.+.--.+..+.++.-++|
T Consensus       171 M~Pkl~~d~g~~~VIRPL~y~~E~di~~~a~~~~fP  206 (311)
T PRK10696        171 MPPKLMSDDGKHIVIRPLAYCREKDIERFADAKAFP  206 (311)
T ss_pred             CCCEEECCCCCEEEEEECCCCCHHHHHHHHHHCCCC
T ss_conf             797667489975998304201599999999975998


No 140
>KOG1559 consensus
Probab=98.20  E-value=3.3e-06  Score=64.64  Aligned_cols=187  Identities=18%  Similarity=0.286  Sum_probs=94.6

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHH--HH-CCCEEEEECCCCCHHHH--HHCCCCEEEECCCCCCCCCCCCCCCCHHHH
Q ss_conf             86344886999988970578899888--86-59406985289898899--723997999985388999999975376898
Q gi|254780414|r    2 HKRERSSKVLIIDFGSQFTQLIARRV--RE-SKVYCEVIAFKNALDYF--KEQNPQAIILSGSPASSLDIDSPQIPKEIL   76 (520)
Q Consensus         2 ~~~~~~~~IlIlDfGSQytqLIaRri--Re-lgVyseI~P~~~~~e~i--~~~~p~GIILSGGP~SV~d~~ap~~~~~I~   76 (520)
                      ++-+..++.+-=+.|+.|-  -|-.|  -| -|....-+-++.+.+.+  +..-+.|||+.||-.  ...+-..+.+.+|
T Consensus        60 hpg~g~~~rl~n~t~~~yI--AASYVK~aEsgGARViPli~nepEe~lfqklelvNGviftGGwa--k~~dY~~vvkkif  135 (340)
T KOG1559          60 HPGDGASGRLKNATGRSYI--AASYVKLAESGGARVIPLIYNEPEEILFQKLELVNGVIFTGGWA--KRGDYFEVVKKIF  135 (340)
T ss_pred             CCCCCCCCEECCCCCCCHH--HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCEEEECCCCC--CCCCHHHHHHHHH
T ss_conf             5788823201366673012--88899998718955887754880899999998736057417432--2240999999999


Q ss_pred             HC---------CCCEEEECHHHHHHHHHCC-CE--EEECCCCCCCEEEEEEC----CCCCCCCCCCC-----CCCCEEEE
Q ss_conf             08---------9988997789999899709-69--99869866103667523----88622278726-----65533686
Q gi|254780414|r   77 ES---------NIPLLGICYGQQIMCQSLG-GK--TKNSQSREFGRAFIEIK----KNCSLLKGMWE-----KGSKQQVW  135 (520)
Q Consensus        77 ~~---------~iPILGICyG~QlLa~~~G-G~--V~~~~~~EyG~~~I~i~----~~~~lf~gl~~-----~~~~~~Vw  135 (520)
                      ++         ..||.|||+|+.+|..... ++  .++.....+. ..++..    -++.+|.+++.     .....-|-
T Consensus       136 nk~le~nDaGehFPvyg~CLGFE~lsmiISqnrdile~~d~vd~A-ssLqF~~nvn~~~t~FQrFPpELLkkL~~dcLvm  214 (340)
T KOG1559         136 NKVLERNDAGEHFPVYGICLGFELLSMIISQNRDILERFDAVDVA-SSLQFVGNVNIHGTMFQRFPPELLKKLSTDCLVM  214 (340)
T ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHHHCCCCCC-CCEEEECCCCEEEHHHHHCCHHHHHHHCCCHHEE
T ss_conf             888760678663621243453899999985570687750320213-5302303554001157548999998735231100


Q ss_pred             EECCCHHHCCCCCC----------CEEECC-CC---CCEEEEEECCCCEEEEEEEEHHH----------CCCHHHH---H
Q ss_conf             00220110124442----------112323-98---31788986350011246521222----------1520257---7
Q gi|254780414|r  136 MSHGDQVEHIPEGF----------EVIASS-DS---TPFAFIADEKRKYYAVQFHPEVV----------HTVGGSQ---L  188 (520)
Q Consensus       136 mSH~D~V~~lP~gf----------~viA~S-~~---~~iaai~~~~~~iyGVQFHPEV~----------hT~~G~~---i  188 (520)
                      ..|...++  |++|          .++..+ +.   .-+.-++..+.|++|+|||||-.          |+++..+   -
T Consensus       215 q~Hk~gis--p~nF~~N~~Ls~FFnilTT~~D~~~k~fvSTv~~~kYPvtgfQWHPEKnafEWgss~IpHsedAiqvtqh  292 (340)
T KOG1559         215 QNHKFGIS--PKNFQGNPALSSFFNILTTCTDGNSKTFVSTVESKKYPVTGFQWHPEKNAFEWGSSDIPHSEDAIQVTQH  292 (340)
T ss_pred             ECCCCCCC--HHHCCCCHHHHHHHHHEEEECCCCCEEEEEEECCEECCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             03323446--2304579889978765333017985079885203012410045667557432355779987217899999


Q ss_pred             HHHHHHH
Q ss_conf             9987550
Q gi|254780414|r  189 IDNFVHH  195 (520)
Q Consensus       189 L~NFl~~  195 (520)
                      +.||+..
T Consensus       293 aA~~lVs  299 (340)
T KOG1559         293 AANYLVS  299 (340)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 141
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domain has  a strongly conserved motif SGGKD at the N terminus.
Probab=98.20  E-value=9e-06  Score=61.46  Aligned_cols=103  Identities=31%  Similarity=0.432  Sum_probs=72.7

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHH---HHHHHHC-CCCCHH
Q ss_conf             366405640477999999862236569999738955156278999988623698579975889---9999966-898889
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASE---RFIRKLK-NIVDPE  300 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~---~Fl~~L~-gv~DPE  300 (520)
                      +|+++|||+|||.+|.++.+-.|-|..||.+|+|+..+-..+++.++.+..+++.....+-+.   +.+..+. .+-||.
T Consensus         4 cIVpvSGGKDS~y~~~~lk~kyglnpL~Vt~~~~~~t~~g~~Nl~nl~~~g~D~~~~~~~~~~~~~l~~~~~~~~~gd~~   83 (154)
T cd01996           4 CIIGVSGGKDSSYALYLLKEKYGLNPLAVTVDNGFNSEEAVKNIKNLIKKGLDLDHLVINPEEMKDLQLARFKAKVGDPC   83 (154)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCH
T ss_conf             89968888189999999999949965999967987546899999999974998169932888999999999984479934


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9998875658999999997439970998646
Q gi|254780414|r  301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       301 ~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
                      .-=..-  .| ..--+.|.+. ++.+..-|.
T Consensus        84 ~~~~~~--i~-~~~~~~A~k~-~IplIi~Ge  110 (154)
T cd01996          84 WPCDTA--IF-TSLYKVALKF-GIPLIITGE  110 (154)
T ss_pred             HHHHHH--HH-HHHHHHHHHC-CCCEEEECC
T ss_conf             889987--99-8999999993-999899727


No 142
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated
Probab=98.13  E-value=1e-04  Score=54.01  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=7.8

Q ss_pred             CCCCEEEECHHHHHHHHH
Q ss_conf             899889977899998997
Q gi|254780414|r   78 SNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        78 ~~iPILGICyG~QlLa~~   95 (520)
                      .+.||+|+|=|+|+|+..
T Consensus       322 ~G~pi~aeCGG~~~Lg~~  339 (451)
T PRK01077        322 AGKPIYAECGGLMYLGES  339 (451)
T ss_pred             CCCCEEEECHHHHHHHHH
T ss_conf             699789987117887543


No 143
>PRK04527 argininosuccinate synthase; Provisional
Probab=98.13  E-value=8.7e-05  Score=54.44  Aligned_cols=157  Identities=18%  Similarity=0.240  Sum_probs=93.4

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHCC
Q ss_conf             44403664056404779999998622365699997389551562789999886236985799758899999-----9668
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLKN  295 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~g  295 (520)
                      ..+||++|.|||.|+||+-..|..- |-.++|+++|.|=-.--|.+.+.+-=.+..-....++|+.+.|.+     .++.
T Consensus         2 ~~kkVvLAySGGLDTSv~l~wL~e~-g~~Vi~~~ad~G~~~~e~~~~i~~kA~~~GA~~~~v~D~~~ef~~~~v~~~i~a   80 (397)
T PRK04527          2 STKDIVLAFSGGLDTSFCIPYLQER-GYAVHTVFADTGGVDAEERDFIEKRAAELGAASHVTVDGGPAIWEGFVKPFVWA   80 (397)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHC-CCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHH
T ss_conf             9875999908972899999999875-994799999789986151578999999819977999728999999999999860


Q ss_pred             CCCHHH-------HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHH
Q ss_conf             988899-------9988756589999999974399709986462202454202467776303443023201132032022
Q gi|254780414|r  296 IVDPET-------KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV  368 (520)
Q Consensus       296 v~DPE~-------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~li  368 (520)
                      -.-.|.       -|-.|.+.-+++    |++. ++..++-|-           +|+..+-+.=.-..-.|+   .++++
T Consensus        81 na~Yeg~YpL~tsaRplIak~~ve~----A~~~-ga~~iaHG~-----------TGkGNDQvRFe~~~~al~---~~~vi  141 (397)
T PRK04527         81 GEGYQGQYPLLVSDRYLIVDAALKR----AEEL-GTRIIAHGC-----------TGMGNDQVRFDLAVKALG---DYQIV  141 (397)
T ss_pred             CHHHCCCCCCCCCHHHHHHHHHHHH----HHHC-CCEEEECCC-----------CCCCCCHHHHHHHHHHCC---CCCCC
T ss_conf             6454185556321079999999999----9972-983840476-----------667870256776888636---76543


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCC
Q ss_conf             378987389999999981999889426888983
Q gi|254780414|r  369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGP  401 (520)
Q Consensus       369 EPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGP  401 (520)
                      -|.|+...+.-  .+|.--+  +....|.||=|
T Consensus       142 AP~R~~~~~~~--~~R~~~~--~ya~~~gipv~  170 (397)
T PRK04527        142 APIREIQKEHT--QTRAYEQ--KYLEERGFGVR  170 (397)
T ss_pred             CCHHHHHHCCH--HHHHHHH--HHHHHCCCCCC
T ss_conf             65565310222--0299999--76786499988


No 144
>PRK13820 argininosuccinate synthase; Provisional
Probab=98.12  E-value=2e-05  Score=59.07  Aligned_cols=148  Identities=27%  Similarity=0.336  Sum_probs=91.4

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHCC
Q ss_conf             44036640564047799999986223-65699997389551562789999886236985799758899999-----9668
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLKN  295 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~g  295 (520)
                      .+||++|.|||.|+||+...|..-.| +.++|+.+|.|- -..|.+.+.+.-. .+|....++|+.+.|.+     ++++
T Consensus         3 ~kKVvLAySGGLDTSv~l~wL~e~yg~~eVi~~~~d~Gq-~~e~~~~~~~kA~-~~G~~~~viD~r~ef~~~~i~paI~a   80 (395)
T PRK13820          3 KKKVVLAYSGGLDTSVCIPLLKEKYGYDEVITVAVDVGQ-PEEEIKEAEEKAK-KLGVKHYTIDAKEEFAKDYIFPAIKA   80 (395)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEECCC-CHHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHHHHHHHC
T ss_conf             872999968984899999999985199869999998999-7677699999999-70994999816999999999999970


Q ss_pred             CCCHH-------HHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHH
Q ss_conf             98889-------99988756589999999974399709986462202454202467776303443023201132032022
Q gi|254780414|r  296 IVDPE-------TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV  368 (520)
Q Consensus       296 v~DPE-------~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~li  368 (520)
                      -.--|       --|-.|.+.-+++    |++. +++.+|-|--          ..|+ +-+.-.  +.-  ....++++
T Consensus        81 na~YegYpL~tslaRplia~~~v~~----A~~~-ga~aiaHG~T----------GkGN-DQvRFe--~~~--~ap~~~ii  140 (395)
T PRK13820         81 NALYEGYPLGTALARPLIAKKIVEV----AKKE-GASAIAHGCT----------GKGN-DQLRFE--AVF--RATDLDVI  140 (395)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHH----HHHC-CCEEEEECCC----------CCCC-HHHHHH--HHH--HCCCCEEE
T ss_conf             8732673032410468999999999----9975-9829830777----------8987-099999--998--67898687


Q ss_pred             HHHHHHH--HHHHHHHHHHHCCCHH
Q ss_conf             3789873--8999999998199988
Q gi|254780414|r  369 EPLKELF--KDEVRLLGKELRLPDS  391 (520)
Q Consensus       369 EPl~~l~--KdEVR~lg~~Lglp~~  391 (520)
                      -|.|+..  ..|-.+-+++-|+|-.
T Consensus       141 aP~R~~~~~R~~~i~ya~~~gI~v~  165 (395)
T PRK13820        141 APIRELNLTREWEIEYAKEHGIPVP  165 (395)
T ss_pred             EEECCHHHHHHHHHHHHHHCCCCCC
T ss_conf             2104533458999999998599888


No 145
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell. ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway . Almost all the proteins in this group have an N-terminal THUMP domain (see IPR004114 from INTERPRO).; GO: 0009228 thiamin biosynthetic process.
Probab=98.03  E-value=6.2e-06  Score=62.65  Aligned_cols=155  Identities=23%  Similarity=0.324  Sum_probs=114.1

Q ss_pred             C-CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH-------CCCCCEEEEEHHHHHHHH
Q ss_conf             4-44036640564047799999986223656999973895515627899998862-------369857997588999999
Q gi|254780414|r  221 G-NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG-------YPNFPLRVVDASERFIRK  292 (520)
Q Consensus       221 g-~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~-------~~~~~l~~vda~~~Fl~~  292 (520)
                      | .+||+|.||||.||-|||.|+=|= |=++..||.+|.=+..+++.+-++.+..       ...+.+..+|-.+. ...
T Consensus       184 G~~Gkvl~LlSGGiDSPVAaf~~m~R-Gc~V~~vhf~~~~~~~~~~~~kv~~la~~~~~~~~~~~~~l~~~~F~~~-~~~  261 (391)
T TIGR00342       184 GTQGKVLALLSGGIDSPVAAFLAMKR-GCRVVAVHFFNEPAASEKAREKVERLANLLSLNETGGSVKLYVVDFTDV-QEE  261 (391)
T ss_pred             CCHHHHHHHHCCCCCHHHHHHHHHHC-CCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEEECHHHH-HHH
T ss_conf             02536320411883516799999663-8779999732885524689999999999885400037999998543899-999


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHH-HH
Q ss_conf             66898889999887565899999999743997099864622024542024677763034430232011320320223-78
Q gi|254780414|r  293 LKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE-PL  371 (520)
Q Consensus       293 L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liE-Pl  371 (520)
                      |....++...==+.-+.|+++.++.+.+. ++.-|.-|       ||=|-.  .|.|++   |---.......-++- ||
T Consensus       262 ~~~~~~e~~~~v~~rR~M~~~A~~~ae~~-g~~A~VTG-------e~LGQV--ASQTL~---Nl~vI~~~~~~~iL~RPL  328 (391)
T TIGR00342       262 IIEIIPEKYTMVLCRRLMLKIASKVAEKE-GCLAIVTG-------ESLGQV--ASQTLE---NLRVIQAVVNTPILRRPL  328 (391)
T ss_pred             HHHCCCCCCEEEEHHHHHHHHHHHHHHHC-CCCEEEEC-------CCCCCH--HHHHHH---HHHHHHHCCCCCEEECCC
T ss_conf             98418998788740667999999888860-99489976-------634203--777888---999997237874240775


Q ss_pred             HHHHHHHHHHHHHHHCCCH
Q ss_conf             9873899999999819998
Q gi|254780414|r  372 KELFKDEVRLLGKELRLPD  390 (520)
Q Consensus       372 ~~l~KdEVR~lg~~Lglp~  390 (520)
                      =-+=|+|.-++++++|==+
T Consensus       329 Ig~DK~~Ii~~Ak~IgTye  347 (391)
T TIGR00342       329 IGMDKEEIIELAKEIGTYE  347 (391)
T ss_pred             CCCCHHHHHHHHHHCCCEE
T ss_conf             5479789999974139621


No 146
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]
Probab=98.03  E-value=1.7e-05  Score=59.43  Aligned_cols=169  Identities=24%  Similarity=0.357  Sum_probs=106.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCC--CCCH
Q ss_conf             44036640564047799999986223656999973895515627899998862369857997588999999668--9888
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN--IVDP  299 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~g--v~DP  299 (520)
                      .+|+++.+|||-|||++|+...+- ++.++++++|=|-=-.-|-+-..+.- +.+|++.++||-+  |++++.|  .||+
T Consensus         2 ~~kavvl~SGG~DStt~l~~a~~~-~~ev~alsfdYGQrh~~Ele~A~~ia-k~lgv~~~iid~~--~~~~~~~saLtd~   77 (222)
T COG0603           2 MKKAVVLLSGGLDSTTCLAWAKKE-GYEVHALTFDYGQRHRKELEAAKELA-KKLGVPHHIIDVD--LLGEIGGSALTDD   77 (222)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCHHHHHHHHHHH-HHCCCCEEEECHH--HHHHCCCCCCCCC
T ss_conf             834999916881389999999960-98899997507898689999999999-9819982895416--8753588867588


Q ss_pred             H----HHH---HHHHHH--------HHHHHHHHHHHCCCCEEEEEC---C---CCCHH----HHHHCCCCCCCCEEEEEE
Q ss_conf             9----999---887565--------899999999743997099864---6---22024----542024677763034430
Q gi|254780414|r  300 E----TKR---KVIGQL--------FIEVFEEEAKKIGGAQFLGQG---T---LYPDV----IESISFFGGPSSIIKSHH  354 (520)
Q Consensus       300 E----~KR---kiIG~~--------Fi~vf~~~a~~~~~~~~L~QG---T---lypDv----IES~~~~~~~~~~IKsHH  354 (520)
                      +    +.+   ..|-.|        |+-+---.|..++ +..+.-|   |   -|||-    ||+-..      +++   
T Consensus        78 ~~~vp~~~~~~~~~p~t~VP~RN~iflsiA~~~Ae~~g-~~~I~~Gv~~~D~sgYPDcrpefi~a~~~------~~~---  147 (222)
T COG0603          78 SIDVPKYEFAEEEIPATFVPARNLIFLSIAAAYAEALG-ADAIIIGVNEEDFSGYPDCRPEFIEALNE------ALN---  147 (222)
T ss_pred             CCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCCCHHHHHHHHH------HHH---
T ss_conf             86366666666668644760660999999999998759-98599975321047899888899999999------998---


Q ss_pred             CCCCHHHHHCCC-HHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCC-CEEEEC
Q ss_conf             232011320320-223789873899999999819998894268889831-112210
Q gi|254780414|r  355 NVGGLPEHMDMK-LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPG-LAIRCI  408 (520)
Q Consensus       355 Nvgglp~~~~~~-liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPG-LaiRi~  408 (520)
                          |--...++ +.-||-+|-|.|.-++|.+||.|-+..|-===++++ ..=||.
T Consensus       148 ----l~~~~~~~~i~aPl~~l~Ka~iv~l~~elg~~~~~T~SCY~g~~~~~CG~C~  199 (222)
T COG0603         148 ----LGTEKGVRIIHAPLMELTKAEIVKLADELGVPLELTWSCYNGGEGDHCGECE  199 (222)
T ss_pred             ----HHCCCCCCEEECCEEECCHHHHHHHHHHHCCCCHHCEEEECCCCCCCCCCCH
T ss_conf             ----6255786177678331349999998888688510026776799988787777


No 147
>pfam00733 Asn_synthase Asparagine synthase. This family is always found associated with pfam00310. Members of this family catalyse the conversion of aspartate to asparagine.
Probab=98.01  E-value=5.9e-05  Score=55.67  Aligned_cols=84  Identities=17%  Similarity=0.110  Sum_probs=59.0

Q ss_pred             HHHHHHHHHHH-CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHH-
Q ss_conf             99999997650-4440366405640477999999862236569999738955156278999988623698579975889-
Q gi|254780414|r  210 KEIVSRIKEQV-GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASE-  287 (520)
Q Consensus       210 ~~~i~~Ir~~v-g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~-  287 (520)
                      +...+.++.+. .|..|=+.||||+|||+.|+++++....++.|.-++..--..+|.......-+ +++++.+.++... 
T Consensus         4 ~ll~~aV~~~l~sdvpig~~LSGGlDSs~ia~l~~~~~~~~i~~~s~~~~~~~~~E~~~a~~~a~-~~~~~~~~v~~~~~   82 (195)
T pfam00733         4 ELLRDAVKRRLRADVPVGVLLSGGLDSSLIAALAARQSSPPLKTFSVGFEGSDYDEAPYAELVAD-HLGTDHHEIIVTEE   82 (195)
T ss_pred             HHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHH-HHCCCCEEEEECHH
T ss_conf             99999999983469836753067468999999999853899538955788899758999999996-51335178772559


Q ss_pred             HHHHHHC
Q ss_conf             9999966
Q gi|254780414|r  288 RFIRKLK  294 (520)
Q Consensus       288 ~Fl~~L~  294 (520)
                      .|++.+.
T Consensus        83 ~~~~~~~   89 (195)
T pfam00733        83 ELLDALP   89 (195)
T ss_pred             HHHHHHH
T ss_conf             9999988


No 148
>pfam00764 Arginosuc_synth Arginosuccinate synthase. This family contains a PP-loop motif.
Probab=97.93  E-value=0.00015  Score=52.71  Aligned_cols=98  Identities=28%  Similarity=0.346  Sum_probs=72.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHCCCCCHH
Q ss_conf             664056404779999998622365699997389551562789999886236985799758899999-----966898889
Q gi|254780414|r  226 ICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLKNIVDPE  300 (520)
Q Consensus       226 i~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~gv~DPE  300 (520)
                      ++|-|||.|+||+...|.+- |..++|+.+|.|- -..+.+.+.+.-.+..-....++|+.+.|.+     ++++-.--|
T Consensus         1 VLAySGGLDTSv~l~wL~e~-~~eVia~~~d~Gq-~~ed~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~p~i~ana~Ye   78 (389)
T pfam00764         1 VLAYSGGLDTSVCIPWLKEK-YYEVIAVAVDVGQ-GEEDLDEAREKALKLGAVKHYVIDAKEEFVEDYIFPAIKANALYE   78 (389)
T ss_pred             CEEECCCCHHHHHHHHHHHC-CCEEEEEEEECCC-CHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCCCCC
T ss_conf             96036762899999999970-9928999997999-778789999999982997899973799999998999996686744


Q ss_pred             H--------HHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             9--------99887565899999999743997099864
Q gi|254780414|r  301 T--------KRKVIGQLFIEVFEEEAKKIGGAQFLGQG  330 (520)
Q Consensus       301 ~--------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QG  330 (520)
                      -        -|-.|.+.-+++    |++. +++.+|-|
T Consensus        79 g~Y~L~tslaRplia~~~v~~----A~~~-ga~aiaHG  111 (389)
T pfam00764        79 GRYPLGTALARPLIAKKLVEA----AKKE-GADAVAHG  111 (389)
T ss_pred             CCEEECCCCHHHHHHHHHHHH----HHHC-CCEEEEEC
T ss_conf             647852432166999999999----8763-97699436


No 149
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional
Probab=97.92  E-value=0.0002  Score=51.80  Aligned_cols=10  Identities=40%  Similarity=0.763  Sum_probs=6.5

Q ss_pred             CEEEECCCCC
Q ss_conf             7999985388
Q gi|254780414|r   52 QAIILSGSPA   61 (520)
Q Consensus        52 ~GIILSGGP~   61 (520)
                      +-||+-|||.
T Consensus       433 ~~vi~lGG~t  442 (1294)
T PRK05297        433 AKLIVLGGPA  442 (1294)
T ss_pred             CEEEEECCCC
T ss_conf             9999978965


No 150
>PRK05370 argininosuccinate synthase; Validated
Probab=97.90  E-value=8.5e-05  Score=54.50  Aligned_cols=148  Identities=20%  Similarity=0.306  Sum_probs=91.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHH----HC---
Q ss_conf             44036640564047799999986223656999973895515627899998862369857997588999999----66---
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRK----LK---  294 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~----L~---  294 (520)
                      .+||++|.|||.|+||+-..|..- |-.++|+.+|.|---..+.+.+.+-=.+..-.+..++|+.+.|.+.    |+   
T Consensus        11 gkKVvLAYSGGLDTSv~l~wL~e~-g~eVia~taDvGQ~de~d~~~i~~kA~~~GA~k~~v~D~reefv~~~i~ai~a~A   89 (447)
T PRK05370         11 GQRVGIAFSGGLDTSAALLWMRQK-GAVPYAYTANLGQPDEDDYDAIPRRAMEYGAENARLIDCRAQLVAEGIAAIQCGA   89 (447)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHC-CCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCC
T ss_conf             888999958982799999999875-9879999997999861338999999998299789997179999999999997362


Q ss_pred             ------CC----CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHC
Q ss_conf             ------89----88899998875658999999997439970998646220245420246777630344302320113203
Q gi|254780414|r  295 ------NI----VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD  364 (520)
Q Consensus       295 ------gv----~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~  364 (520)
                            |.    +-|= -|-+|...-+++    |++. +++..|.|--.          .|+.. +.=  -+.+.--.=.
T Consensus        90 ~y~~~~g~~Y~l~t~l-aRplia~~lv~~----a~~~-ga~~iaHGaTG----------KGNDQ-VRF--e~~~~~l~P~  150 (447)
T PRK05370         90 FHISTGGVTYFNTTPL-GRAVTGTMLVAA----MKED-GVNIWGDGSTY----------KGNDI-ERF--YRYGLLTNPE  150 (447)
T ss_pred             HHHHCCCCCCCCCCCH-HHHHHHHHHHHH----HHHH-CCCEEEECCCC----------CCCCH-HHH--HHHHHHHCCC
T ss_conf             3330257644587730-788999999999----9983-99899557767----------87438-899--9999852998


Q ss_pred             CCHHHHHHHHH-------HHHHHHHHHHHCCC
Q ss_conf             20223789873-------89999999981999
Q gi|254780414|r  365 MKLVEPLKELF-------KDEVRLLGKELRLP  389 (520)
Q Consensus       365 ~~liEPl~~l~-------KdEVR~lg~~Lglp  389 (520)
                      ++++-|-|+.-       .+|--+-.++-|+|
T Consensus       151 lkIiaPwRd~~f~~el~sR~e~i~Ya~~~gIp  182 (447)
T PRK05370        151 LKIYKPWLDQDFIDELGGRAEMSEFMIACGFD  182 (447)
T ss_pred             CEEECCCCCHHHHHHCCCHHHHHHHHHHCCCC
T ss_conf             76971433466665415749999999984998


No 151
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1. The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.
Probab=97.83  E-value=0.0004  Score=49.69  Aligned_cols=124  Identities=15%  Similarity=0.174  Sum_probs=69.1

Q ss_pred             CHHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             01101244421123239831788986350011246521222152025779987550106441114067899999999765
Q gi|254780414|r  140 DQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQ  219 (520)
Q Consensus       140 D~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~  219 (520)
                      ..|.++|+|-.++-..++..+..     +..|-+.|.|....++                  +...+.+.+...+.++.+
T Consensus       198 ~~I~~l~PG~~l~~~~~~~~~~~-----~~yw~~~~~~~~~~~~------------------~e~~~~~~~ll~~sV~~r  254 (628)
T TIGR03108       198 KGVKKLEPGHTLTLRRGAPPARP-----RCYWDVSFAPAAPLSE------------------ADALAELIERLREAVRSR  254 (628)
T ss_pred             CCCEECCCCCEEEEECCCCCEEE-----EEECCCCCCCCCCCCH------------------HHHHHHHHHHHHHHHHHH
T ss_conf             57413189707999889871578-----7613676565679999------------------999999999999999998


Q ss_pred             H-CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCE--EEEEHHH
Q ss_conf             0-444036640564047799999986223656999973895515627899998862369857--9975889
Q gi|254780414|r  220 V-GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPL--RVVDASE  287 (520)
Q Consensus       220 v-g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l--~~vda~~  287 (520)
                      . .|-.|=+.||||+|||..++++.+..++++.+.-|.-.--..+|.....+.- +++|.+-  ..++..+
T Consensus       255 l~sDVpvG~~LSGGlDSS~I~a~~~~~~~~~i~tfsi~f~~~~~DE~~~A~~vA-~~~g~~h~~~~~~~~~  324 (628)
T TIGR03108       255 MVADVPLGAFLSGGVDSSAVVALMAGLSDTPVNTCSIAFDDPAFDESAYARQVA-ERYGTNHRVETVDPDD  324 (628)
T ss_pred             HCCCCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHH-HHHCCCCEEEECCHHH
T ss_conf             057885687646886368999999984299864366534888754369999999-8608764799779899


No 152
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=97.82  E-value=0.00014  Score=52.90  Aligned_cols=172  Identities=22%  Similarity=0.196  Sum_probs=111.5

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH
Q ss_conf             99999765044403664056404779999998622365699997389551562789999886236985799758899999
Q gi|254780414|r  212 IVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR  291 (520)
Q Consensus       212 ~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~  291 (520)
                      .+....+..++ .++.+.|||.||+|+..|+.|+..+ +.-+|+|||+.=. |..+-.+.+.+.+++++++....+.+..
T Consensus        30 i~~~~~~~~~~-~~~~~~S~Gkds~V~l~L~~k~~~~-~~vif~DTg~~f~-Et~~~~d~~~~~~~~~l~~~~~~~~~~~  106 (261)
T COG0175          30 ILRWAAEEFSN-PVVVSFSGGKDSTVLLHLAAKAFPD-FPVIFLDTGYHFP-ETYEFRDRLAEEYGLDLKVYRPDDEVAE  106 (261)
T ss_pred             HHHHHHHHCCC-CEEEEECCCHHHHHHHHHHHHHCCC-CCEEEEECCCCCH-HHHHHHHHHHHHCCCEEEEECCCHHHHH
T ss_conf             99999987489-7599812746799999999860258-7189970777578-8999999999872971798167323443


Q ss_pred             H---HCCCCCHHHHHHHHHHHHHH---HHHHHHHHCCC-CEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHC
Q ss_conf             9---66898889999887565899---99999974399-70998646220245420246777630344302320113203
Q gi|254780414|r  292 K---LKNIVDPETKRKVIGQLFIE---VFEEEAKKIGG-AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD  364 (520)
Q Consensus       292 ~---L~gv~DPE~KRkiIG~~Fi~---vf~~~a~~~~~-~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~  364 (520)
                      .   ......|..-|   .-+.+.   =+.+..++.+. +++.++=   -|  ||.+..   .-.+-+  ..+..++.  
T Consensus       107 ~~~~~~~~~~~~~~r---~c~~i~K~~pl~~al~~~~~~a~~~G~R---rd--es~~Ra---k~~~~~--~~~~~~~~--  171 (261)
T COG0175         107 GEKYGGKLWEPSVER---WCCDIRKVEPLKRALDEYGFDAWFTGLR---RD--ESPTRA---KLPVVS--FDSEFGES--  171 (261)
T ss_pred             HHHCCCCCCCCCCCH---HHHHHHHHHHHHHHHHHCCCCEEEEECC---CC--CCCCCC---CCCEEC--CCCCCCCC--
T ss_conf             442136679997402---3325685513999996358624998612---04--563202---486453--46787683--


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             20223789873899999999819998894268889831
Q gi|254780414|r  365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPG  402 (520)
Q Consensus       365 ~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPG  402 (520)
                       --+-||.+---.||-.-=..-+||-+-++.+=|+-=|
T Consensus       172 -~rv~Pl~~Wt~~dVw~Yi~~~~lp~npLy~~Gy~siG  208 (261)
T COG0175         172 -IRVNPLADWTELDVWLYILANNLPYNPLYDQGYRSIG  208 (261)
T ss_pred             -EEECCHHCCCHHHHHHHHHHHCCCCCCHHHCCCCCCC
T ss_conf             -6871532099999999999958998841125888248


No 153
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ).  CobQ plays a role in cobalamin biosythesis.   CobQ catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin.  CobQ belongs to the triad family of amidotransferases.  Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobQ.
Probab=97.76  E-value=0.00016  Score=52.51  Aligned_cols=81  Identities=27%  Similarity=0.414  Sum_probs=50.5

Q ss_pred             EEEEECC--CCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC---CCCCCCHHHH---HCCCC
Q ss_conf             9999889--70578899888865940698528989889972399799998538899999---9975376898---08998
Q gi|254780414|r   10 VLIIDFG--SQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI---DSPQIPKEIL---ESNIP   81 (520)
Q Consensus        10 IlIlDfG--SQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~---~ap~~~~~I~---~~~iP   81 (520)
                      |+|+.++  |.+|-+= .+.++-+|-.+.+....   .  ..+++.|||.|+.+..-|-   ....++.+|.   +.+.|
T Consensus         1 iavi~lp~isNftDf~-~l~~~~~v~v~~v~~~~---~--l~~~D~iIlPGsK~t~~DL~~l~~~Gl~~~i~~~~~~g~~   74 (194)
T cd01750           1 IAVIRYPDISNFTDLD-PLAREPGVDVRYVEVPE---G--LGDADLIILPGSKDTIQDLAWLRKRGLAEAIKNYARAGGP   74 (194)
T ss_pred             CEEEECCCCCCHHHHH-HHHCCCCCEEEEECCCC---C--CCCCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             9788269746645547-76006993899967977---6--4669999989988389999999874979999999975997


Q ss_pred             EEEECHHHHHHHHHC
Q ss_conf             899778999989970
Q gi|254780414|r   82 LLGICYGQQIMCQSL   96 (520)
Q Consensus        82 ILGICyG~QlLa~~~   96 (520)
                      |||||-|+|+|++.+
T Consensus        75 vlgICGGyQmLG~~i   89 (194)
T cd01750          75 VLGICGGYQMLGKYI   89 (194)
T ss_pred             EEEECHHHHHHHCEE
T ss_conf             899736567300035


No 154
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B  catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .
Probab=97.75  E-value=0.00024  Score=51.27  Aligned_cols=74  Identities=19%  Similarity=0.173  Sum_probs=52.7

Q ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHH-HHHHHH
Q ss_conf             504440366405640477999999862236569999738955156278999988623698579975889-999996
Q gi|254780414|r  219 QVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASE-RFIRKL  293 (520)
Q Consensus       219 ~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~-~Fl~~L  293 (520)
                      ...|.+|-+.||||+|||..|+++.+....++.+.-++.+.--.+|.+.....- ++++++.+.+.... .|.+.+
T Consensus        12 l~sd~~vg~~LSGGlDSs~ia~~~~~~~~~~~~~~s~~~~~~~~de~~~a~~va-~~~~~~~~~i~~~~~~~~~~~   86 (269)
T cd01991          12 LRSDVPVGVLLSGGLDSSLVAALAARLLPEPVKTFSIGFGFEGSDEREYARRVA-EHLGTEHHEVEFTPADLLAAL   86 (269)
T ss_pred             HCCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHH-HHCCCCCEEEECCHHHHHHHH
T ss_conf             544885686513569999999999983689984799862899973789999999-980988245314348899999


No 155
>PRK02628 nadE NAD synthetase; Reviewed
Probab=97.71  E-value=0.00023  Score=51.38  Aligned_cols=162  Identities=20%  Similarity=0.193  Sum_probs=85.2

Q ss_pred             HHCCCCEEEEECCCCHHHHH---HHHHHHHCC---CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHH
Q ss_conf             50444036640564047799---999986223---656999973895515627899998862369857997588999999
Q gi|254780414|r  219 QVGNERVICAVSGGVDSTVA---AFLIYEAIG---INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRK  292 (520)
Q Consensus       219 ~vg~~kVi~~lSGGVDStV~---A~Ll~kAig---~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~  292 (520)
                      +.|-++|++|||||+|||.|   |+..-.|+|   ++++||..= |+---+++.+=-..+.+.+|+++..++=++.+..-
T Consensus       359 k~g~~~vViGLSGGiDSaLaLLVaa~A~d~Lg~~r~~V~~vtMP-s~~TS~~S~~dA~~La~~LGi~~~~I~I~~a~~~~  437 (678)
T PRK02628        359 ATGIKKVVIGISGGLDSTLALLVAAKAFDRLGLPRKNILAYTMP-GFGTTDRTKNNAVALMKALGVTAREIDIRPAALQM  437 (678)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHCEEEEECC-CCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHH
T ss_conf             64998189967776447999999999999848971224899778-87657878999999999729977997629999999


Q ss_pred             HCCCCCHHHHHH-H--HHHHHHHH------HHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             668988899998-8--75658999------99999743997099864622024542024677763034430232011320
Q gi|254780414|r  293 LKNIVDPETKRK-V--IGQLFIEV------FEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM  363 (520)
Q Consensus       293 L~gv~DPE~KRk-i--IG~~Fi~v------f~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~  363 (520)
                      ++.+..|-.... .  |-.+-|+-      ....++   ..-+|+-||  -|.=|.+-+        =+.-|+|    +|
T Consensus       438 ~~di~~~~~~~~~~~Dvt~ENiQAR~R~~iLM~laN---k~g~LVL~T--GNkSElAvG--------y~Ty~yG----D~  500 (678)
T PRK02628        438 LKDIGHPFARGEKVYDVTFENVQAGERTQILFRLAN---QRGGLVIGT--GDLSELALG--------WCTYGVG----DH  500 (678)
T ss_pred             HHHHCCHHHCCCCCCCCHHHHHHHHHHHHHHHHHHC---CCCCEEEEC--CCCCHHHHC--------EECCCCC----CC
T ss_conf             998444222378776602665203556789999745---779679736--851468648--------3104775----41


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHC-----------CCHHHHCCCCCC
Q ss_conf             320223789873899999999819-----------998894268889
Q gi|254780414|r  364 DMKLVEPLKELFKDEVRLLGKELR-----------LPDSFVERHPCP  399 (520)
Q Consensus       364 ~~~liEPl~~l~KdEVR~lg~~Lg-----------lp~~~~~RhPFP  399 (520)
                      . --.-|++++.|-.||.|.+.+.           ++.+++...|=|
T Consensus       501 m-g~yavn~~VpKTlV~~L~r~~a~~~~~~~~~~~vl~~Il~tpiSp  546 (678)
T PRK02628        501 M-SHYNVNASVPKTLIQHLIRWVAESGQFDEAVSEVLLDILDTPISP  546 (678)
T ss_pred             C-CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCC
T ss_conf             2-462446788378999999999862444531125689854699991


No 156
>PRK08384 thiamine biosynthesis protein ThiI; Provisional
Probab=97.66  E-value=0.00033  Score=50.29  Aligned_cols=131  Identities=18%  Similarity=0.226  Sum_probs=84.4

Q ss_pred             HC-CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH-CCCCCEEEEEHHHHHHHHHCCCC
Q ss_conf             04-44036640564047799999986223656999973895515627899998862-36985799758899999966898
Q gi|254780414|r  220 VG-NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG-YPNFPLRVVDASERFIRKLKNIV  297 (520)
Q Consensus       220 vg-~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~-~~~~~l~~vda~~~Fl~~L~gv~  297 (520)
                      +| .+||++.+|||. |.|||.++-|= |-+++++|.++|=--..-..++.+.+++ ..+.++..+-..           
T Consensus       176 vGs~Gk~l~LlSGGi-SPVAa~~mmKR-G~~v~~vhf~~~~~~~~kv~~l~~~L~~y~~~~~~~~~~~~-----------  242 (310)
T PRK08384        176 IGTQGKMVGLLSDEL-SAVAIFLMMKR-GVEVIPVHIGMGEKNLEKVRKLWNQLKKYSYGSKGRLVVVK-----------  242 (310)
T ss_pred             CCCCCCEEEEECCCC-CHHHHHHHHHC-CCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEC-----------
T ss_conf             467884899953886-39999999856-98799998568878999999999999986799846999966-----------


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHH
Q ss_conf             88999988756589999999974399709986462202454202467776303443023201132032022378987389
Q gi|254780414|r  298 DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKD  377 (520)
Q Consensus       298 DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~Kd  377 (520)
                       |.           +..++.|+++ ++.=|.-|       ||-+...  |.|+.   |..-.-....+-++-||--+=|+
T Consensus       243 -~~-----------~~a~~ia~~~-~~~alvTG-------EsLGQVA--SQTl~---nl~~i~~~~~~PVlRPLIg~DK~  297 (310)
T PRK08384        243 -NF-----------ERVNKIIRDF-GAKGVVKG-------LRPEQLA--SETLE---NIYEDSRMFDVPVYYPLIALPDE  297 (310)
T ss_pred             -HH-----------HHHHHHHHHH-CCCEEEEC-------CCHHHHH--HHHHH---HHHHHHHCCCCCCCCCCCCCCHH
T ss_conf             -59-----------9999999985-99899977-------4125545--45798---89999730488730385689989


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999998199
Q gi|254780414|r  378 EVRLLGKELRL  388 (520)
Q Consensus       378 EVR~lg~~Lgl  388 (520)
                      |.-++++++|.
T Consensus       298 EII~~Ar~IGT  308 (310)
T PRK08384        298 YIEKVKEKIGT  308 (310)
T ss_pred             HHHHHHHHCCC
T ss_conf             99999986388


No 157
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterized by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity
Probab=97.63  E-value=0.0014  Score=45.84  Aligned_cols=101  Identities=30%  Similarity=0.342  Sum_probs=71.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHCCCCCH
Q ss_conf             3664056404779999998622365699997389551562789999886236985799758899999-----96689888
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLKNIVDP  299 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~gv~DP  299 (520)
                      |++|-|||.|+||+-..|.+--+-.++|+.+|.|--- .+.+.+.+-=.+..-.+..++|+++.|.+     ++++-.--
T Consensus         1 VvLAySGGLDTSv~l~wL~e~~~~eVia~~~d~Gq~~-e~~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~pai~ana~Y   79 (385)
T cd01999           1 VVLAYSGGLDTSVILKWLKEKGGYEVIAVTADVGQPE-EEIEAIEEKALKLGAKKHVVVDLREEFVEDYIFPAIQANALY   79 (385)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCCCH-HHHHHHHHHHHHHCCCEEEEECHHHHHHHHHHHHHHHHCCCC
T ss_conf             9799778817999999999745984999999899966-777899999998199789996129999999999999608643


Q ss_pred             HH--------HHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             99--------998875658999999997439970998646
Q gi|254780414|r  300 ET--------KRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       300 E~--------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
                      |.        -|-.|.+.-+++    |++. ++..+|-|-
T Consensus        80 eg~Y~L~tslaRplIak~~ve~----A~~~-ga~aiaHG~  114 (385)
T cd01999          80 EGTYPLGTALARPLIAKALVEV----AKEE-GADAVAHGC  114 (385)
T ss_pred             CCCEECCCCHHHHHHHHHHHHH----HHHH-CCEEEEECC
T ss_conf             3753213501578999999999----9980-984997456


No 158
>pfam07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain.
Probab=97.63  E-value=0.00018  Score=52.11  Aligned_cols=48  Identities=25%  Similarity=0.556  Sum_probs=34.4

Q ss_pred             CCCCEEEECCCCCCCCCCC---CCCCCHHH---HHCCCCEEEECHHHHHHHHHC
Q ss_conf             3997999985388999999---97537689---808998899778999989970
Q gi|254780414|r   49 QNPQAIILSGSPASSLDID---SPQIPKEI---LESNIPLLGICYGQQIMCQSL   96 (520)
Q Consensus        49 ~~p~GIILSGGP~SV~d~~---ap~~~~~I---~~~~iPILGICyG~QlLa~~~   96 (520)
                      .++++|||.||-...++..   ...+..+|   .+.+.||||||-|+|+|+..+
T Consensus         6 ~~~D~lilpGg~~~~~~~~~~~~~~~~~~i~~~~~~G~pi~giCGG~q~Lg~~i   59 (158)
T pfam07685         6 GDADLVILPGGKPTIQDLALLRNSGLDEALREHAEAGGPILGICGGYQMLGETI   59 (158)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHCCCCEEEECHHHHHHHHHH
T ss_conf             998799989954099999998775579999999977996999875889876550


No 159
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily  including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF). The domain forms a apha/beta/apha fold which  binds to Adenosine nucleotide.
Probab=97.62  E-value=0.00019  Score=52.05  Aligned_cols=84  Identities=24%  Similarity=0.277  Sum_probs=60.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHH--CCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHH
Q ss_conf             366405640477999999862--236569999738955156278999988623698579975889999996689888999
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEA--IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK  302 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kA--ig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~K  302 (520)
                      +++++|||.||++++.++++.  -+.++..+.++                                              
T Consensus         1 ilv~~Sgg~dS~~~~~la~~~~~~~~~~~~~~~~----------------------------------------------   34 (86)
T cd01984           1 ILVALSGGLDSSVLLHLAKRLKSGGPEVVALVVV----------------------------------------------   34 (86)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEHH----------------------------------------------
T ss_conf             9788617853899999999852599808976389----------------------------------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHH
Q ss_conf             98875658999999997439970998646220245420246777630344302320113203202237
Q gi|254780414|r  303 RKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEP  370 (520)
Q Consensus       303 RkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEP  370 (520)
                            .|.+...+.+.+. +++++.+|+-++|+.+......         +|+...++.....++.|
T Consensus        35 ------~~~~~~~~~~~~~-~~~~i~~G~~~~~~~~~~~~~~---------~~~~~~~~~~~~~vl~p   86 (86)
T cd01984          35 ------AFVRILKRLAAEE-GADVIILGHNADDVAGRRLGAS---------ANVLVVIKGAGIPVLTP   86 (86)
T ss_pred             ------HHHHHHHHHHHHC-CCCEEEECCCCHHHHHHCCCCC---------CCEEEEEECCCCCCCCC
T ss_conf             ------9999999987760-8988998677324533101665---------54899981688643187


No 160
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase. CobB plays a role in cobalamin biosythesis catalyzing the conversion of cobyrinic acid to cobyrinic acid a,c-diamide.  CobB belongs to the triad family of amidotransferases.  Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobB.
Probab=97.59  E-value=0.0013  Score=46.11  Aligned_cols=162  Identities=17%  Similarity=0.184  Sum_probs=88.0

Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC---CCCCC---HHHHHCCCCEEEECHHHHH
Q ss_conf             05788998888659406985289898899723997999985388999999---97537---6898089988997789999
Q gi|254780414|r   18 QFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID---SPQIP---KEILESNIPLLGICYGQQI   91 (520)
Q Consensus        18 QytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~---ap~~~---~~I~~~~iPILGICyG~Ql   91 (520)
                      -|...+ +.+|++|+  |+++++--.++ ..-+.+|++|.||-=-.|.+.   .-...   ++..+.+.||++.|=|||.
T Consensus        12 yY~enl-~~L~~~Ga--elv~FSPl~d~-~lP~~d~lylgGGyPE~~a~~Ls~N~~~~~~ir~~~~~G~PiyAECGGlMy   87 (198)
T cd03130          12 YYPENL-ELLEAAGA--ELVPFSPLKDE-ELPDADGLYLGGGYPELFAEELSANQSMRESIRAFAESGGPIYAECGGLMY   87 (198)
T ss_pred             ECHHHH-HHHHHCCC--EEEEECCCCCC-CCCCCCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             579999-99998899--78987776788-899876898279987588999976799999999999849977998204888


Q ss_pred             HHHHCCC--------------EEEECCCCCCCEEEEEECCCCCCCCC-CCCCCCCEEEEEECCCHHHCCCC---CCCEEE
Q ss_conf             8997096--------------99986986610366752388622278-72665533686002201101244---421123
Q gi|254780414|r   92 MCQSLGG--------------KTKNSQSREFGRAFIEIKKNCSLLKG-MWEKGSKQQVWMSHGDQVEHIPE---GFEVIA  153 (520)
Q Consensus        92 La~~~GG--------------~V~~~~~~EyG~~~I~i~~~~~lf~g-l~~~~~~~~VwmSH~D~V~~lP~---gf~viA  153 (520)
                      |+..+-+              ++...++.-+|...+....+++++.. ..-..-.+     |.-.++..++   -+++.-
T Consensus        88 L~~~i~~~~G~~~~M~Gllp~~~~m~~rl~lGY~~~~~~~~~~~~~~g~~lrGHEF-----HyS~~~~~~~~~~~~~~~~  162 (198)
T cd03130          88 LGESLDDEEGQSYPMAGVLPGDARMTKRLGLGYREAEALGDTLLGKKGTTLRGHEF-----HYSRLEPPPEPDFAATVRR  162 (198)
T ss_pred             HHHHCCCCCCCEEEEEEEEEEEEEECCCCCCCEEEEEECCCCCCCCCCCEEEEEEE-----EEEEEECCCCCCCEEEEEE
T ss_conf             74220558998975021151688977763256389998278622379968887775-----5104031898752079981


Q ss_pred             CC-CCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHH
Q ss_conf             23-98317889863500112465212221520257799875
Q gi|254780414|r  154 SS-DSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV  193 (520)
Q Consensus       154 ~S-~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl  193 (520)
                      .. .+..-+++..  ++++|-..|-=-.   .-.++.+||+
T Consensus       163 ~~g~~~~~~G~~~--~n~~asY~H~h~~---~~p~~~~~fv  198 (198)
T cd03130         163 GRGIDGGEDGYVY--GNVLASYLHLHWA---SNPDLAERFV  198 (198)
T ss_pred             CCCCCCCCCEEEE--CCEEEEEEEECCC---CCHHHHHHHC
T ss_conf             5699888278998--9999998786787---3957999659


No 161
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase. Members of this protein family are closely related to several isoforms of asparagine synthetase (glutamine amidotransferase) and typically have been given this name in genome annotation to date. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and a member of the GNAT family of acetyltransferases.
Probab=97.47  E-value=0.0014  Score=45.89  Aligned_cols=90  Identities=19%  Similarity=0.176  Sum_probs=55.1

Q ss_pred             HHHHHHHHHHHH-CCCCEEEEECCCCHHHHHHHHHHHHCCCCE---EEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             999999997650-444036640564047799999986223656---9999738955156278999988623698579975
Q gi|254780414|r  209 HKEIVSRIKEQV-GNERVICAVSGGVDSTVAAFLIYEAIGINL---TCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD  284 (520)
Q Consensus       209 ~~~~i~~Ir~~v-g~~kVi~~lSGGVDStV~A~Ll~kAig~~l---~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vd  284 (520)
                      .+...+.++.+. .|-.|=+.||||+|||+.++++.+.-.+++   ++.|-|.+--+.+|.+.....-+ +++.+.+.+.
T Consensus       246 ~~~l~~sV~~rl~sDvpvg~~LSGGlDSS~i~a~~~~~~~~~i~tfs~~f~~~~~~~~dE~~~a~~va~-~~~~~h~~~~  324 (589)
T TIGR03104       246 LEALRLAVKRRLVADVPVGVLLSGGLDSSLIVGLLAEAGVDGLRTFSIGFEDVGGEKGDEFEYSDIIAE-RFHTRHHKIR  324 (589)
T ss_pred             HHHHHHHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHH-HHCCCCEEEE
T ss_conf             999999999997446763000178754389999999956999852788724688776667999999999-7387857999


Q ss_pred             H-HHHHHHH----HCCCCCH
Q ss_conf             8-8999999----6689888
Q gi|254780414|r  285 A-SERFIRK----LKNIVDP  299 (520)
Q Consensus       285 a-~~~Fl~~----L~gv~DP  299 (520)
                      - .+.|++.    +.-..+|
T Consensus       325 ~~~~~~~~~l~~~~~~~deP  344 (589)
T TIGR03104       325 IPNHRVLPALPEAVAAMSEP  344 (589)
T ss_pred             ECCHHHHHHHHHHHHCCCCC
T ss_conf             57178999889988526898


No 162
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated
Probab=97.45  E-value=0.0025  Score=44.08  Aligned_cols=194  Identities=20%  Similarity=0.297  Sum_probs=95.8

Q ss_pred             ECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC--CCCCCHHHHHCCCCEEEECHHHHH
Q ss_conf             889705788998888659406985289898899723997999985388999999--975376898089988997789999
Q gi|254780414|r   14 DFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID--SPQIPKEILESNIPLLGICYGQQI   91 (520)
Q Consensus        14 DfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~--ap~~~~~I~~~~iPILGICyG~Ql   91 (520)
                      |||.-=|++|    .|.|           ..+++  +.+++|+.||.  .-+.+  .+.+.++|.+.+-+|+|||-|+|+
T Consensus        18 ~FG~LPTkii----~enn-----------~k~ik--dLD~lIIPGGS--lvEs~sl~~elk~eI~~f~~~IiGICsGFQi   78 (482)
T PRK06278         18 NFGNLPTKII----KENN-----------IKAIK--DLDMLIIPGGS--IVESGSLTDELKKEILDFDNYILGICSGFQI   78 (482)
T ss_pred             HCCCCCHHHH----CCCC-----------HHHHH--CCCEEEECCCC--EEECCCCCHHHHHHHHHCCCEEEEECHHHHH
T ss_conf             2167863664----4367-----------22353--07579965973--5733775778999998627858996116788


Q ss_pred             HHHHCC-CEEEECCC-CC-CCEEEEEEC------------CCCCCCCCCCCCCCCEEEEEECCCHHHC-CCCCCCEEECC
Q ss_conf             899709-69998698-66-103667523------------8862227872665533686002201101-24442112323
Q gi|254780414|r   92 MCQSLG-GKTKNSQS-RE-FGRAFIEIK------------KNCSLLKGMWEKGSKQQVWMSHGDQVEH-IPEGFEVIASS  155 (520)
Q Consensus        92 La~~~G-G~V~~~~~-~E-yG~~~I~i~------------~~~~lf~gl~~~~~~~~VwmSH~D~V~~-lP~gf~viA~S  155 (520)
                      |+..-. |+-.+.+. +| -|.-+++..            .++.+|.+-......+++   |.+.=.+ .+...+.+..|
T Consensus        79 L~~kiDIGRKS~vPIikeGLGLLdV~fsPlictDrV~f~i~~~~~~~~~~~~~~GFHC---HTYG~Iei~~~~tk~lt~S  155 (482)
T PRK06278         79 LAEKIDIGRKSPVPIIKEGLGLLNVEFSPLICTDRVKFNIENDSFFGEKNESGTGFHC---HTYGNIEITNNSTKKLTYS  155 (482)
T ss_pred             HHHHCCCCCCCCCCEEECCCCCEEEEEEEEEECCEEEEEEECCCCCCCCCCCEEEEEE---ECCCCEEECCCCCCEEEHH
T ss_conf             7764376667999741004552014661136515156897514003555773312553---1014378427887522465


Q ss_pred             C-----------CCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH----
Q ss_conf             9-----------8317889863500112465212221520257799875501064411140678999999997650----
Q gi|254780414|r  156 D-----------STPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQV----  220 (520)
Q Consensus       156 ~-----------~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~v----  220 (520)
                      .           ...+.+..  +.++||++-|-=..    -..+-.||+ +.-+++.+=.-  .+-+.-+.||+++    
T Consensus       156 ~i~klNYk~~~~~~IlSG~~--kgkV~GTmVHn~LD----n~~v~~N~l-~~l~~~e~e~e--eIf~kNk~lk~~lk~~~  226 (482)
T PRK06278        156 KIQKLNYKMVGKQNILSGVF--KGNVYGTMVHNLLD----NNFVVNNIL-KYLDITEEEKE--EIFKKNKILKEKLKSES  226 (482)
T ss_pred             HHHHHCCCCCCCCEEEEEEC--CCCCHHHHHHHHCC----HHHHHHHHH-HHCCCCHHHHH--HHHHHHHHHHHHHHHHH
T ss_conf             54340234367640552001--68461454555424----288999999-87288778899--99987699999998873


Q ss_pred             ---------------CCCCEEEEECCCCHHHHH
Q ss_conf             ---------------444036640564047799
Q gi|254780414|r  221 ---------------GNERVICAVSGGVDSTVA  238 (520)
Q Consensus       221 ---------------g~~kVi~~lSGGVDStV~  238 (520)
                                     +.++-|..+|-|-||--+
T Consensus       227 ~i~~~~~~~~~~k~~~~kkgiiLl~TgS~SGKT  259 (482)
T PRK06278        227 KISTNNKKIDRNKNPEVKKGIILLATGSESGKT  259 (482)
T ss_pred             CCCCCCCHHHCCCCCCCCCEEEEEECCCCCCCE
T ss_conf             666674023304788899659998437877743


No 163
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=97.44  E-value=0.0032  Score=43.27  Aligned_cols=154  Identities=23%  Similarity=0.299  Sum_probs=97.9

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHCC
Q ss_conf             44403664056404779999998622365699997389551562789999886236985799758899999-----9668
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLKN  295 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~g  295 (520)
                      ..+||++|-|||.|-|||-..|..-.|..++++.+|-|-= ..|.+.+.+-=.+....+..++|+.+.|-+     .+++
T Consensus         3 ~~kkvvLAYSGGLDTSv~i~wL~e~~~~eVit~tadvGQ~-eed~~~i~eKA~~~Ga~~~~viD~reeFv~~yi~~~i~a   81 (403)
T COG0137           3 KVKKVVLAYSGGLDTSVAIKWLKEKGGAEVIAVTADVGQP-EEDLDAIREKALELGAEEAYVIDAREEFVEDYIFPAIKA   81 (403)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHCCCEEEEEEEECCCC-HHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHH
T ss_conf             7767999954882399999999976594699999758997-577579999999818852899643899999999999973


Q ss_pred             CCCHHH--------HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCH
Q ss_conf             988899--------998875658999999997439970998646220245420246777630344302320113203202
Q gi|254780414|r  296 IVDPET--------KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL  367 (520)
Q Consensus       296 v~DPE~--------KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~l  367 (520)
                      -.-.|-        -|-.|++.-+++.++    . ++..+|-|--          ..|+.. ..=  -++..--.-.+++
T Consensus        82 na~Yeg~YpL~TalaRPLIak~lVe~A~k----~-Ga~avaHGcT----------GKGNDQ-vRF--E~~~~al~pdlki  143 (403)
T COG0137          82 NALYEGVYPLGTALARPLIAKKLVEAAKK----E-GADAVAHGCT----------GKGNDQ-VRF--ELAILALNPDLKI  143 (403)
T ss_pred             HCEEECCCCCCCHHHHHHHHHHHHHHHHH----C-CCCEEEECCC----------CCCCCE-EEE--EEEHHHHCCCCEE
T ss_conf             05121564145434677999999999997----1-9969974678----------888753-543--2004541899679


Q ss_pred             HHHHHHH--HHHHHHHHHHHHCCCHHHH
Q ss_conf             2378987--3899999999819998894
Q gi|254780414|r  368 VEPLKEL--FKDEVRLLGKELRLPDSFV  393 (520)
Q Consensus       368 iEPl~~l--~KdEVR~lg~~Lglp~~~~  393 (520)
                      +-|-|+.  -..|--+-+++-|+|-..-
T Consensus       144 iAP~Rew~~~R~~~i~Ya~~~gipv~~~  171 (403)
T COG0137         144 IAPWREWNLTREEEIEYAEEHGIPVKAT  171 (403)
T ss_pred             EEEHHHHCCCHHHHHHHHHHCCCCCCCC
T ss_conf             8563341337699999999849976656


No 164
>TIGR01001 metA homoserine O-succinyltransferase; InterPro: IPR005697    This family of enzymes, homoserine O-succinyltransferase (2.3.1.46 from EC), catalyses the first step in the biosynthesis of methionine.  Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine. ; GO: 0008415 acyltransferase activity, 0019281 methionine biosynthetic process from homoserine via O-succinyl-L-homoserine and cystathionine, 0005737 cytoplasm.
Probab=97.43  E-value=0.0008  Score=47.55  Aligned_cols=146  Identities=25%  Similarity=0.335  Sum_probs=92.2

Q ss_pred             CHHHHHHCCCCEEEECCCCCCCCC--CCCCCC-CHHHHH---CCC-CEEEECHHHHHHHHHCCCEEE-ECCCCCCCEEEE
Q ss_conf             988997239979999853889999--999753-768980---899-889977899998997096999-869866103667
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASSLD--IDSPQI-PKEILE---SNI-PLLGICYGQQIMCQSLGGKTK-NSQSREFGRAFI  113 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV~d--~~ap~~-~~~I~~---~~i-PILGICyG~QlLa~~~GG~V~-~~~~~EyG~~~I  113 (520)
                      .++++++.+.||+|++|-|-.--+  +-+.|- -.+|++   .+| -.|=||+|.|.=-..|=|-=+ .-..+=.|.-.-
T Consensus        91 ~fe~vk~~~FDG~IvTGAP~el~~Fe~VaYW~~l~~i~~w~k~~VtStlyiCWaaqAaL~~lYg~pK~~~~~KlsGVY~H  170 (305)
T TIGR01001        91 TFEEVKDRKFDGLIVTGAPVELVDFEDVAYWEELKEIMEWSKQNVTSTLYICWAAQAALKYLYGIPKITLDEKLSGVYKH  170 (305)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEEHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEE
T ss_conf             47888512788158847762446644322368999999987506705204778999999987178732223220002443


Q ss_pred             EEC-CCCCCCCCCCCCCCCEEEEEECC-------CHHHCCC--CCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCC
Q ss_conf             523-88622278726655336860022-------0110124--4421123239831788986350011246521222152
Q gi|254780414|r  114 EIK-KNCSLLKGMWEKGSKQQVWMSHG-------DQVEHIP--EGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV  183 (520)
Q Consensus       114 ~i~-~~~~lf~gl~~~~~~~~VwmSH~-------D~V~~lP--~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~  183 (520)
                      .+. +.+.|+.|+     .-.+||=|+       ..+.+++  .+++++|.|+..-+=.+..++++..=|--|||-.-  
T Consensus       171 ~~~~~~~~L~rg~-----Dd~flaPHSRy~~~~~e~i~~~~kqG~L~ILa~~~~~gvY~~a~kd~r~iFvtGHpEYd~--  243 (305)
T TIGR01001       171 DIVKPDDLLLRGF-----DDKFLAPHSRYADFDAEQILELTKQGDLEILAESDEAGVYLAALKDERNIFVTGHPEYDA--  243 (305)
T ss_pred             EEECCCCCCCCCC-----CCCCCCCCCCCCCCCHHHHHHHCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCHHHH--
T ss_conf             2226734332268-----711117747766776899985014564000001254567898623664588846823677--


Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             0257799875501
Q gi|254780414|r  184 GGSQLIDNFVHHV  196 (520)
Q Consensus       184 ~G~~iL~NFl~~I  196 (520)
                        .++-.-|+.++
T Consensus       244 --~TL~~EY~RD~  254 (305)
T TIGR01001       244 --YTLHQEYVRDV  254 (305)
T ss_pred             --HHHHHCCEEEC
T ss_conf             --76541221000


No 165
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS). Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS). HTS, the first enzyme in methionine biosynthesis in Escherichia coli, transfers a succinyl group from succinyl-CoA to homoserine forming succinyl homoserine.  It has been suggested that the succinyl group of succinyl-CoA is initially transferred to an enzyme nucleophile before subsequent transfer to homoserine. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with GATase1 domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. It has been proposed that this cys is in the active site of the molecule. However, as succinyl has been found bound to a conserved lysine residue, this conserved cys may play a role in dimer formation.  HTS acti
Probab=97.43  E-value=0.00076  Score=47.71  Aligned_cols=86  Identities=21%  Similarity=0.264  Sum_probs=60.0

Q ss_pred             CHHHHHHCCCCEEEECCCCCCCCC--CCCCCC-CHHHHH----CCCCEEEECHHHHHHHHHCCC-EEEECCCCCCCEEEE
Q ss_conf             988997239979999853889999--999753-768980----899889977899998997096-999869866103667
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASSLD--IDSPQI-PKEILE----SNIPLLGICYGQQIMCQSLGG-KTKNSQSREFGRAFI  113 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV~d--~~ap~~-~~~I~~----~~iPILGICyG~QlLa~~~GG-~V~~~~~~EyG~~~I  113 (520)
                      ++++++..+++|+|++|-|-.-.+  +-..+- -.+|++    .-...|+||+|.|....++-| .-...+.+-+|...-
T Consensus        54 ~~~~i~~~~~DglIITGAPve~l~fe~v~YW~El~~i~dwa~~~v~stl~iCWaA~Aal~~~ygI~k~~l~~K~fGVf~h  133 (175)
T cd03131          54 TFDDIRDAKFDGLIVTGAPVEHLPFEQVDYWEELTEILDWAKTHVTSTLFSCWAAMAALYYFYGIKKHQLPEKIFGVFPH  133 (175)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHCCCCEECCCCEEEEECC
T ss_conf             49987417776689718998878834387799999999999873663345649999999998399840068734886413


Q ss_pred             EECCCCCCCCCCCC
Q ss_conf             52388622278726
Q gi|254780414|r  114 EIKKNCSLLKGMWE  127 (520)
Q Consensus       114 ~i~~~~~lf~gl~~  127 (520)
                      .+..+++++.|+.+
T Consensus       134 ~~~~~~pLl~g~~d  147 (175)
T cd03131         134 TILEPHPLLRGLDD  147 (175)
T ss_pred             CCCCCCCCCCCCCC
T ss_conf             46899904067898


No 166
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518   Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate , .   In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation.   AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process.
Probab=97.29  E-value=0.0013  Score=46.07  Aligned_cols=157  Identities=22%  Similarity=0.343  Sum_probs=108.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-----HHC---
Q ss_conf             0366405640477999999862236-5699997389551562789999886236985799758899999-----966---
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGI-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-----KLK---  294 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-----~L~---  294 (520)
                      ||.+|-|||+|-|||=.+|..--|- .++.+.+|=|==-..|.+++.+-=++....|-.+|||++.|-+     +++   
T Consensus         1 KVvLAySGGLDTSv~l~wL~~kyG~~~Via~~~dvGQPDE~d~~~~~~kA~~~GA~~~~~iDak~eFv~dy~f~aiqanA   80 (420)
T TIGR00032         1 KVVLAYSGGLDTSVCLKWLEEKYGYEEVIAVTADVGQPDEEDIDAIEEKALKYGAEKHYTIDAKEEFVKDYLFAAIQANA   80 (420)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHHHHHCCC
T ss_conf             96888607025999999988652898607999756799988888899998873671025772368899999888765066


Q ss_pred             ------CCCC---HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCC
Q ss_conf             ------8988---8999988756589999999974399709986462202454202467776303443023201132032
Q gi|254780414|r  295 ------NIVD---PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM  365 (520)
Q Consensus       295 ------gv~D---PE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~  365 (520)
                            |++=   ---=|=.|++--++|.++     .++.=.|-|-          +.+|+ +-+.=  .+-++-..-.|
T Consensus        81 ~Ye~~GG~~Y~L~TaLaRPlIA~~lVe~Ak~-----~Ga~AvaHGC----------TGKGN-DQ~RF--e~~~~~~~p~L  142 (420)
T TIGR00032        81 VYEGTGGLVYPLSTALARPLIAKKLVEVAKK-----EGAEAVAHGC----------TGKGN-DQVRF--ERSIRALNPDL  142 (420)
T ss_pred             EECCCCCEECCCCCCCHHHHHHHHHHHHHHH-----CCCEEEECCC----------CCCCC-CHHHH--HHHHHHHCCCC
T ss_conf             0317874103476611457999999999846-----6954987076----------87774-13576--58887526898


Q ss_pred             CHHHHHHH--HH-----HHHHHHHHHHHCCCHHHHCCCCC
Q ss_conf             02237898--73-----89999999981999889426888
Q gi|254780414|r  366 KLVEPLKE--LF-----KDEVRLLGKELRLPDSFVERHPC  398 (520)
Q Consensus       366 ~liEPl~~--l~-----KdEVR~lg~~Lglp~~~~~RhPF  398 (520)
                      |++-|.|+  |+     -.|--+-+++-|+|-..-.--|+
T Consensus       143 kviaP~R~~~~~e~lgGR~e~~eYa~~~Gip~p~~~~K~Y  182 (420)
T TIGR00032       143 KVIAPWRDLNLTEELGGREEEIEYAAQKGIPVPMTKEKPY  182 (420)
T ss_pred             EEECCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             5874734646776405948899999966888765467777


No 167
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]
Probab=97.27  E-value=0.0019  Score=44.84  Aligned_cols=151  Identities=21%  Similarity=0.217  Sum_probs=87.3

Q ss_pred             HHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CHHHHHHHHHHCCCCCEEEEEH--HHHHHHHH
Q ss_conf             76504440366405640477999999862236569999738955156-2789999886236985799758--89999996
Q gi|254780414|r  217 KEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKN-EVENIISLFKGYPNFPLRVVDA--SERFIRKL  293 (520)
Q Consensus       217 r~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRkn-E~~~v~~~~~~~~~~~l~~vda--~~~Fl~~L  293 (520)
                      |..+.+-|+..|.|||||||..|..+..| |     +-||-|-++.- +-.+-.+.+...+|.-..++.+  ++.--.+|
T Consensus        55 r~~id~~kiaVA~SGG~DSsas~iilR~~-g-----~~v~p~t~~Lp~~ir~n~~~l~~~lg~~p~yveedl~~i~kGal  128 (255)
T COG1365          55 RIKIDKPKIAVAYSGGVDSSASAIILRWA-G-----FTVDPGTAILPDHIRRNKEELETLLGEVPEYVEEDLEDIEKGAL  128 (255)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHHH-C-----EEECCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHC
T ss_conf             57888843899842786427889998862-1-----04146321387788678999989972577789989999986320


Q ss_pred             CCCCCHHHHHHHHHHHHH---HHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHH-H
Q ss_conf             689888999988756589---999999974399709986462202454202467776303443023201132032022-3
Q gi|254780414|r  294 KNIVDPETKRKVIGQLFI---EVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV-E  369 (520)
Q Consensus       294 ~gv~DPE~KRkiIG~~Fi---~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~li-E  369 (520)
                      .|---|      .|+---   .-.++.|+++ ++++++-|-+.|-        |        ||.|  -+++=-|++= -
T Consensus       129 nGRfhp------CGRCh~~I~~~V~~k~re~-di~~vafGDlLs~--------G--------~~sv--y~eD~i~rlnlP  183 (255)
T COG1365         129 NGRFHP------CGRCHSMIENAVMDKAREL-DIDVVAFGDLLST--------G--------YGSV--YREDGIFRLNLP  183 (255)
T ss_pred             CCCCCC------CCHHHHHHHHHHHHHHHHC-CCEEEEECCCCCC--------C--------CCCE--ECCCCEEEECCH
T ss_conf             587787------5237899999999999853-8708997463234--------6--------6321--205887997258


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHCCCCC
Q ss_conf             78987389999999981999889426888
Q gi|254780414|r  370 PLKELFKDEVRLLGKELRLPDSFVERHPC  398 (520)
Q Consensus       370 Pl~~l~KdEVR~lg~~Lglp~~~~~RhPF  398 (520)
                      -+=-|-|||+|.+-..-|.--++-+--||
T Consensus       184 AflAltK~Elr~il~~~~~e~~~kygCPl  212 (255)
T COG1365         184 AFLALTKDELRSILKWNGYELEMKYGCPL  212 (255)
T ss_pred             HHHHHCCHHHHHHHHHCCCCCHHCCCCCH
T ss_conf             88851719999998713843001158835


No 168
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain.  The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.  For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site.  Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-depende
Probab=97.24  E-value=0.00029  Score=50.66  Aligned_cols=72  Identities=22%  Similarity=0.401  Sum_probs=47.8

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCHHH--HHHCCCCEEEECCCCCCCCCCC-CCC---CCHHHHHCCCCEEEECHHHHHH
Q ss_conf             8899888865940698528989889--9723997999985388999999-975---3768980899889977899998
Q gi|254780414|r   21 QLIARRVRESKVYCEVIAFKNALDY--FKEQNPQAIILSGSPASSLDID-SPQ---IPKEILESNIPLLGICYGQQIM   92 (520)
Q Consensus        21 qLIaRriRelgVyseI~P~~~~~e~--i~~~~p~GIILSGGP~SV~d~~-ap~---~~~~I~~~~iPILGICyG~QlL   92 (520)
                      ......+|+.++...+++.......  ....+++++|+.||+....... ...   .-.+....+.|++|+|.|+|++
T Consensus        15 ~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~~d~liipgg~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~c~g~~~l   92 (115)
T cd01653          15 ASPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPDDLARDEALLALLREAAAAGKPILGICLGAQLL   92 (115)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCHHCCCEEEECCCCCCHHHHHHCHHHHHHHHHHHHCCCEEEEECHHHHHH
T ss_conf             999999997799799996589986665762008999989986329998639999999999998699899988588999


No 169
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism]
Probab=97.19  E-value=0.0073  Score=40.70  Aligned_cols=193  Identities=17%  Similarity=0.244  Sum_probs=88.7

Q ss_pred             EEEEE--ECCCCHHHHHHHHHHH-CCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC----CCCCCCHHHHH---C
Q ss_conf             69999--8897057889988886-5940698528989889972399799998538899999----99753768980---8
Q gi|254780414|r    9 KVLII--DFGSQFTQLIARRVRE-SKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI----DSPQIPKEILE---S   78 (520)
Q Consensus         9 ~IlIl--DfGSQytqLIaRriRe-lgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~----~ap~~~~~I~~---~   78 (520)
                      +|+|+  +.+|.||-+=  -++. -+|....++...++.     +|+.|||-|+- |.+.+    ..-+++.++.+   .
T Consensus       253 ~Iav~~lp~isNFtD~d--pL~~~~~v~v~~v~~~~~l~-----~~dlvIlPGsk-~t~~DL~~lr~~g~d~~i~~~~~~  324 (486)
T COG1492         253 RIAVIRLPRISNFTDFD--PLRAEPDVRVRFVKPGSDLR-----DADLVILPGSK-NTIADLKILREGGMDEKILEYARK  324 (486)
T ss_pred             EEEEECCCCCCCCCCCH--HHHCCCCEEEEEECCCCCCC-----CCCEEEECCCC-CCHHHHHHHHHCCHHHHHHHHHHC
T ss_conf             99996578755644521--46527980799961677789-----98889947985-608899999976979999999747


Q ss_pred             CCCEEEECHHHHHHHHHCCC--EEEECCCCC---CCEEEEEECC----------CCCCCCCCCCCCCCEEEEEECCCHHH
Q ss_conf             99889977899998997096--999869866---1036675238----------86222787266553368600220110
Q gi|254780414|r   79 NIPLLGICYGQQIMCQSLGG--KTKNSQSRE---FGRAFIEIKK----------NCSLLKGMWEKGSKQQVWMSHGDQVE  143 (520)
Q Consensus        79 ~iPILGICyG~QlLa~~~GG--~V~~~~~~E---yG~~~I~i~~----------~~~lf~gl~~~~~~~~VwmSH~D~V~  143 (520)
                      +.||+|||=|||+|...+--  .++... .+   .|.-.++..-          ......+.+...  +.+   |. .++
T Consensus       325 ~~~viGICGG~QmLG~~i~Dp~g~Eg~~-~~~~GLgLldv~T~~~~~K~~~~~~~~~~~~~~~~~G--yEI---H~-G~t  397 (486)
T COG1492         325 GGDVIGICGGYQMLGRRLKDPSGIEGAK-GEAEGLGLLDVETCFAGGKTTRVVTGALILSGLEVEG--YEI---HM-GIT  397 (486)
T ss_pred             CCCEEEECCHHHHHHHHHCCCCCCCCCC-CCCCCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEE--EEE---EE-EEE
T ss_conf             9979998635776433414864445763-4337856257888653883599974466047862046--899---87-797


Q ss_pred             CCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCC-CCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             1244421123239831788986350011246521222152025779987550106-4411140678999999997650
Q gi|254780414|r  144 HIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAG-IQDNWVMSSYHKEIVSRIKEQV  220 (520)
Q Consensus       144 ~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~-~~~~W~~~~~~~~~i~~Ir~~v  220 (520)
                      .-+++.......+...--+-...+.+++|.-+|==    .......+.|+..+.. -...-......+..+..+.+.+
T Consensus       398 ~~~~~~~~~~~~~~~~~dG~i~~dg~v~gTy~HGi----f~n~~~~~~fl~~~~~~~~~~~~~~e~~~~~~d~~a~~v  471 (486)
T COG1492         398 NRVDDSRPFNRLGSGVEDGAISADGRVFGTYLHGI----FENDIFREAFLRELGEREDTGIEYREVRERALDRLADEV  471 (486)
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC----CCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             14455664213667655763346785888873374----666789999999972667665578999988899999999


No 170
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]
Probab=97.13  E-value=0.0054  Score=41.61  Aligned_cols=108  Identities=19%  Similarity=0.228  Sum_probs=59.5

Q ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEE-ECCCCCCCCCHHHHHHHHHHCCCCCE-EEEEHHHHHHHHHCCC-
Q ss_conf             04440366405640477999999862236569999-73895515627899998862369857-9975889999996689-
Q gi|254780414|r  220 VGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVL-VDHGFMRKNEVENIISLFKGYPNFPL-RVVDASERFIRKLKNI-  296 (520)
Q Consensus       220 vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vf-VD~GllRknE~~~v~~~~~~~~~~~l-~~vda~~~Fl~~L~gv-  296 (520)
                      +.|..|-+.||||||||+.|+++++....+..+-| |+-.-=.-.|.+-.....+. +|.+. .++=..+.++..+..+ 
T Consensus       228 ~advpvg~~lSGGlDSS~Iaa~a~~~~~~~~~~~fsvg~~~~~~~D~~~a~~~A~~-lg~~h~~~~~~~~e~~~~~~~vv  306 (542)
T COG0367         228 VADVPVGVFLSGGLDSSLIAAIAAEELGKEGKTTFTVGFEDSDSPDAKYARAVAKF-LGTPHHEIILTNEELLNALPEVV  306 (542)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHH-HCCCCEEEEECHHHHHHHHHHHH
T ss_conf             15887899967762299999999986234552158985489997079999999998-59985799617899999999999


Q ss_pred             ---CCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECC
Q ss_conf             ---88899998875658999999997439-970998646
Q gi|254780414|r  297 ---VDPETKRKVIGQLFIEVFEEEAKKIG-GAQFLGQGT  331 (520)
Q Consensus       297 ---~DPE~KRkiIG~~Fi~vf~~~a~~~~-~~~~L~QGT  331 (520)
                         ..|-.  --++-.+.- ..+.+++.+ .+-+-+||-
T Consensus       307 ~~~~~p~~--~~~~~ply~-~~~~a~~~g~kVvLSGeGA  342 (542)
T COG0367         307 KALDTPGG--MAASIPLYL-LSRKARAEGEKVVLSGEGA  342 (542)
T ss_pred             HHHCCCCC--CHHHHHHHH-HHHHHHHCCCEEEECCCCH
T ss_conf             87078862--004579999-9987653387898238748


No 171
>PRK09431 asnB asparagine synthetase B; Provisional
Probab=97.08  E-value=0.0056  Score=41.53  Aligned_cols=101  Identities=14%  Similarity=0.202  Sum_probs=58.7

Q ss_pred             HHHHHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHHHHHCCC-------------CEEEEEECCCCCCCCCHHHHHHH
Q ss_conf             6789999999976504-440366405640477999999862236-------------56999973895515627899998
Q gi|254780414|r  206 SSYHKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLIYEAIGI-------------NLTCVLVDHGFMRKNEVENIISL  271 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg-~~kVi~~lSGGVDStV~A~Ll~kAig~-------------~l~~vfVD~GllRknE~~~v~~~  271 (520)
                      +.+.+...+.+|.+.- |-.|=+.||||+|||..|+|..|....             ++++.-|  |+=...|.....+ 
T Consensus       210 ~~lr~lL~~AV~~rL~sDvpvG~~LSGGLDSSlIaala~k~~~~~~~~~~~~~~~~~~l~tFsi--G~~~s~D~~~Ar~-  286 (555)
T PRK09431        210 NELREALEAAVKKRLMSDVPYGVLLSGGLDSSLISAIAKKYAARRIEDDERSEAWWPQLHSFAV--GLEGSPDLKAARE-  286 (555)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEE--CCCCCCHHHHHHH-
T ss_conf             9999999999999835688624320577067999999998520244332222234678753660--4799814999999-


Q ss_pred             HHHCCCCCEEEEE-HHHHHHHHHCCCC------CHHHHHHHHHHH
Q ss_conf             8623698579975-8899999966898------889999887565
Q gi|254780414|r  272 FKGYPNFPLRVVD-ASERFIRKLKNIV------DPETKRKVIGQL  309 (520)
Q Consensus       272 ~~~~~~~~l~~vd-a~~~Fl~~L~gv~------DPE~KRkiIG~~  309 (520)
                      ..+++|.+-+.+. ..+.+++.|..+.      ||-.=|-.|+.-
T Consensus       287 vA~~lgt~h~ei~~t~~d~~~~l~~vi~~lE~~d~~~~~asip~y  331 (555)
T PRK09431        287 VADYLGTVHHEIHFTVQEGLDALRDVIYHLETYDVTTIRASTPMY  331 (555)
T ss_pred             HHHHHCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             999829956599954799999999999874146875025689999


No 172
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional
Probab=97.07  E-value=0.029  Score=36.46  Aligned_cols=175  Identities=17%  Similarity=0.213  Sum_probs=114.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCE
Q ss_conf             11140678999999997650444036640564047799999986223656999973895515627899998862369857
Q gi|254780414|r  201 DNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPL  280 (520)
Q Consensus       201 ~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l  280 (520)
                      .+.+++..++-.++    +.| ++++..-|-|.+|.|.--|+.++ +....-+|||||++=. |+-+..+.+.+++++|+
T Consensus        25 ~~~~p~eil~wa~~----~~~-~~~~~tsSFG~es~Vllhli~~~-~~~ipV~flDTG~~f~-ETy~~~d~l~~~~~l~i   97 (243)
T PRK02090         25 EKASAQERLAWALE----EFG-GGLALASSFGAESAVLLHLVAQV-DPDIPVIFLDTGYLFP-ETYRFIDQLTERLLLNL   97 (243)
T ss_pred             HCCCHHHHHHHHHH----HCC-CCEEEEECCCHHHHHHHHHHHHH-CCCCCEEEEECCCCCH-HHHHHHHHHHHHHCCCE
T ss_conf             17999999999999----759-97699945867899999999941-9999679865798888-99999999999979977


Q ss_pred             EEEEHHHH---HHHHHCC-----CCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEE
Q ss_conf             99758899---9999668-----988899998875658999999997439970998646220245420246777630344
Q gi|254780414|r  281 RVVDASER---FIRKLKN-----IVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKS  352 (520)
Q Consensus       281 ~~vda~~~---Fl~~L~g-----v~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKs  352 (520)
                      +++.....   ......|     ++||++==.|   .=++-|.+..+.+ ++|+-++   .-|  ||  ........+ +
T Consensus        98 ~~~~P~~~~~~~~~~~g~l~~~~~~d~~~CC~i---rKvePL~raL~~~-daWitG~---Rr~--Qs--~~Ra~l~~v-e  165 (243)
T PRK02090         98 KVYRPDASAAEQEARYGGLWEQSVEDPDECCRI---RKVEPLNRALAGL-DAWITGL---RRE--QS--GTRAELPVL-E  165 (243)
T ss_pred             EEECCCCHHHHHHHHHCCCCCCCCCCHHHHHHH---HCCHHHHHHHHHC-CEEEECC---CHH--HC--HHHCCCCCE-E
T ss_conf             997788149999998299766763248987677---6502799986017-7587447---144--26--334258734-5


Q ss_pred             EECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             30232011320320223789873899999999819998894268889831
Q gi|254780414|r  353 HHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPG  402 (520)
Q Consensus       353 HHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPG  402 (520)
                      .  .+|+     +| +-||-+.-++||-.-=+.-+||.+=++.+=||-=|
T Consensus       166 ~--d~g~-----~K-vnPL~~Ws~~dv~~Yi~~~~LP~npL~~~GY~SIG  207 (243)
T PRK02090        166 I--DRGR-----FK-INPLADWTNEDVWAYLKEHDLPYHPLVDQGYPSIG  207 (243)
T ss_pred             E--CCCE-----EE-ECCCHHCCHHHHHHHHHHCCCCCCCHHHCCCCCCC
T ss_conf             2--3998-----88-67001199999999999859998832445999858


No 173
>PRK00784 cobyric acid synthase; Provisional
Probab=97.06  E-value=0.01  Score=39.71  Aligned_cols=81  Identities=23%  Similarity=0.380  Sum_probs=48.8

Q ss_pred             EEEEEECC--CCHHHHHHHHH-HHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCC---CCCCCHHH---HHCC
Q ss_conf             69999889--70578899888-8659406985289898899723997999985388999999---97537689---8089
Q gi|254780414|r    9 KVLIIDFG--SQFTQLIARRV-RESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID---SPQIPKEI---LESN   79 (520)
Q Consensus         9 ~IlIlDfG--SQytqLIaRri-RelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~---ap~~~~~I---~~~~   79 (520)
                      +|+|+.+=  |.||-.  --+ .|-+|...-++.   .+++  .+++.|||.|+-+.+.|-.   .-.++.+|   .+.+
T Consensus       255 ~IaVi~lP~iSNftDf--dpL~~e~~V~l~~v~~---~~~l--~~~D~vIlPGsK~Ti~DL~~Lr~~Gl~~~i~~~~~~G  327 (492)
T PRK00784        255 RVAVPRLPRISNFTDF--DPLRAEPGVDVRYVRP---GEPL--PDADLVILPGSKNTIADLAWLRESGWDEAIRAHARRG  327 (492)
T ss_pred             EEEEEECCCCCCCCCC--HHHHHCCCEEEEEECC---CCCC--CCCCEEEECCCCCCHHHHHHHHHCCHHHHHHHHHHCC
T ss_conf             8999806755686544--3564078728999789---7656--8999999799866489999999869499999999759


Q ss_pred             CCEEEECHHHHHHHHHC
Q ss_conf             98899778999989970
Q gi|254780414|r   80 IPLLGICYGQQIMCQSL   96 (520)
Q Consensus        80 iPILGICyG~QlLa~~~   96 (520)
                      .||+|||=|+|+|+...
T Consensus       328 ~~V~GICGGyQMLG~~I  344 (492)
T PRK00784        328 GPVLGICGGYQMLGRTI  344 (492)
T ss_pred             CCEEEECCHHHHHCCEE
T ss_conf             97899870288630200


No 174
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. NH(2) groups are provided by glutamine, and one molecule of ATP is hydrogenolysed for each amidation .; GO: 0003824 catalytic activity, 0009236 cobalamin biosynthetic process.
Probab=97.03  E-value=0.00025  Score=51.14  Aligned_cols=82  Identities=29%  Similarity=0.567  Sum_probs=57.8

Q ss_pred             CEEEEEECC--CCHHHHHHHHHH-HCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCC---CCCCHHHHH--CC
Q ss_conf             869999889--705788998888-6594069852898988997239979999853889999999---753768980--89
Q gi|254780414|r    8 SKVLIIDFG--SQFTQLIARRVR-ESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS---PQIPKEILE--SN   79 (520)
Q Consensus         8 ~~IlIlDfG--SQytqLIaRriR-elgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~a---p~~~~~I~~--~~   79 (520)
                      =+|.|+-|-  |.||-+  -=+| |.+||..-++.+.++.     +++.||+.|+-+|+.|-.+   -.++.+|.+  ..
T Consensus       249 irv~v~RLpriSNFTD~--ePL~~~~~V~v~fl~l~~~L~-----~~d~vIiPGsk~ti~dl~~L~~~~~~~~i~~~~~~  321 (502)
T TIGR00313       249 IRVGVVRLPRISNFTDF--EPLRYEADVAVKFLELEDSLD-----GLDAVIIPGSKDTIADLKALKESGFAEEILDLAKE  321 (502)
T ss_pred             EEEEEEECCCCCCCCCC--CHHHCCCCCEEEEECCCCCCC-----CCEEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHC
T ss_conf             48999853763566775--221114872899832688778-----84489967996578999999746866799999606


Q ss_pred             CC-EEEECHHHHHHHHHC
Q ss_conf             98-899778999989970
Q gi|254780414|r   80 IP-LLGICYGQQIMCQSL   96 (520)
Q Consensus        80 iP-ILGICyG~QlLa~~~   96 (520)
                      +| |+|||=|.|+|++.+
T Consensus       322 ig~V~GICGGYQ~LG~~l  339 (502)
T TIGR00313       322 IGIVIGICGGYQMLGKEL  339 (502)
T ss_pred             CCEEEEECCCHHHHHHHH
T ss_conf             988998347602100310


No 175
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA, the A4 beta-galactosidase middle domain and peptidase E.  The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.  For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site.  Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamin
Probab=97.00  E-value=0.0013  Score=46.11  Aligned_cols=72  Identities=22%  Similarity=0.396  Sum_probs=48.8

Q ss_pred             HHHHHHHHHCCCEEEEECCCCCHHH--HHHCCCCEEEECCCCCCCCCCC-CCC---CCHHHHHCCCCEEEECHHHHHH
Q ss_conf             8899888865940698528989889--9723997999985388999999-975---3768980899889977899998
Q gi|254780414|r   21 QLIARRVRESKVYCEVIAFKNALDY--FKEQNPQAIILSGSPASSLDID-SPQ---IPKEILESNIPLLGICYGQQIM   92 (520)
Q Consensus        21 qLIaRriRelgVyseI~P~~~~~e~--i~~~~p~GIILSGGP~SV~d~~-ap~---~~~~I~~~~iPILGICyG~QlL   92 (520)
                      ......+++.+....+++.......  ....+++++|+.||+....... ...   .-.+.+..+.|++|+|.|+|++
T Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vii~gg~~~~~~~~~~~~~~~~i~~~~~~~~~i~~~c~G~~~l   92 (92)
T cd03128          15 ASPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPDDLAWDEALLALLREAAAAGKPVLGICLGAQLL   92 (92)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHCCEEEECCCCCCCCCCHHCHHHHHHHHHHHHCCCEEEEECCHHHHC
T ss_conf             999999997799799995389964453686458899978998664210109899999999998799799999047539


No 176
>TIGR01382 PfpI intracellular protease, PfpI family; InterPro: IPR006286   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad .    This group of cysteine peptidases belong to MEROPS peptidase family C56 (Pfp1 endopeptidase, clan PC(C)).   The member of this family from Pyrococcus horikoshii has been solved to 2 Angstrom resolution. It is an ATP-independent intracellular protease that crystallises as a hexameric ring. Cys-101 is proposed as the active site residue in a catalytic triad with the adjacent His-102 and a Glu residue from an adjacent monomer. A member of this family from Bacillus subtilis, GSP18, has been shown to be expressed in response to several forms of stress. A role in the degradation of small peptides has been suggested. This family is contained in a larger one of the thiamine biosynthesis protein ThiJ and its homologs.; GO: 0016798 hydrolase activity acting on glycosyl bonds.
Probab=96.96  E-value=0.00012  Score=53.51  Aligned_cols=83  Identities=20%  Similarity=0.352  Sum_probs=57.1

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCC----CCCCCCCCHHHHHCCCCEEEEC
Q ss_conf             999889705788998888659406985289898899723997999985388999----9999753768980899889977
Q gi|254780414|r   11 LIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL----DIDSPQIPKEILESNIPLLGIC   86 (520)
Q Consensus        11 lIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~----d~~ap~~~~~I~~~~iPILGIC   86 (520)
                      +|-||-+..|.-     .+.|.   ++.-|.+++++...++++|+|.||-.|.+    |++.-.+-++.++.++||..||
T Consensus        45 aihdfeGdqty~-----~~~g~---~v~vd~~~~~v~~~~YDal~ipGG~a~~e~LR~d~~~~~lvR~f~e~gK~vaaIC  116 (189)
T TIGR01382        45 AIHDFEGDQTYT-----EKHGY---SVTVDATIDDVDPEDYDALVIPGGRASPEYLRLDEKVIRLVREFVEKGKPVAAIC  116 (189)
T ss_pred             EEECCCCCCCCC-----CCCCE---EEEEECCEECCCHHHCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             101156763213-----47881---6887441214785256478971773560001487689999999841788199984


Q ss_pred             HHHHHHHHHCCCEEEECC
Q ss_conf             899998997096999869
Q gi|254780414|r   87 YGQQIMCQSLGGKTKNSQ  104 (520)
Q Consensus        87 yG~QlLa~~~GG~V~~~~  104 (520)
                      .|-|+|+.+   .|-|++
T Consensus       117 hgp~lLi~A---~VlrGk  131 (189)
T TIGR01382       117 HGPQLLISA---GVLRGK  131 (189)
T ss_pred             CCCEEEEEC---CEECCC
T ss_conf             530000025---510375


No 177
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426   These sequences represent glutamine-hydrolysing asparagine synthase. The group have a poorly conserved C-terminal extension while bacterial members of the family tend to have a long, poorly conserved insert lacking from archaeal and eukaryotic sequences. Multiple isozymes have been demonstrated, such as in Bacillus subtilis .; GO: 0004066 asparagine synthase (glutamine-hydrolyzing) activity, 0006529 asparagine biosynthetic process.
Probab=96.89  E-value=0.0098  Score=39.78  Aligned_cols=97  Identities=16%  Similarity=0.142  Sum_probs=65.2

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCC-------CCEEEEEECCC--CCCCCCHH--------HHHHHHHHCCCCCEEEE
Q ss_conf             444036640564047799999986223-------65699997389--55156278--------99998862369857997
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIG-------INLTCVLVDHG--FMRKNEVE--------NIISLFKGYPNFPLRVV  283 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig-------~~l~~vfVD~G--llRknE~~--------~v~~~~~~~~~~~l~~v  283 (520)
                      .|..|=|.||||||||.+|+++.+-+.       .+++-.=|+-+  ==-.+|+.        .-.+ ..+++|++.+.+
T Consensus       310 aDvpvG~~LSGGlDSS~vaa~a~~~~~~~~~~W~~~~~tFsigf~~~~~~~~Es~l~P~~D~P~A~~-vA~~~G~~h~~~  388 (646)
T TIGR01536       310 ADVPVGVLLSGGLDSSLVAAIARREAPSEGVDWKGPVKTFSIGFEGDSKDFDESKLRPDDDQPYARK-VADELGTEHHEV  388 (646)
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCEECCCCCCCCHHHHHH-HHHHHCCCCEEE
T ss_conf             0560688871716799999999997676433117743478865177876530025789986189999-999849832489


Q ss_pred             E-HHHHHHHHHCCC----C--CHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             5-889999996689----8--889999887565899999999743
Q gi|254780414|r  284 D-ASERFIRKLKNI----V--DPETKRKVIGQLFIEVFEEEAKKI  321 (520)
Q Consensus       284 d-a~~~Fl~~L~gv----~--DPE~KRkiIG~~Fi~vf~~~a~~~  321 (520)
                      . ..+.+++.|.-|    .  ||=.=|-+|+--|+-   +.|++.
T Consensus       389 ~~s~~e~~~~l~~v~~~~e~y~p~~~~~~~P~Yl~s---~~ar~~  430 (646)
T TIGR01536       389 LISEEEVLKALPEVIYHLETYDPTAIRASIPLYLLS---KLARED  430 (646)
T ss_pred             EECHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH---HHHHHC
T ss_conf             845899999988876542488543031123589999---999962


No 178
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism]
Probab=96.81  E-value=0.0059  Score=41.37  Aligned_cols=178  Identities=21%  Similarity=0.260  Sum_probs=100.4

Q ss_pred             CCCCEEEEEECCCCH----HHHHHHHHH--HCCCEEEEECC------C----------CCHHHHHHCCCCEEEECCCCCC
Q ss_conf             448869999889705----788998888--65940698528------9----------8988997239979999853889
Q gi|254780414|r    5 ERSSKVLIIDFGSQF----TQLIARRVR--ESKVYCEVIAF------K----------NALDYFKEQNPQAIILSGSPAS   62 (520)
Q Consensus         5 ~~~~~IlIlDfGSQy----tqLIaRriR--elgVyseI~P~------~----------~~~e~i~~~~p~GIILSGGP~S   62 (520)
                      .+--+|+||..=-+-    +| |+|-+-  -|.|.-+.+--      +          .+.++++..+.+|.|++|-|--
T Consensus        33 IRPL~IlilNLMP~Ki~TE~Q-~lRLL~nsPLQV~itll~~~sh~~KnTp~eHl~~FY~tfeeVk~~~FDG~IiTGAPve  111 (307)
T COG1897          33 IRPLKILILNLMPKKIETETQ-ILRLLGNSPLQVDITLLRIDSHESKNTPAEHLNSFYCTFEEVKDQKFDGLIITGAPVE  111 (307)
T ss_pred             CCCCEEEEEECCCHHHHHHHH-HHHHHCCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHCHHHHHHCCCCCEEEECCCCC
T ss_conf             753103543247355777999-9998569975378899983376778880899999860699886454671598388534


Q ss_pred             C--CCCCCCCC-CHHHHHC---CC-CEEEECHHHHHHHHHCCCE-EEECCCCCCCEEEEE-ECCCCCCCCCCCCCCCCEE
Q ss_conf             9--99999753-7689808---99-8899778999989970969-998698661036675-2388622278726655336
Q gi|254780414|r   63 S--LDIDSPQI-PKEILES---NI-PLLGICYGQQIMCQSLGGK-TKNSQSREFGRAFIE-IKKNCSLLKGMWEKGSKQQ  133 (520)
Q Consensus        63 V--~d~~ap~~-~~~I~~~---~i-PILGICyG~QlLa~~~GG~-V~~~~~~EyG~~~I~-i~~~~~lf~gl~~~~~~~~  133 (520)
                      -  +++-+.+- ...|++-   ++ -.|-||+|.|.--..+=|- -...+.+-+|...-. ....+.++.|+.+.   +.
T Consensus       112 ~l~feeV~YW~el~~I~eWskt~V~STl~ICWgaqAaly~~yGv~K~~l~~Kl~GVy~h~~l~p~~~l~rGfdd~---f~  188 (307)
T COG1897         112 LLPFEEVAYWEELKQIFEWSKTHVTSTLHICWGAQAALYYFYGVPKYTLPEKLSGVYKHDILSPHSLLTRGFDDS---FL  188 (307)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCEEECCCCCCCCHHHCCCCCC---CC
T ss_conf             457004306999999999886420013566888888899980987343654340212212458662644267743---23


Q ss_pred             EEEE-CCC----HHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHH
Q ss_conf             8600-220----11012444211232398317889863500112465212221520257
Q gi|254780414|r  134 VWMS-HGD----QVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ  187 (520)
Q Consensus       134 VwmS-H~D----~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~  187 (520)
                      +-.| |.|    .+.+.| +.++++.|+..-+..++.++.+..=+--|||-.-+.--.+
T Consensus       189 ~PhSR~t~~~~e~i~~~~-~LeIL~es~e~G~~l~a~k~~r~ifv~gH~EYD~~tL~~E  246 (307)
T COG1897         189 APHSRYTDVPKEDILAVP-DLEILAESKEAGVYLLASKDGRNIFVTGHPEYDATTLAQE  246 (307)
T ss_pred             CCCCCCCCCCHHHHHHCC-CCEEEECCCCCCEEEEECCCCCEEEEECCCCHHHHHHHHH
T ss_conf             764222457999984289-8513432664536898627777678717741025678899


No 179
>PTZ00077 asparagine synthetase; Provisional
Probab=96.78  E-value=0.018  Score=37.86  Aligned_cols=36  Identities=19%  Similarity=0.376  Sum_probs=27.5

Q ss_pred             HHHHHHHHH-CCCCEEEEECCCCHHHHHHHHHHHHCC
Q ss_conf             999997650-444036640564047799999986223
Q gi|254780414|r  212 IVSRIKEQV-GNERVICAVSGGVDSTVAAFLIYEAIG  247 (520)
Q Consensus       212 ~i~~Ir~~v-g~~kVi~~lSGGVDStV~A~Ll~kAig  247 (520)
                      ..+.++++. .|-.|=|.||||+|||..|+|+.|-++
T Consensus       226 L~~AV~~rL~sDVPvG~lLSGGLDSSlIaAia~k~l~  262 (610)
T PTZ00077        226 LEKAVIKRLMGDVPFGILLSGGLDSSIIAAILAKHLK  262 (610)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9999999822567236663477058999999998654


No 180
>KOG3210 consensus
Probab=96.54  E-value=0.01  Score=39.72  Aligned_cols=87  Identities=14%  Similarity=0.282  Sum_probs=48.2

Q ss_pred             EEEEEECCCCHH-H--HHHHHHHHC--CCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCC---C-CC--CCCCHHHHH
Q ss_conf             699998897057-8--899888865--94069852898988997239979999853889999---9-99--753768980
Q gi|254780414|r    9 KVLIIDFGSQFT-Q--LIARRVRES--KVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD---I-DS--PQIPKEILE   77 (520)
Q Consensus         9 ~IlIlDfGSQyt-q--LIaRriRel--gVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d---~-~a--p~~~~~I~~   77 (520)
                      -|-||-.-+-+- |  -..|.+-|-  ++.-+|.|-.+ .+++  .+.+|+|+.||-+....   + +.  +.+..-+-+
T Consensus        13 VIGVLALQGAFiEH~N~~~~c~~en~y~Ik~~~~tVKT-~~D~--aq~DaLIIPGGEST~mslia~~tgL~d~L~~fVhn   89 (226)
T KOG3210          13 VIGVLALQGAFIEHVNHVEKCIVENRYEIKLSVMTVKT-KNDL--AQCDALIIPGGESTAMSLIAERTGLYDDLYAFVHN   89 (226)
T ss_pred             EEEEEEHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECC-HHHH--HHCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             66531021578998878877530586267888886157-7778--65777783398502678887441017779998448


Q ss_pred             CCCCEEEECHHHHHHHHHCCC
Q ss_conf             899889977899998997096
Q gi|254780414|r   78 SNIPLLGICYGQQIMCQSLGG   98 (520)
Q Consensus        78 ~~iPILGICyG~QlLa~~~GG   98 (520)
                      -..|++|-|-||-+|.+.+-+
T Consensus        90 ~~k~~WGTCAGmI~LS~ql~n  110 (226)
T KOG3210          90 PSKVTWGTCAGMIYLSQQLSN  110 (226)
T ss_pred             CCCCEEEECHHHHHHHHHHCC
T ss_conf             886403410225310565528


No 181
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073   This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis. This form is found mostly in eukaryotes and proteobacteria. In Bacillus subtilis PurL (FGAM synthase II) and PurQ (FGAM synthase I) perform the equivalent function; the unrelated small protein PurS is also required and may be a third subunit .; GO: 0004642 phosphoribosylformylglycinamidine synthase activity, 0006189 'de novo' IMP biosynthetic process.
Probab=96.52  E-value=0.044  Score=35.10  Aligned_cols=189  Identities=20%  Similarity=0.298  Sum_probs=107.2

Q ss_pred             CCCCCCEEEEEE-CCC--CHHHHHHHHHHHCCCEE-EEECCCCCHHHHHHCCCCEEEECCCCC--CCCCCCC-----CCC
Q ss_conf             634488699998-897--05788998888659406-985289898899723997999985388--9999999-----753
Q gi|254780414|r    3 KRERSSKVLIID-FGS--QFTQLIARRVRESKVYC-EVIAFKNALDYFKEQNPQAIILSGSPA--SSLDIDS-----PQI   71 (520)
Q Consensus         3 ~~~~~~~IlIlD-fGS--QytqLIaRriRelgVys-eI~P~~~~~e~i~~~~p~GIILSGGP~--SV~d~~a-----p~~   71 (520)
                      ++.-.+||+||- =|+  |+-  .|-.....|..| .|+=.|.-.-.+.....+|++.-||=+  -|.+.+.     ..+
T Consensus      1123 ~~G~~PkvAILREqG~NG~~E--MAaAF~rAGF~~~DVhmsDL~~Grv~Ld~F~glvacGGFSYgDVLGag~GWA~SIlF 1200 (1401)
T TIGR01735      1123 NKGVKPKVAILREQGVNGDIE--MAAAFDRAGFEAIDVHMSDLLAGRVHLDEFRGLVACGGFSYGDVLGAGKGWAKSILF 1200 (1401)
T ss_pred             CCCCCCCEEEEEECCCCCCHH--HHHHHHHCCCCEEEEEEEEHCCCCCCHHHCCEEEEECCCCHHHHHHHHHHHHHHHHC
T ss_conf             368986178885068670068--999997458957852310010056652245558997175302130112446776640


Q ss_pred             CHHH-------H-HCCCCEEEECHHHHHHHHHCC--------CE--------------EEECC-CC--CCCEEEEEECCC
Q ss_conf             7689-------8-089988997789999899709--------69--------------99869-86--610366752388
Q gi|254780414|r   72 PKEI-------L-ESNIPLLGICYGQQIMCQSLG--------GK--------------TKNSQ-SR--EFGRAFIEIKKN  118 (520)
Q Consensus        72 ~~~I-------~-~~~iPILGICyG~QlLa~~~G--------G~--------------V~~~~-~~--EyG~~~I~i~~~  118 (520)
                      .+.+       | +-+-=-||||=|+|+|+...|        ++              ..+.+ ..  |=-.+.+++.+.
T Consensus      1201 ~~~~~~qF~~Ff~rpdtf~LGVCNGCQm~snL~~~iPG~~~wp~~e~GPD~~~~RPGlFvrn~LSerFEaR~a~V~v~~s 1280 (1401)
T TIGR01735      1201 NPRLRDQFAAFFKRPDTFSLGVCNGCQMLSNLLEIIPGTENWPHLEMGPDSSQARPGLFVRNRLSERFEARVALVEVKES 1280 (1401)
T ss_pred             CHHHHHHHHHHCCCCCCEEECCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCEEEEEEEEEECCC
T ss_conf             57789999986058884230321078999976434787888884122788888887513320235201321265465566


Q ss_pred             -CCCCCCCCCCCCCEEEEEECCCHHH--CCC--------CCCCEEECC-------------CCCC---EEEEEECCCCEE
Q ss_conf             -6222787266553368600220110--124--------442112323-------------9831---788986350011
Q gi|254780414|r  119 -CSLLKGMWEKGSKQQVWMSHGDQVE--HIP--------EGFEVIASS-------------DSTP---FAFIADEKRKYY  171 (520)
Q Consensus       119 -~~lf~gl~~~~~~~~VwmSH~D~V~--~lP--------~gf~viA~S-------------~~~~---iaai~~~~~~iy  171 (520)
                       |-+|+|..  ++..-||.+||..=.  +.|        .|...+-+-             .|+.   |+||.+.|-++-
T Consensus      1281 ~Si~L~GM~--GS~LPv~~aHGEG~a~F~~~~~~~~~~~~gl~aLry~D~~G~~Te~YPlNPNGSP~GIagits~DGR~~ 1358 (1401)
T TIGR01735      1281 PSIMLKGMA--GSRLPVAVAHGEGRAEFESEELLAEADASGLVALRYVDDDGNVTEAYPLNPNGSPEGIAGITSADGRVT 1358 (1401)
T ss_pred             CEEEECCCC--CCCCCEEEEECCCEEECCCHHHHHHHHHHCCEEEEEECCCCCHHHCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             500113778--883773775066256418878988775519557786757557331186888877443020118887589


Q ss_pred             EEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHH
Q ss_conf             246521222152025779987550106441114067899
Q gi|254780414|r  172 AVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHK  210 (520)
Q Consensus       172 GVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~  210 (520)
                      .++=|||=.           |.    -..-.|.|+++-+
T Consensus      1359 imMPHPER~-----------~R----~~q~sW~P~~W~e 1382 (1401)
T TIGR01735      1359 IMMPHPERV-----------FR----AVQNSWRPEDWDE 1382 (1401)
T ss_pred             EECCCCCCC-----------CC----CCCCCCCCCCCCC
T ss_conf             666889721-----------12----4668778778863


No 182
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional
Probab=96.45  E-value=0.02  Score=37.61  Aligned_cols=194  Identities=18%  Similarity=0.120  Sum_probs=103.0

Q ss_pred             HHHHHHHHHHHHHHHCC-CCEEEEECCCCHHHHHHHHHHHHCC--C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             67899999999765044-4036640564047799999986223--6-569999738955156278999988623698579
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGN-ERVICAVSGGVDSTVAAFLIYEAIG--I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~-~kVi~~lSGGVDStV~A~Ll~kAig--~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
                      +....+.|--||+.+.. ++..+..|||=||+|..-|..||.-  . -+-.++||||.= -.|.-+-.+.+.+..|++++
T Consensus        20 ~~LEaesI~I~RE~~a~f~~pvmL~S~GKDS~VmlhLA~KAF~p~~iPfPllHIDTg~k-F~Emi~fRD~~a~~~~l~Li   98 (312)
T PRK12563         20 DRLEAESIHILREVVAECSKPVMLYSIGKDSSVMLHLAMKAFRPTRPPFPLLHVDTTWK-FREMIDFRDRRAKELGLDLV   98 (312)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCC-HHHHHHHHHHHHHHHCCEEE
T ss_conf             99998889999999997369679861674299999999997377899973588636887-59999999999998198689


Q ss_pred             EEEHHHHHHHHHCCCCCHHHHHHHHHHHHHH-HHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHH
Q ss_conf             9758899999966898889999887565899-999999743997099864622024542024677763034430232011
Q gi|254780414|r  282 VVDASERFIRKLKNIVDPETKRKVIGQLFIE-VFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP  360 (520)
Q Consensus       282 ~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~-vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp  360 (520)
                      +..-.+    .++--..|+..-......-++ +--+.|-+-.+.+.+. |-..-|==.|-     ..-.|=||-+-.|- 
T Consensus        99 V~~n~~----~i~~g~~p~~~~~~~~~~~lKT~~L~~ale~~~fDa~~-gGaRRDEEksR-----AKERiFS~Rd~~~~-  167 (312)
T PRK12563         99 VHHNPD----GIARGIVPFRHGSALHTDVAKTQGLKQALDHHGFDAAI-GGARRDEEKSR-----AKERIFSFRSAFHR-  167 (312)
T ss_pred             EECCHH----HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEE-ECCCCCCCCCC-----CCCEEECCCCCCCC-
T ss_conf             832878----88669996767837776689889999999973988785-04532134234-----43403066677889-


Q ss_pred             HHHCCCHHHH-HHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             3203202237-898738999999998199988942688898311122100036789999999999999999864653
Q gi|254780414|r  361 EHMDMKLVEP-LKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIY  436 (520)
Q Consensus       361 ~~~~~~liEP-l~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly  436 (520)
                        +.-|-=-| |=+||+-.                    -.||=.+||---..=.-+||-   ..|..+.+.-..||
T Consensus       168 --WDPknQrPElWnlyN~~--------------------~~~Geh~RVfPlsNWTElDIW---~YI~~E~Ipi~~LY  219 (312)
T PRK12563        168 --WDPKAQRPELWSLYNAR--------------------LRRGESLRVFPLSNWTELDVW---QYIAREKIPLVPLY  219 (312)
T ss_pred             --CCCCCCCHHHHHHHCCC--------------------CCCCCEEEECCCCCCCHHHHH---HHHHHHCCCCCCCE
T ss_conf             --88555883587761556--------------------799971442235566178999---99998288988612


No 183
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141   This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP..
Probab=96.41  E-value=0.038  Score=35.61  Aligned_cols=179  Identities=24%  Similarity=0.396  Sum_probs=103.9

Q ss_pred             CCCCCEEEEEECC---CCHHHHHHHHHHHCCCEEEEECCCC-C-------HHHHH-HC-CCCEEEECCCCCCCCCC--CC
Q ss_conf             3448869999889---7057889988886594069852898-9-------88997-23-99799998538899999--99
Q gi|254780414|r    4 RERSSKVLIIDFG---SQFTQLIARRVRESKVYCEVIAFKN-A-------LDYFK-EQ-NPQAIILSGSPASSLDI--DS   68 (520)
Q Consensus         4 ~~~~~~IlIlDfG---SQytqLIaRriRelgVyseI~P~~~-~-------~e~i~-~~-~p~GIILSGGP~SV~d~--~a   68 (520)
                      +-.+++|+|==|=   |-|=  -+|+..+-|....+++... +       .+.+. +. +-.=++|.|| -|.-||  ++
T Consensus      1013 ~v~KP~VvIpvFPGtNsEYD--~~~aFe~~GAev~~~~~~nL~~~a~~~Sv~~l~~~i~ksqI~~lpGG-FSAgDEPDGS 1089 (1279)
T TIGR01857      1013 KVEKPRVVIPVFPGTNSEYD--SAKAFEKEGAEVKLVILRNLTEEALVESVEELVDEIDKSQILMLPGG-FSAGDEPDGS 1089 (1279)
T ss_pred             EEECCEEEEECCCCCCCHHH--HHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCCCCCC
T ss_conf             54078679813588984888--88898545895899600038888999999999874046408995587-8777788852


Q ss_pred             ----------CCCCHH---HHH-CCCCEEEECHHHHHHHHHCC----CEEEE----CCCCCC---CEE-----EEEE-CC
Q ss_conf             ----------753768---980-89988997789999899709----69998----698661---036-----6752-38
Q gi|254780414|r   69 ----------PQIPKE---ILE-SNIPLLGICYGQQIMCQSLG----GKTKN----SQSREF---GRA-----FIEI-KK  117 (520)
Q Consensus        69 ----------p~~~~~---I~~-~~iPILGICyG~QlLa~~~G----G~V~~----~~~~Ey---G~~-----~I~i-~~  117 (520)
                                |++..+   +++ .+==|||||=|+|.|.+. |    |++..    +++--|   |++     ...+ .+
T Consensus      1090 AKFi~~~l~npkv~~~v~~lL~~RDGLiLGiCNGFQALvK~-GLlPYG~i~~~~~~~pTLtyN~inrH~s~~V~Tki~~~ 1168 (1279)
T TIGR01857      1090 AKFIAAILRNPKVKEAVKKLLKERDGLILGICNGFQALVKL-GLLPYGEIVDVEEDSPTLTYNKINRHVSKIVRTKIASK 1168 (1279)
T ss_pred             HHHHHHHHHCHHHHHHHHHHHHHCCCEEEEEEHHHHHHHHH-CCCCCCCEEECCCCCCCCCCCCHHHHHEEEEEEEECCC
T ss_conf             89999976081479999999960798498620056788882-47888642400457863120201012010123565047


Q ss_pred             CCCCCCCCCCCCCCEEEEEECCC-------HH-HCCCCC---------CCE-----EECCCCCC---EEEEEECCCCEEE
Q ss_conf             86222787266553368600220-------11-012444---------211-----23239831---7889863500112
Q gi|254780414|r  118 NCSLLKGMWEKGSKQQVWMSHGD-------QV-EHIPEG---------FEV-----IASSDSTP---FAFIADEKRKYYA  172 (520)
Q Consensus       118 ~~~lf~gl~~~~~~~~VwmSH~D-------~V-~~lP~g---------f~v-----iA~S~~~~---iaai~~~~~~iyG  172 (520)
                      +||-|..+ ..+..+.+-.|||.       .+ .+|-++         |.-     .-.++|+.   |++|-.++-+|+|
T Consensus      1169 ~SPWL~~~-~vGdih~ipvSHGEGrFva~~~~l~~L~~NGQIatQYVD~~G~~~m~~~yNPNGS~~AIEGI~S~dG~i~G 1247 (1279)
T TIGR01857      1169 NSPWLSEV-SVGDIHAIPVSHGEGRFVASDEVLKELRENGQIATQYVDFEGKPAMDLKYNPNGSSLAIEGIISPDGRIFG 1247 (1279)
T ss_pred             CCCCCCCE-EECCEEEEEEECCCCCEECCHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCEEECCEECCCCEEEE
T ss_conf             78840210-32427753344489832307789989863796378987267863578866978530246344568972752


Q ss_pred             EEEEEHHHCCCHHHHHHHH
Q ss_conf             4652122215202577998
Q gi|254780414|r  173 VQFHPEVVHTVGGSQLIDN  191 (520)
Q Consensus       173 VQFHPEV~hT~~G~~iL~N  191 (520)
                      =+=|-|    ..|..+++|
T Consensus      1248 KMGHSE----R~~~~lf~N 1262 (1279)
T TIGR01857      1248 KMGHSE----RYGDGLFKN 1262 (1279)
T ss_pred             ECCCEE----ECCCCCEEC
T ss_conf             045202----447885460


No 184
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional
Probab=96.31  E-value=0.026  Score=36.72  Aligned_cols=141  Identities=20%  Similarity=0.111  Sum_probs=82.1

Q ss_pred             HHHHHHHHHHHHHHHCC-CCEEEEECCCCHHHHHHHHHHHHCC--C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             67899999999765044-4036640564047799999986223--6-569999738955156278999988623698579
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGN-ERVICAVSGGVDSTVAAFLIYEAIG--I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~-~kVi~~lSGGVDStV~A~Ll~kAig--~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
                      +....+.|--||+.+.. ++..+.-|||=||||..-|..||.=  . -+-.++||||.= -.|.-+-.+.+.+..|++|+
T Consensus         9 ~~LEaesI~I~RE~~a~f~~pvmL~S~GKDS~VmLhLarKAF~p~~iPfPllHIDTg~k-F~Emi~fRD~~a~e~gl~Li   87 (300)
T PRK05253          9 DQLEAESIHIIREVAAEFENPVMLYSIGKDSSVMLHLARKAFYPGKLPFPLLHVDTGWK-FPEMIEFRDRRAKELGLELI   87 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCC-HHHHHHHHHHHHHHHCCCEE
T ss_conf             99998889999999997369679871672599999999998578899963488307998-18999999999998499789


Q ss_pred             EEEHHHHHHHHHCCCCCHHHHHHHHHHHHHH--HHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCC
Q ss_conf             9758899999966898889999887565899--9999997439970998646220245420246777630344302320
Q gi|254780414|r  282 VVDASERFIRKLKNIVDPETKRKVIGQLFIE--VFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG  358 (520)
Q Consensus       282 ~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~--vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgg  358 (520)
                      +-.-.+    .++--..|+.....-...-.+  -..+...+ .+.+.+.- -..-|  |-.+.   ..-.|=||-|-.|
T Consensus        88 V~~n~e----~i~~g~~p~~~g~~~~~~~lKT~~L~~al~~-~~fda~~g-GaRRD--Ee~sR---AKERiFS~R~~~~  155 (300)
T PRK05253         88 VHSNPE----GIARGINPFTHGSAKHTNIMKTEGLKQALEK-YGFDAAFG-GARRD--EEKSR---AKERIFSFRDEFG  155 (300)
T ss_pred             EEECHH----HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHH-CCCCEEEE-CCCCC--CCCCC---CCCCCCCCCCCCC
T ss_conf             975767----7756999566882223157878999999996-48765651-01234--43212---1254247756468


No 185
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479   This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome.    In Sinorhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA , .    In Arthrobacter viscosus, the homologous gene is designated alu1 and is associated with an aluminum tolerance phenotype. When expressed in Escherichia coli, it conferred aliminium tolerance .   The entry also contains the gene queC, which is responsible for the conversion of GTP to 7-cyano-7-deazaguanine (preQ0). The biosynthesis of hypermodified tRNA nucleoside queuosine only occurs in eubacteria. It occupies the wobble position for all known tRNAs that are specific for Asp, Asn, His or Tyr ..
Probab=96.28  E-value=0.0077  Score=40.52  Aligned_cols=160  Identities=22%  Similarity=0.257  Sum_probs=101.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCC-CCCCHHHHHHHHHHCCCCCEE-EEEHH---HHHH-HHHCCCC
Q ss_conf             36640564047799999986223-6569999738955-156278999988623698579-97588---9999-9966898
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFM-RKNEVENIISLFKGYPNFPLR-VVDAS---ERFI-RKLKNIV  297 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~Gll-RknE~~~v~~~~~~~~~~~l~-~vda~---~~Fl-~~L~gv~  297 (520)
                      .|..||||.||||+++++.+--| ++++||=-|=|== -.-|-+-=.+ ..+.+|++-+ .||-+   +.=- ++|-.-.
T Consensus         1 Av~~lSGG~DStT~~~~a~~~~GkyeV~a~TF~YGQR~H~~Ele~A~~-ia~~Lgi~~~~~~Dl~~l~~l~~YsaLt~~~   79 (227)
T TIGR00364         1 AVVVLSGGQDSTTVLLIALDEGGKYEVHAITFDYGQRAHSRELESARK-IAEALGIRHHFVIDLSLLKQLGKYSALTDEQ   79 (227)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHH-HHHHHCCCCEEEECHHHHHHHHCCCCCCCCC
T ss_conf             968743734689999999961795079985465013789999999999-9998089707861779998554045235787


Q ss_pred             -CH-----H----HHHHHHHHHHH----HHHH----HHHHHCCC-----CEEEEECCCCCHHHHHHCCCCCCCCEEEEEE
Q ss_conf             -88-----9----99988756589----9999----99974399-----7099864622024542024677763034430
Q gi|254780414|r  298 -DP-----E----TKRKVIGQLFI----EVFE----EEAKKIGG-----AQFLGQGTLYPDVIESISFFGGPSSIIKSHH  354 (520)
Q Consensus       298 -DP-----E----~KRkiIG~~Fi----~vf~----~~a~~~~~-----~~~L~QGTlypDvIES~~~~~~~~~~IKsHH  354 (520)
                       +|     |    +=--++=+||+    -||-    -.|.+++-     -.-+.-.-.|||-=+-         -|||--
T Consensus        80 ~~~~~~~~e~d~~~~~E~~p~tfVPgRN~~fl~~a~~yA~~~gA~~v~~G~~~~DfSgYPDCr~E---------Fvka~n  150 (227)
T TIGR00364        80 EIPEQKSNEEDKEKALETLPNTFVPGRNLIFLSLAASYAEALGAEAVITGVCETDFSGYPDCRDE---------FVKALN  150 (227)
T ss_pred             CCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCCCCCCCCHH---------HHHHHH
T ss_conf             56766665320235653113333780479999999998886184252200100036579888688---------999999


Q ss_pred             CCCCHH-HHHCCCH-----HHHHHHHHHHHHHHHHHHHC-----CCHHHHC
Q ss_conf             232011-3203202-----23789873899999999819-----9988942
Q gi|254780414|r  355 NVGGLP-EHMDMKL-----VEPLKELFKDEVRLLGKELR-----LPDSFVE  394 (520)
Q Consensus       355 Nvgglp-~~~~~~l-----iEPl~~l~KdEVR~lg~~Lg-----lp~~~~~  394 (520)
                      .+--|= -.-..++     .=||-+|-|-|.=++|.+||     +|-+..|
T Consensus       151 ~~l~Lgn~~~~v~i~Piql~aPL~~ltKaeiv~la~elGkk~l~lv~~~T~  201 (227)
T TIGR00364       151 HALNLGNMLTPVEIRPIQLEAPLMDLTKAEIVKLADELGKKLLDLVIKETY  201 (227)
T ss_pred             HHHHHHCCCCCCEEEEEEEECCEEECCHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             999974126881120246666701269899999988735112311000111


No 186
>KOG0573 consensus
Probab=96.12  E-value=0.013  Score=38.92  Aligned_cols=72  Identities=28%  Similarity=0.356  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH----------------CCCCEEEEECCCCHHHHHHHHHHHHCCC
Q ss_conf             257799875501064411140678999999997650----------------4440366405640477999999862236
Q gi|254780414|r  185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQV----------------GNERVICAVSGGVDSTVAAFLIYEAIGI  248 (520)
Q Consensus       185 G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~v----------------g~~kVi~~lSGGVDStV~A~Ll~kAig~  248 (520)
                      +..+.++|+..   -...-+...++.-.+..+++.|                -..+|-..+||||||||.|+|+|..+-.
T Consensus       200 ~~~i~~~~l~~---~~~~~~v~~l~~~l~ds~k~rvl~i~~rl~~~i~~~c~~~s~VcVlfSGGvDs~vvA~l~h~~vp~  276 (520)
T KOG0573         200 LCDISEIFLNQ---SHRSEVVSGLHTGLRDSLKDRVLVIPPRLCANILLRCIHESNVCVLFSGGVDSTVVAVLAHYVVPE  276 (520)
T ss_pred             CCCHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             30067887656---888888766677778877544312575575421533224576799964884089999999860698


Q ss_pred             CEEEEEECCCC
Q ss_conf             56999973895
Q gi|254780414|r  249 NLTCVLVDHGF  259 (520)
Q Consensus       249 ~l~~vfVD~Gl  259 (520)
                      |-.-=.|+.-|
T Consensus       277 ne~IdLINVaF  287 (520)
T KOG0573         277 NEPIDLINVAF  287 (520)
T ss_pred             CCCEEEEEEEC
T ss_conf             88636898602


No 187
>KOG1907 consensus
Probab=95.68  E-value=0.035  Score=35.83  Aligned_cols=31  Identities=10%  Similarity=0.043  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHCCCHHHHCCCCCCCCCCEEEEC
Q ss_conf             99999999819998894268889831112210
Q gi|254780414|r  377 DEVRLLGKELRLPDSFVERHPCPGPGLAIRCI  408 (520)
Q Consensus       377 dEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~  408 (520)
                      +-|+++=++-|++.+.+.+-| -+-|...+|.
T Consensus       956 ~~v~~~~~~~gv~~~~ig~~~-~~~g~~~~i~  986 (1320)
T KOG1907         956 EKVLEIFSEAGVKCEYIGKAS-AVFGQDAHIK  986 (1320)
T ss_pred             HHHHHHHHHCCCCCEEEEEEC-CCCCCCCEEE
T ss_conf             999999986498612541100-3447774599


No 188
>COG3442 Predicted glutamine amidotransferase [General function prediction only]
Probab=95.64  E-value=0.06  Score=34.13  Aligned_cols=189  Identities=18%  Similarity=0.282  Sum_probs=95.1

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCC---CCCCCCCCCCC---HHHHHCCCCEEEECHHHHHHHHHC
Q ss_conf             998888659406985289898899723997999985388---99999997537---689808998899778999989970
Q gi|254780414|r   23 IARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA---SSLDIDSPQIP---KEILESNIPLLGICYGQQIMCQSL   96 (520)
Q Consensus        23 IaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~---SV~d~~ap~~~---~~I~~~~iPILGICyG~QlLa~~~   96 (520)
                      +-+|.+-.|+-.+|.+-+.. +.+....++=+++.||-.   +.-.++-+...   +..++.+.|+|.||-|.|+|.+.+
T Consensus        26 Lr~ra~~rgi~v~i~~vsl~-d~~~~~~~Dl~~~GGgqD~eQ~i~t~d~~~k~~~l~~~i~~g~p~laiCgg~QlLG~yY  104 (250)
T COG3442          26 LRQRAEKRGIKVEIVEVSLT-DTFPDDSYDLYFLGGGQDYEQEIATRDLLTKKEGLKDAIENGKPVLAICGGYQLLGQYY  104 (250)
T ss_pred             EHHHHHHCCCCEEEEEEECC-CCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCHHHHHHHHCCCCEEEECCCHHHCCCEE
T ss_conf             45789866981699996347-89874440279951720788888752100103779999866995899825553304032


Q ss_pred             ----CCEEE-----------ECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECC------CHHHCCCCCCCEEECC
Q ss_conf             ----96999-----------86986610366752388622278726655336860022------0110124442112323
Q gi|254780414|r   97 ----GGKTK-----------NSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHG------DQVEHIPEGFEVIASS  155 (520)
Q Consensus        97 ----GG~V~-----------~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~------D~V~~lP~gf~viA~S  155 (520)
                          |-++.           +..+|-.|...++.+.....|      ..+..=+-.|+      +.+.  |=|-.+...-
T Consensus       105 ~~a~G~ri~GlGiLd~~T~~~~~~R~IGdiv~~~~~~~e~~------~et~~GFENH~GrT~L~~d~~--pLG~Vv~G~G  176 (250)
T COG3442         105 ETASGTRIDGLGILDHYTENPQTKRFIGDIVIENTLAGEEF------GETLVGFENHGGRTYLGPDVK--PLGKVVYGYG  176 (250)
T ss_pred             ECCCCCEEECCCCEEEEECCCCCCCEEEEEEEECCCCHHHH------CCEEEEEECCCCCEECCCCCC--CCEEEEECCC
T ss_conf             16898476132211234126666504536886214565773------880462543788134189876--4600788667


Q ss_pred             CC--CCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCC--CCCCCCHHHHHHHHHHHH-HHHCCCC
Q ss_conf             98--317889863500112465212221520257799875501064--411140678999999997-6504440
Q gi|254780414|r  156 DS--TPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGI--QDNWVMSSYHKEIVSRIK-EQVGNER  224 (520)
Q Consensus       156 ~~--~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~--~~~W~~~~~~~~~i~~Ir-~~vg~~k  224 (520)
                      +|  -..++.-+  ++++|.-||=-.- + .--++-.-++...|+.  .....+..+-+....++| +...+.+
T Consensus       177 Nn~eD~~eG~~y--kn~~aTY~HGP~L-~-rNp~LAd~Ll~tAl~~ky~~~i~L~~ldd~l~~~~r~e~l~~~~  246 (250)
T COG3442         177 NNGEDGTEGAHY--KNVIATYFHGPIL-S-RNPELADRLLTTALEKKYGQEIELPPLDDILADQARRERLADRK  246 (250)
T ss_pred             CCCCCCCCCEEE--EEEEEEEECCCCC-C-CCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             775546642345--2047875117544-6-88789999999999886277666786230899999999998644


No 189
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons.  DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly 
Probab=95.37  E-value=0.011  Score=39.45  Aligned_cols=59  Identities=15%  Similarity=0.309  Sum_probs=42.1

Q ss_pred             ECCCCCHHHHHHCCCCEEEECCCCCCCCC-CCCCC---CCHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             52898988997239979999853889999-99975---3768980899889977899998997
Q gi|254780414|r   37 IAFKNALDYFKEQNPQAIILSGSPASSLD-IDSPQ---IPKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        37 ~P~~~~~e~i~~~~p~GIILSGGP~SV~d-~~ap~---~~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +..+.++++....+++++|+.||+.+..+ ...|.   +-++..+.+.||.+||-|.++||.+
T Consensus        47 i~~d~~l~~~~~~~~D~liipGG~~~~~~l~~~~~~~~~i~~~~~~~k~i~aiC~G~~~La~a  109 (163)
T cd03135          47 VKADKTLSDVNLDDYDAIVIPGGLPGAQNLADNEKLIKLLKEFNAKGKLIAAICAAPAVLAKA  109 (163)
T ss_pred             EECCCCHHHCCCCCCCEEEECCCCCHHHHHHHCHHHHHHHHHHHHHCCEEEEECHHHHHHHHC
T ss_conf             946876655782017989986898217677669999999999998299479864548999986


No 190
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]
Probab=94.71  E-value=0.29  Score=29.24  Aligned_cols=114  Identities=25%  Similarity=0.355  Sum_probs=75.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEE---EEECCC--CCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCC
Q ss_conf             03664056404779999998622365699---997389--5515627899998862369857997588999999668988
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTC---VLVDHG--FMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVD  298 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~---vfVD~G--llRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~D  298 (520)
                      |++...|||=||+-|+.+.-+. |..+.|   +.=.++  +|=.-.--+..+...+-+|+++...+.+-        ..|
T Consensus         2 k~~aL~SGGKDS~~Al~~a~~~-G~eV~~Ll~~~p~~~dS~m~H~~n~~~~~~~Ae~~gi~l~~~~~~g--------~~e   72 (223)
T COG2102           2 KVIALYSGGKDSFYALYLALEE-GHEVVYLLTVKPENGDSYMFHTPNLELAELQAEAMGIPLVTFDTSG--------EEE   72 (223)
T ss_pred             CEEEEEECCCHHHHHHHHHHHC-CCEEEEEEEEECCCCCEEEEECCCHHHHHHHHHHCCCCEEEEECCC--------CCH
T ss_conf             6899981671889999999975-9836899998159987044222256799999874488359983476--------305


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             89999887565899999999743997099864622024542024677763034430232011320320223789
Q gi|254780414|r  299 PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       299 PE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      -|          ++-..+..+.++ ++.+.-|-+|.+-=-+               .+-.+.+.+.++.++||=
T Consensus        73 ~e----------ve~L~~~l~~l~-~d~iv~GaI~s~yqk~---------------rve~lc~~lGl~~~~PLW  120 (223)
T COG2102          73 RE----------VEELKEALRRLK-VDGIVAGAIASEYQKE---------------RVERLCEELGLKVYAPLW  120 (223)
T ss_pred             HH----------HHHHHHHHHHCC-CCEEEECHHHHHHHHH---------------HHHHHHHHHCCEEEECCC
T ss_conf             56----------999999997376-3379973433099999---------------999999972978851251


No 191
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784   Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through reaction of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS). In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids. Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules.; GO: 0004781 sulfate adenylyltransferase (ATP) activity, 0019421 sulfate reduction APS pathway.
Probab=94.59  E-value=0.32  Score=28.99  Aligned_cols=260  Identities=17%  Similarity=0.174  Sum_probs=140.2

Q ss_pred             HHHHHHHHHHHHHHCC-CCEEEEECCCCHHHHHHHHHHHHCC--C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEE
Q ss_conf             7899999999765044-4036640564047799999986223--6-5699997389551562789999886236985799
Q gi|254780414|r  207 SYHKEIVSRIKEQVGN-ERVICAVSGGVDSTVAAFLIYEAIG--I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRV  282 (520)
Q Consensus       207 ~~~~~~i~~Ir~~vg~-~kVi~~lSGGVDStV~A~Ll~kAig--~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~  282 (520)
                      ....+.|.-|||..++ .+=++..|+|=||+|.--|..||.=  . =+.-++||||. ...|.-...+..-...++.|.+
T Consensus         3 ~LE~EaI~i~REvaa~F~~PV~LyS~GKDS~VlLHLA~KaF~Pg~~PFplLHvDTgw-~f~E~~~fRD~~~~~~~~~L~v   81 (295)
T TIGR02039         3 LLEAEAIHIIREVAAEFERPVLLYSIGKDSSVLLHLARKAFYPGRLPFPLLHVDTGW-KFREMIAFRDELVAKYGLELIV   81 (295)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHCCCCCCCCCCEEEEECCC-CHHHHHHHHHHHHHHHCCEEEE
T ss_conf             015788999998763037976898657347999998764058888797357740663-2789999999999870976888


Q ss_pred             EEHHHHHHHHHCCCCCHHH-HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCC--H
Q ss_conf             7588999999668988899-998875658999999997439970998646220245420246777630344302320--1
Q gi|254780414|r  283 VDASERFIRKLKNIVDPET-KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG--L  359 (520)
Q Consensus       283 vda~~~Fl~~L~gv~DPE~-KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgg--l  359 (520)
                      -..++.....+.-+++-.. .+.++--.=   ..+...+. ..+ -|-|--.=|==.|-+     .--|=|--|--+  -
T Consensus        82 ~~~~~~~~~g~~P~~~~~~~~~~~~~T~~---L~~Al~~~-~FD-Aa~gGARRdEE~sRa-----KERifS~R~~~h~WD  151 (295)
T TIGR02039        82 HSNEEGIAEGINPFTEGSALHTDIMKTEA---LRQALDKN-QFD-AAFGGARRDEEKSRA-----KERIFSFRDAFHQWD  151 (295)
T ss_pred             EECHHHHHHCCCCCHHHHHHHHHHHHHHH---HHHHHHHC-CCC-EEECCCCCHHHHCCC-----CCCEEHHCCCCCCCC
T ss_conf             50502354156620101245555563189---99998733-886-563166313443012-----010001003457888


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCH---
Q ss_conf             13203202237898738999999998199988942688898311122100036789999999999999999864653---
Q gi|254780414|r  360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIY---  436 (520)
Q Consensus       360 p~~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~~ly---  436 (520)
                      |+.-.                        |+=+-.=-+---+|=.||+--=-.=.-+||=+   .|..+.+.-.-||   
T Consensus       152 Pk~QR------------------------PELW~~YNg~~~~GE~~RvFPLSNwTE~DiW~---Y~~~~~i~~~~lYfA~  204 (295)
T TIGR02039       152 PKKQR------------------------PELWNLYNGRISKGESVRVFPLSNWTELDIWR---YIAAENIEIVPLYFAA  204 (295)
T ss_pred             CCCCC------------------------HHHHHHCCCCCCCCCEEEEECCCCCCHHHHHH---HHHHCCCCCCEEECCC
T ss_conf             51257------------------------37787505234688726872266650445898---8743465422011024


Q ss_pred             -HHHHHHHEE--ECCCCCCCCCCCCCCCCCEEEEEEE---ECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEE
Q ss_conf             -332201045--5686324215998541447999632---168775587101898999987557504879812578
Q gi|254780414|r  437 -RKIWQAFTV--LLPVQTVGVMGDERTYEYVCSLRAV---TSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVV  506 (520)
Q Consensus       437 -~~~~q~~av--llp~~svGv~GD~R~y~~~~~lr~v---~s~d~mta~~~~~~~~~l~~is~~i~n~v~~v~rV~  506 (520)
                       ..|.|-=+.  +.........-|+..-...|.-|.+   ..+.+...+.... .+++.++...-+.| +|-.|+.
T Consensus       205 ~RpV~~R~g~l~~~~D~~~~~~~~E~~~~~~vrfRTlGc~~~tga~~S~A~~~-~~ii~E~~~~~~sE-Rg~~R~~  278 (295)
T TIGR02039       205 KRPVVERDGMLIMVDDERLELEPGEVVKERMVRFRTLGCYPLTGAIESDAATV-EEIIAEVAVARTSE-RGQGRAI  278 (295)
T ss_pred             CCCEEECCCEEEEECCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCHHHH-HHHHHHHHHHHHCC-CCCCCCC
T ss_conf             68624107448886065246677751000045555405756454312234107-99999988753202-5452332


No 192
>PRK06850 hypothetical protein; Provisional
Probab=94.23  E-value=0.084  Score=33.13  Aligned_cols=225  Identities=20%  Similarity=0.259  Sum_probs=119.3

Q ss_pred             CHHHHHHHHHHHHHHHC-CC-CEEEEECCCCHHHHHHHHHHHHCCC--------CEEEEEECCCCCCC------CCHHHH
Q ss_conf             06789999999976504-44-0366405640477999999862236--------56999973895515------627899
Q gi|254780414|r  205 MSSYHKEIVSRIKEQVG-NE-RVICAVSGGVDSTVAAFLIYEAIGI--------NLTCVLVDHGFMRK------NEVENI  268 (520)
Q Consensus       205 ~~~~~~~~i~~Ir~~vg-~~-kVi~~lSGGVDStV~A~Ll~kAig~--------~l~~vfVD~GllRk------nE~~~v  268 (520)
                      +...+++.+++|++..- |+ --+.|.|||=|||++..|+-.||-.        .++-|.-||+.=--      +.+-+-
T Consensus         2 ~~~~i~~i~~ei~~~Yl~D~rPWvIGySGGKDSTavLqLvw~Al~~Lp~e~r~K~v~VIssDTlVEnPiV~~~v~~sL~~   81 (488)
T PRK06850          2 LGEPIEELIEEIQELYCADNRPWVIGYSGGKDSTAVLQLVWNALAGLPPEKRHKPVYVISTDTLVENPVVVAWVNKSLER   81 (488)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHHHCCHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             31379999999999986379987997587719999999999999837887668988999589875677999999999999


Q ss_pred             HHHHHHCCCCCEEEE----EHHHHHHHHHCCCCCH--HHH-------HHHH-HHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             998862369857997----5889999996689888--999-------9887-5658999999997439970998646220
Q gi|254780414|r  269 ISLFKGYPNFPLRVV----DASERFIRKLKNIVDP--ETK-------RKVI-GQLFIEVFEEEAKKIGGAQFLGQGTLYP  334 (520)
Q Consensus       269 ~~~~~~~~~~~l~~v----da~~~Fl~~L~gv~DP--E~K-------RkiI-G~~Fi~vf~~~a~~~~~~~~L~QGTlyp  334 (520)
                      ++...+..++++...    +-.+.|.-.|-|=-=|  -.+       =||= -+.||+-.   +++. +.--++-||=..
T Consensus        82 i~~~A~~~~LPI~~~~v~P~~~dtFWvnlIGrGYPaP~~~FRWCTdRLKI~P~~rFI~~~---v~~~-ge~IlvLGtR~~  157 (488)
T PRK06850         82 IKEAAKKQGLPITPHKLTPKVKDTFWVNLIGKGYPAPRRKFRWCTERLKINPSNDFIRDK---VSAF-GEVIVVLGTRKA  157 (488)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHCCHHHHHHHHH---HHHC-CCEEEEEECCHH
T ss_conf             999998659982268814886544335420476799987665475665148489999999---8753-978999854527


Q ss_pred             HHHHHHCCCCCCCCEEEEEECCCCHHHHH----C---CCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEE
Q ss_conf             24542024677763034430232011320----3---2022378987389999999981999889426888983111221
Q gi|254780414|r  335 DVIESISFFGGPSSIIKSHHNVGGLPEHM----D---MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRC  407 (520)
Q Consensus       335 DvIES~~~~~~~~~~IKsHHNvgglp~~~----~---~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi  407 (520)
                         ||...    +.+|+.|- .+|.-+.+    .   .-+.-|++++--|||=..=..        +.-||-++      
T Consensus       158 ---ES~~R----a~~m~k~e-~~~~r~~Ls~h~~l~n~~vy~PI~~ws~ddVW~yL~~--------~~nPWg~~------  215 (488)
T PRK06850        158 ---ESAAR----AQVMAKHK-IGGTRDRLSRHSTLPNSFVYTPIEDWSNDDVWKYLLQ--------WENPWGGS------  215 (488)
T ss_pred             ---HHHHH----HHHHHHHH-CCCCCCCCCCCCCCCCCEEECCHHHCCCCHHHHHHHH--------CCCCCCCC------
T ss_conf             ---77999----99999875-2473012577888888689712553773379999861--------89988997------


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHH-HHHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCC
Q ss_conf             000367899999999999999998646533322-01045568632421599854144799963216877558
Q gi|254780414|r  408 IGEITEERINILRESDAIYREEIHKAGIYRKIW-QAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTA  478 (520)
Q Consensus       408 ~g~vt~e~~~i~r~ad~i~~~~l~~~~ly~~~~-q~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta  478 (520)
                          ..+-..+                 |.... ..=|-+.-..|..--|+.|-=-|+|.+  |.---.|+|
T Consensus       216 ----n~~L~~l-----------------Y~~A~~~gECPlv~d~stpSCG~SRFGCWvCTv--V~~DKSm~~  264 (488)
T PRK06850        216 ----NKDLFTL-----------------YRGATADGECPLVVDTSTPSCGNSRFGCWVCTV--VTKDKSMEA  264 (488)
T ss_pred             ----HHHHHHH-----------------HHCCCCCCCCCEEECCCCCCCCCCCCCCEEEEE--ECCCHHHHH
T ss_conf             ----6999999-----------------705788996773657999987787666167777--643372999


No 193
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domainhas  a strongly conserved motif SGGKD at the N terminus.
Probab=94.01  E-value=0.59  Score=27.05  Aligned_cols=61  Identities=23%  Similarity=0.348  Sum_probs=45.9

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEE----CCCCCC-CCCHHHHHHHHHHCCCCCEEEEEH
Q ss_conf             03664056404779999998622365699997----389551-562789999886236985799758
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLV----DHGFMR-KNEVENIISLFKGYPNFPLRVVDA  285 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfV----D~GllR-knE~~~v~~~~~~~~~~~l~~vda  285 (520)
                      ||++..|||=||+-|...+.+. |.++.|+..    +..-++ ..-..++.+...+.+|+++..+..
T Consensus         1 Kv~~l~SGGKDS~lAl~~a~~~-g~~v~~L~~~~~~~~~~~~~H~~~~~l~~~qAealgiPl~~~~~   66 (194)
T cd01994           1 KVVALISGGKDSCYALYRALEE-GHEVVALLNLTPEEGSSMMYHTVNHELLELQAEAMGIPLIRIEI   66 (194)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEEECCCCCEEECCCCCHHHHHHHHHHCCCCEEEEEC
T ss_conf             9899977859999999999986-99259999996399880525055789999999985996699966


No 194
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional
Probab=93.91  E-value=0.62  Score=26.91  Aligned_cols=22  Identities=23%  Similarity=0.264  Sum_probs=10.5

Q ss_pred             HEEECCCCCCCCCCCCC-CCCCEEE
Q ss_conf             04556863242159985-4144799
Q gi|254780414|r  443 FTVLLPVQTVGVMGDER-TYEYVCS  466 (520)
Q Consensus       443 ~avllp~~svGv~GD~R-~y~~~~~  466 (520)
                      ++-++|.++  .|.+.+ ..+|+-+
T Consensus       334 M~Gvlp~~~--~m~~r~~~lGY~~~  356 (432)
T PRK13896        334 MAGVLPADV--RMQDRYQALDHVEL  356 (432)
T ss_pred             EEEEECEEE--EECCCCCCCCCEEE
T ss_conf             251354288--97778554475599


No 195
>KOG2840 consensus
Probab=93.82  E-value=0.2  Score=30.36  Aligned_cols=98  Identities=30%  Similarity=0.374  Sum_probs=63.6

Q ss_pred             HHHHCCCCEEEEECCCCHHHHHHHHHH---H--HCCCCEEEEEECCCC--CCCCCHHHHHHHHHHCCCCCEEEEEHHHHH
Q ss_conf             765044403664056404779999998---6--223656999973895--515627899998862369857997588999
Q gi|254780414|r  217 KEQVGNERVICAVSGGVDSTVAAFLIY---E--AIGINLTCVLVDHGF--MRKNEVENIISLFKGYPNFPLRVVDASERF  289 (520)
Q Consensus       217 r~~vg~~kVi~~lSGGVDStV~A~Ll~---k--Aig~~l~~vfVD~Gl--lRknE~~~v~~~~~~~~~~~l~~vda~~~F  289 (520)
                      +.-.-.++|-.|-|||=||||+|-.+.   .  -.|-+|.-+=||+|+  .|++--+-|..++.+ .++++.++-..+.|
T Consensus        46 ~l~~rge~v~igasGgkdstvlA~v~~~Ln~r~~~g~~l~Lls~degi~gyrd~sl~avkrn~~~-~~lPL~ivs~~dl~  124 (347)
T KOG2840          46 KLFARGERVAIGASGGKDSTVLAYVLDALNERHDYGLRLFLLSIDEGIRGYRDDSLEAVKRNGVQ-YGLPLCIVSYKDLY  124 (347)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHH-CCCCEEEECHHHHH
T ss_conf             86678883132555660277999999984030178841342101003642004299999986142-07863884199972


Q ss_pred             HHHHCCCCCHHHHHHHHH------HHHHHHHHHHHHH
Q ss_conf             999668988899998875------6589999999974
Q gi|254780414|r  290 IRKLKNIVDPETKRKVIG------QLFIEVFEEEAKK  320 (520)
Q Consensus       290 l~~L~gv~DPE~KRkiIG------~~Fi~vf~~~a~~  320 (520)
                          .+.|--| +=.-||      -||-.||-+++-+
T Consensus       125 ----~~~tmd~-i~~~i~~~~rn~ctfCgv~RrqaL~  156 (347)
T KOG2840         125 ----GEWTMDE-IVSEIGQEIRNNCTFCGVFRRQALD  156 (347)
T ss_pred             ----CCCHHHH-HHHHHHHHHCCCCEEECHHHHHHHH
T ss_conf             ----5020888-9999866230460451189888887


No 196
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus.   PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source.  Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=93.51  E-value=0.052  Score=34.57  Aligned_cols=57  Identities=23%  Similarity=0.384  Sum_probs=40.1

Q ss_pred             CCCCHHHHHHCCCCEEEECCCCCCCCCCCCC---CCCHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             8989889972399799998538899999997---53768980899889977899998997
Q gi|254780414|r   39 FKNALDYFKEQNPQAIILSGSPASSLDIDSP---QIPKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        39 ~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap---~~~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      .+..++++...++++|++.||++.-+-...+   ++-++..+.+.||-.||-|-++|+.+
T Consensus        65 ~~~~~~dv~~~~yDai~iPGG~g~~~l~~d~~~~~li~~~~~~gK~iaaIChgp~~L~~a  124 (180)
T cd03169          65 VTADFDEVDPDDYDALVIPGGRAPEYLRLDEKVLAIVRHFAEANKPVAAICHGPQILAAA  124 (180)
T ss_pred             CCCCHHHCCHHHCCEEEECCCCCHHHHHCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHC
T ss_conf             678767898610999998998228777119799999999998199699778168999876


No 197
>pfam01965 DJ-1_PfpI DJ-1/PfpI family. The family includes the protease PfpI. This domain is also found in transcriptional regulators.
Probab=93.39  E-value=0.052  Score=34.61  Aligned_cols=60  Identities=23%  Similarity=0.458  Sum_probs=44.5

Q ss_pred             EECCCCCHHHHHHCCCCEEEECCCCCCCCC-CCCCCC---CHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             852898988997239979999853889999-999753---768980899889977899998997
Q gi|254780414|r   36 VIAFKNALDYFKEQNPQAIILSGSPASSLD-IDSPQI---PKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        36 I~P~~~~~e~i~~~~p~GIILSGGP~SV~d-~~ap~~---~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      .+..|.+++++...++++||+.||.....+ ...+.+   -++..+.+.+|.+||-|-.+|+.+
T Consensus        20 ~v~~d~~~~~~~~~~~D~lvipGG~~~~~~l~~~~~~~~~l~~~~~~~~~i~aiC~g~~~La~~   83 (141)
T pfam01965        20 KLRADKTLDDVNADDYDALVIPGGHAAAEDLRDDEKLVKFVKEFYEAGKPIAAICHGPVLLAAA   83 (141)
T ss_pred             EEECCCCHHHCCHHHCCEEEECCCCCHHHHHHHCHHHHHHHHHHHHHCCEEEEECHHHHHHHHC
T ss_conf             8967701888895249999996994067664019999999999998399899987668999986


No 198
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus.   PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source.  Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=93.35  E-value=0.11  Score=32.15  Aligned_cols=57  Identities=18%  Similarity=0.357  Sum_probs=40.5

Q ss_pred             CCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCC---HHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             28989889972399799998538899999997537---68980899889977899998997
Q gi|254780414|r   38 AFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIP---KEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        38 P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~---~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      -.|..++++...+++.+||.||+.... ...|.+.   ++..+.+.+|-+||-|-++|+.+
T Consensus        48 ~~D~~l~~v~~~~~D~lvlPGG~~~~~-~~~~~l~~~l~~~~~~gk~iaaIC~g~~vLa~a  107 (170)
T cd03140          48 VPDYSLDDLPPEDYDLLILPGGDSWDN-PEAPDLAGLVRQALKQGKPVAAICGATLALARA  107 (170)
T ss_pred             ECCCCHHHCCCCCCCEEEECCCCCCCC-CCCHHHHHHHHHHHHHCCCEEEECHHHHHHHHC
T ss_conf             567586888902177899868875100-249999999999987499099986558999985


No 199
>TIGR00649 MG423 conserved hypothetical protein; InterPro: IPR004613 This is a family of conserved hypothetical proteins, the members of which contain an ATP-binding domain at the N-terminal end of the protein. It is possibly part of a superfamily of beta-lactmases..
Probab=92.57  E-value=0.26  Score=29.63  Aligned_cols=86  Identities=20%  Similarity=0.224  Sum_probs=55.8

Q ss_pred             CCCCEEEEEECCCCHH-----HH--HHHHHHHCCCE---EEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             4488699998897057-----88--99888865940---69852898988997239979999853889999999753768
Q gi|254780414|r    5 ERSSKVLIIDFGSQFT-----QL--IARRVRESKVY---CEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKE   74 (520)
Q Consensus         5 ~~~~~IlIlDfGSQyt-----qL--IaRriRelgVy---seI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~   74 (520)
                      +-.+-|+|+|-|+.+-     .-  |++ +  +||.   --|+|-.+.+.+..+ +++||+||-|.    ++ ..---..
T Consensus        20 e~~~ev~i~D~G~~~PRVlIHed~di~~-~--~G~dL~~~~vIPD~~~l~~~~~-kvkgI~~tHGH----~D-HIGav~y   90 (593)
T TIGR00649        20 EVDDEVVIIDAGIRFPRVLIHEDTDIAE-M--LGVDLIEKGVIPDFTYLKENED-KVKGIVITHGH----ED-HIGAVPY   90 (593)
T ss_pred             EECCEEEEEECCCCCCCEEEECCCCHHH-H--CCHHHHHCCCCCCCHHHHHHCC-CEEEEEECCCC----CC-CCCHHHH
T ss_conf             8778599982322379646415520354-4--0411432031689616752125-06788970871----00-0122888


Q ss_pred             HH-HCCCC-EEEECHHHHHHHHHCCCE
Q ss_conf             98-08998-899778999989970969
Q gi|254780414|r   75 IL-ESNIP-LLGICYGQQIMCQSLGGK   99 (520)
Q Consensus        75 I~-~~~iP-ILGICyG~QlLa~~~GG~   99 (520)
                      ++ +.+.| |.|-=|++.||-..+-|+
T Consensus        91 L~~~~~~~PiYGt~lt~~L~~~ki~~E  117 (593)
T TIGR00649        91 LLHQYGFPPIYGTPLTIALIKSKIKAE  117 (593)
T ss_pred             HHHHCCCCCEECCHHHHHHHHHHHHHH
T ss_conf             986568882404378999999988654


No 200
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus.   This group includes proteins similar to PfpI from P.  furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source.  Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.  For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain.  PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704.
Probab=92.27  E-value=0.088  Score=32.97  Aligned_cols=59  Identities=14%  Similarity=0.335  Sum_probs=40.3

Q ss_pred             ECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCC---CCHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             5289898899723997999985388999999975---3768980899889977899998997
Q gi|254780414|r   37 IAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQ---IPKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        37 ~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~---~~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +..+.+++++...++++||+.||.+.-.-.+.+.   +-++..+.+.||-.||-|-++|+.+
T Consensus        49 v~~d~~l~~~~~~~yD~ivlPGG~g~~~l~~~~~~~~~i~~~~~~~k~iaaIC~gp~~L~~~  110 (165)
T cd03134          49 VTVDLTIADVDADDYDALVIPGGTNPDKLRRDPDAVAFVRAFAEAGKPVAAICHGPWVLISA  110 (165)
T ss_pred             EECCCCHHHCCHHHCCEEEECCCCCHHHHHHCHHHHHHHHHHHHHCCCEEEECCHHHHHHHC
T ss_conf             86786579989622888997898588888529899999999997199299998757877457


No 201
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases. Catalase catalyzes the dismutation of hydrogen peroxide (H2O2) to water and oxygen. This group includes the large catalases: Neurospora crassa Catalase-1 and Catalase-3 and, Escherichia coli HP-II.  This GATase1-like domain has an essential role in HP-II catalase activity.  However, it lacks enzymatic activity and the catalytic triad typical of GATase1 domains. Catalase-1 and -3 are homotetrameric, HP-II is homohexameric. It has been proposed that this domain may facilitate the folding and oligomerization process. The interface between this GATase1-like domain of HP-II and the core of the subunit forms part of a channel which provides access to the deeply buried catalase active sites of HPII.  Catalase-1 is associated with non-growing cells; C
Probab=92.20  E-value=0.28  Score=29.36  Aligned_cols=88  Identities=14%  Similarity=0.160  Sum_probs=58.3

Q ss_pred             EEEEE-ECCCCHHHH--HHHHHHHCCCEEEEECCCC---------------CHHHHHHCCCCEEEECCCCCCCC----CC
Q ss_conf             69999-889705788--9988886594069852898---------------98899723997999985388999----99
Q gi|254780414|r    9 KVLII-DFGSQFTQL--IARRVRESKVYCEVIAFKN---------------ALDYFKEQNPQAIILSGSPASSL----DI   66 (520)
Q Consensus         9 ~IlIl-DfGSQytqL--IaRriRelgVyseI~P~~~---------------~~e~i~~~~p~GIILSGGP~SV~----d~   66 (520)
                      ||+|| .=|.....+  +..++++.|+..+|+....               +++......++++++.||+.++.    +.
T Consensus         3 kVaiLv~dg~~~~e~~~~~~al~~aG~~v~via~~~g~v~~~~g~~~~vd~t~~~~~s~~fDAvvipgG~~~~~~L~~~~   82 (142)
T cd03132           3 KVGILVADGVDAAELSALKAALKAAGANVKVVAPTLGGVVDSDGKTLEVDQTYAGAPSVLFDAVVVPGGAEAAFALAPSG   82 (142)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCEECCCCCEEECCEEECCCCHHHCCEEEECCCCCCHHHHCCCH
T ss_conf             89999669988899999999999889989999579870775899888054435368964713688438877988864486


Q ss_pred             CCCCCCHHHHHCCCCEEEECHHHHHHHHHC
Q ss_conf             997537689808998899778999989970
Q gi|254780414|r   67 DSPQIPKEILESNIPLLGICYGQQIMCQSL   96 (520)
Q Consensus        67 ~ap~~~~~I~~~~iPILGICyG~QlLa~~~   96 (520)
                      .+.++-.+.|+-++||-.||-|-++|..+-
T Consensus        83 ~~~~fv~eay~h~KpI~a~~~~~~lL~~ag  112 (142)
T cd03132          83 RALHFVTEAFKHGKPIGAVGEGSDLLEAAG  112 (142)
T ss_pred             HHHHHHHHHHHCCCEEEEECCHHHHHHHCC
T ss_conf             799999999976997999377299999769


No 202
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=91.94  E-value=0.23  Score=29.97  Aligned_cols=146  Identities=21%  Similarity=0.316  Sum_probs=83.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCC-CCCHHHH
Q ss_conf             036640564047799999986223656999973895515627899998862369857997588999999668-9888999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN-IVDPETK  302 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~g-v~DPE~K  302 (520)
                      +|-...|||-|||.+|.+|.|- |=+.+-|-|+-|++-..+-..  +.- +.+|.+-.++.--...|++-.. +.+----
T Consensus         2 ~v~vLfSGGKDSSLaA~iL~kl-gyev~LVTvnFGv~d~~k~A~--~tA-~~lgF~h~vl~Ldr~ile~A~em~iedg~P   77 (198)
T COG2117           2 DVYVLFSGGKDSSLAALILDKL-GYEVELVTVNFGVLDSWKYAR--ETA-AILGFPHEVLQLDREILEDAVEMIIEDGYP   77 (198)
T ss_pred             CEEEEECCCCCHHHHHHHHHHH-CCCCEEEEEEECCCCCHHHHH--HHH-HHHCCCCCEECCCHHHHHHHHHHHHHCCCC
T ss_conf             5689844897105899999871-787179998733466406689--999-982997000016889999999999853898


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             98875658999999997439970998646220245420246777630344302320113203202237898738999999
Q gi|254780414|r  303 RKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLL  382 (520)
Q Consensus       303 RkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~l  382 (520)
                      |..|-..-=...|-.|..  ..+.+|-||=..|-.---+.     +.+.      .|-.+++-.-+-||.-|=+--||.|
T Consensus        78 ~~aIq~iH~~alE~~A~r--~~~~iaDGTRRDDrvP~ls~-----~~~q------SLEdR~nv~Yi~PL~G~G~kti~~L  144 (198)
T COG2117          78 RNAIQYIHEMALEALASR--EVDRIADGTRRDDRVPKLSR-----SEAQ------SLEDRLNVQYIRPLLGLGYKTIRRL  144 (198)
T ss_pred             CHHHHHHHHHHHHHHHHH--HHHHHCCCCCCCCCCCCCCH-----HHHH------HHHHHCCCEEECCCCCCCHHHHHHH
T ss_conf             508899999999999877--78887578744566764249-----8875------1887518645530334467899999


Q ss_pred             HHHH
Q ss_conf             9981
Q gi|254780414|r  383 GKEL  386 (520)
Q Consensus       383 g~~L  386 (520)
                      ...+
T Consensus       145 v~~~  148 (198)
T COG2117         145 VSAI  148 (198)
T ss_pred             HHHH
T ss_conf             8877


No 203
>pfam01902 ATP_bind_4 ATP-binding region. This family of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.In some members of this family, this domain is associated with pfam01042.
Probab=91.30  E-value=1.3  Score=24.55  Aligned_cols=114  Identities=18%  Similarity=0.232  Sum_probs=64.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--CEEEEEECCC--CCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCH
Q ss_conf             0366405640477999999862236--5699997389--55156278999988623698579975889999996689888
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGI--NLTCVLVDHG--FMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDP  299 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~--~l~~vfVD~G--llRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DP  299 (520)
                      |+++..|||=||+-|.....+. .+  -|.++.-.++  .|=..-..++.+...+-+|+++..+..+        |.   
T Consensus         2 K~~~l~SGGKDS~~Al~~a~~~-~~v~~L~t~~~~~~ds~~~H~~~~~l~~~qA~algiPl~~~~~~--------~~---   69 (219)
T pfam01902         2 KVAALYSGGKDSNYALYWALKE-IEVPYLVSMKSENKESYMFHEPNLHLTKLLAEALGIPIIKLYTK--------GE---   69 (219)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECC--------CC---
T ss_conf             3999972869999999999871-98379999963799810261578899999999759968999679--------86---


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             9999887565899999999743997099864622024542024677763034430232011320320223789
Q gi|254780414|r  300 ETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       300 E~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      +       +.+.+-+.+..+++ +++-++-|-|+-+-.-.               .+-.+-+.++++.+.||=
T Consensus        70 ~-------e~~~~~L~~~l~~~-~i~~vv~GdI~s~~qr~---------------~~e~~c~~lgl~~~~PLW  119 (219)
T pfam01902        70 E-------EKEVEDLAGFLESL-DVDALVAGAIYSEYQKS---------------RIESVCRELGLKPFAPLW  119 (219)
T ss_pred             H-------HHHHHHHHHHHHHC-CCCEEEECCCCCHHHHH---------------HHHHHHHHCCCEEEECCC
T ss_conf             1-------79999999999875-98699998603688999---------------999999972988971034


No 204
>KOG1706 consensus
Probab=91.23  E-value=0.73  Score=26.38  Aligned_cols=90  Identities=24%  Similarity=0.293  Sum_probs=60.8

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH----------
Q ss_conf             4403664056404779999998622365699997389551562789999886236985799758899999----------
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR----------  291 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~----------  291 (520)
                      .++|++|-|||.|.|+.-+-|.. -|=.++|.+-|-|-  +-+.++-.+--.+...-++.+.|.++.|.+          
T Consensus         5 ~~~vVLAySGgLDTscil~WLke-qGyeViay~AnvGQ--~edfe~ar~kAlk~Gakk~~~ed~~~eFvedfi~Pa~qs~   81 (412)
T KOG1706           5 KKSVVLAYSGGLDTSCILAWLKE-QGYEVIAYLANVGQ--KEDFEEARKKALKSGAKKVVVEDVREEFVEDFIWPALQSS   81 (412)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHH-CCCEEEEEECCCCC--HHHHHHHHHHHHHCCCEEEEEHHHHHHHHHHCCHHHHHHC
T ss_conf             74599995388672343588886-29658984001562--6668999975331276079861315888760201644311


Q ss_pred             ------HHCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             ------96689888999988756589999999
Q gi|254780414|r  292 ------KLKNIVDPETKRKVIGQLFIEVFEEE  317 (520)
Q Consensus       292 ------~L~gv~DPE~KRkiIG~~Fi~vf~~~  317 (520)
                            .|-|.+   --|-+|-+.-|+|..++
T Consensus        82 a~YEd~YLLGTS---laRp~ia~~qv~va~~e  110 (412)
T KOG1706          82 ALYEDRYLLGTS---LARPVIAKAQVDVAQRE  110 (412)
T ss_pred             CHHHCEEEECCC---CCCCHHHHHHHHHHHHC
T ss_conf             210101342244---44313433353577651


No 205
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC. Members of this protein family are the DndC protein from the dnd (degradation during electrophoresis) operon. The dnd phenotype reflects a sulfur-containing modification to DNA. This operon is sparsely and sporadically distributed among bactera; among the first eight examples are members from the Actinobacteria, Firmicutes, Gammaproteobacteria, Cyanobacteria. DndC is suggested to be a sulfurtransferase.
Probab=90.74  E-value=0.3  Score=29.14  Aligned_cols=217  Identities=20%  Similarity=0.270  Sum_probs=111.4

Q ss_pred             HHHHHHHHC-CC-CEEEEECCCCHHHHHHHHHHHHCCC--------CEEEEEECCCCCCC------CCHHHHHHHHHHCC
Q ss_conf             999976504-44-0366405640477999999862236--------56999973895515------62789999886236
Q gi|254780414|r  213 VSRIKEQVG-NE-RVICAVSGGVDSTVAAFLIYEAIGI--------NLTCVLVDHGFMRK------NEVENIISLFKGYP  276 (520)
Q Consensus       213 i~~Ir~~vg-~~-kVi~~lSGGVDStV~A~Ll~kAig~--------~l~~vfVD~GllRk------nE~~~v~~~~~~~~  276 (520)
                      +++||+..- |+ --+.|.|||=|||++..|+-.||-.        .++-|.-||+.=--      +.+-+-++.+.+..
T Consensus         2 ~~ei~~~Y~~d~~PWvIGySGGKDSTavLqLvw~Al~~Lp~e~r~K~v~VIssDTlVEnP~V~~~v~~~L~~i~~~a~~~   81 (447)
T TIGR03183         2 IEEIQELYCADDIPWVIGYSGGKDSTAVLQLVWNALSELPPEQRTKKIHVISTDTLVENPIVAAWVNVSLERMQEAAQKQ   81 (447)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHHHCCHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             38999998537998799758773999999999999984788757688899979987557799999999999999999974


Q ss_pred             CCCEEEE----EHHHHHHHHHCCCCC--HHHH-------HHHH-HHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCC
Q ss_conf             9857997----588999999668988--8999-------9887-565899999999743997099864622024542024
Q gi|254780414|r  277 NFPLRVV----DASERFIRKLKNIVD--PETK-------RKVI-GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISF  342 (520)
Q Consensus       277 ~~~l~~v----da~~~Fl~~L~gv~D--PE~K-------RkiI-G~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~  342 (520)
                      ++++...    +-.+.|.-.|-|=-=  |..+       =||= -+.||+-   .+.+. +.--|+-||=+.   ||...
T Consensus        82 ~LPi~~~~~~P~~~dtFWvnlIGrGYPaP~~~FRWCTdrLKI~P~~~fi~~---~v~~~-ge~ilvLGtR~~---ES~~R  154 (447)
T TIGR03183        82 GLPIEPHRLTPAIEDTFWVNLIGKGYPAPRQKFRWCTDRLKISPSNTFIRD---KVAAN-GEVILVLGTRKN---ESQAR  154 (447)
T ss_pred             CCCCEEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCHHHHCCHHHHHHHH---HHHCC-CCEEEEEECCHH---HHHHH
T ss_conf             998236893378544300010346307999876525576636828999998---65214-968999956527---77999


Q ss_pred             CCCCCCEEEEEECCCCHHHHH----C---CCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHH
Q ss_conf             677763034430232011320----3---202237898738999999998199988942688898311122100036789
Q gi|254780414|r  343 FGGPSSIIKSHHNVGGLPEHM----D---MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER  415 (520)
Q Consensus       343 ~~~~~~~IKsHHNvgglp~~~----~---~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~  415 (520)
                          |.+|+.|-. ++.-+.+    .   --+.-|++++--|||=..=..            +|-|      -|.-..+-
T Consensus       155 ----a~~i~k~e~-~~~~~~ls~h~~l~n~~vy~PI~dws~ddVW~yL~~------------~~~P------wg~~n~~L  211 (447)
T TIGR03183       155 ----AAVMEKHEG-GSTRDRLSRNSSLPNSWVYTPIEDWSNDDVWMYLLQ------------NPNP------WGYDNHDL  211 (447)
T ss_pred             ----HHHHHHHHC-CCCHHHCCCCCCCCCCEEECCHHHCCHHHHHHHHCC------------CCCC------CCCCHHHH
T ss_conf             ----999998644-670421276888888379730674764089998633------------8998------89985999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHH-HHEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCCC
Q ss_conf             99999999999999986465333220-1045568632421599854144799963216877558
Q gi|254780414|r  416 INILRESDAIYREEIHKAGIYRKIWQ-AFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTA  478 (520)
Q Consensus       416 ~~i~r~ad~i~~~~l~~~~ly~~~~q-~~avllp~~svGv~GD~R~y~~~~~lr~v~s~d~mta  478 (520)
                      ..                 +|..... .=|-+.-.+|..--|+.|-=-|+|.+  |.---.|+|
T Consensus       212 ~~-----------------lY~~At~~gECplv~d~stpSCG~SRFGCWvCTv--V~~DKSm~~  256 (447)
T TIGR03183       212 FK-----------------LYQGATADGECPLVVDKSTPSCGDSRFGCWVCTV--VSEDKSMNA  256 (447)
T ss_pred             HH-----------------HHHCCCCCCCCCEEECCCCCCCCCCCCCCEEEEE--ECCHHHHHH
T ss_conf             99-----------------9740678997763547988886677667367777--632273999


No 206
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only]
Probab=90.53  E-value=0.21  Score=30.31  Aligned_cols=56  Identities=16%  Similarity=0.329  Sum_probs=38.6

Q ss_pred             CHHHHHHCCCCEEEECCC-CCCCCCCCCC---CCCHHHHHCCCCEEEECHHHHHHHHHCC
Q ss_conf             988997239979999853-8899999997---5376898089988997789999899709
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGS-PASSLDIDSP---QIPKEILESNIPLLGICYGQQIMCQSLG   97 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGG-P~SV~d~~ap---~~~~~I~~~~iPILGICyG~QlLa~~~G   97 (520)
                      ..+.....+++++++.|| ...-+....+   .+-++.++.+.||..||-|-++|+.+-.
T Consensus        58 ~~~~~~~~~ydal~ipGG~~~~~~~~~~~~~~~~v~~~~~~~k~vaaIC~g~~~L~~ag~  117 (188)
T COG0693          58 AFDDADAADYDALVIPGGDHGPEYLRPDPDLLAFVRDFYANGKPVAAICHGPAVLAAAGL  117 (188)
T ss_pred             HCCCCCCCCCCEEEECCCCCCHHHCCCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHCCC
T ss_conf             116578135989998899752322135178999999999769989998468899874768


No 207
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31).  This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein.  EcHsp31 has chaperone activity.  Ydr533c is upregulated in response to various stress conditions along with the heat shock family.  EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A.   The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different 
Probab=90.41  E-value=0.21  Score=30.23  Aligned_cols=57  Identities=19%  Similarity=0.366  Sum_probs=43.2

Q ss_pred             CCCCHHHHHHCCCCEEEECCCCCCCCC-CCCC---CCCHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             898988997239979999853889999-9997---53768980899889977899998997
Q gi|254780414|r   39 FKNALDYFKEQNPQAIILSGSPASSLD-IDSP---QIPKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        39 ~~~~~e~i~~~~p~GIILSGGP~SV~d-~~ap---~~~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      ...+++++...++++|++.||+...+| .+++   ++-.++++.+.||-.||.|-..|..+
T Consensus        79 ~~~~l~~v~~~~ydai~~pGG~g~m~dl~~~~~l~~l~~~~~~~gk~vaaiCHGp~~L~~~  139 (221)
T cd03141          79 NTKKLSDVDPSDYDAIFIPGGHGPMFDLPDNPDLQDLLREFYENGKVVAAVCHGPAALLNV  139 (221)
T ss_pred             CCCCHHHCCHHHCCEEEECCCCCHHHHHHCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHH
T ss_conf             8789678998788389989985458774416999999999997498599976307988750


No 208
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]
Probab=89.12  E-value=1.5  Score=24.22  Aligned_cols=42  Identities=24%  Similarity=0.348  Sum_probs=20.4

Q ss_pred             CCCHHHHHHHHHHHHHHHCC-CCEEEEECCCCHHHHHHHHHHH
Q ss_conf             14067899999999765044-4036640564047799999986
Q gi|254780414|r  203 WVMSSYHKEIVSRIKEQVGN-ERVICAVSGGVDSTVAAFLIYE  244 (520)
Q Consensus       203 W~~~~~~~~~i~~Ir~~vg~-~kVi~~lSGGVDStV~A~Ll~k  244 (520)
                      ...+|..+-.+++|+=...+ .+|+...|||-||+|.--|++.
T Consensus         7 y~~~nV~eA~~eRl~~if~~f~~VcVSFSGGKDS~lmLhL~~~   49 (407)
T COG3969           7 YLDENVLEAAIERLEWIFNTFPRVCVSFSGGKDSGLMLHLVAE   49 (407)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             4740499999999999884388389992378740589999999


No 209
>KOG0571 consensus
Probab=88.47  E-value=0.69  Score=26.56  Aligned_cols=111  Identities=15%  Similarity=0.230  Sum_probs=60.1

Q ss_pred             HHHHHHH-HHCCCCEEEEECCCCHHHHHHHHHHHHCCC-------CEEEEEECCCCCC---CCCHHHHHHHHHHCCCCCE
Q ss_conf             9999976-504440366405640477999999862236-------5699997389551---5627899998862369857
Q gi|254780414|r  212 IVSRIKE-QVGNERVICAVSGGVDSTVAAFLIYEAIGI-------NLTCVLVDHGFMR---KNEVENIISLFKGYPNFPL  280 (520)
Q Consensus       212 ~i~~Ir~-~vg~~kVi~~lSGGVDStV~A~Ll~kAig~-------~l~~vfVD~GllR---knE~~~v~~~~~~~~~~~l  280 (520)
                      ..+.+++ -.+|...=|.||||.|||..|+...|-+.+       +|+..-|  ||=-   .--+.+|-+.+..   ..-
T Consensus       214 ~~~aV~KRLM~d~p~GvLLSGGLDSSLvAsia~R~lk~~~~~~~~~lhsFaI--Gle~SPDL~aarkVAd~igt---~Hh  288 (543)
T KOG0571         214 LEKAVRKRLMTDVPFGVLLSGGLDSSLVASIAARELKKAQAARGSKLHSFAI--GLEDSPDLLAARKVADFIGT---IHH  288 (543)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCHHHHHHHHHHHHHCC---CCE
T ss_conf             9999999863168615895077318999999999998766412787547885--28998537888999987488---523


Q ss_pred             EEEEHHHHHHHHHCCCC------CHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             99758899999966898------8899998875658999999997439970998646
Q gi|254780414|r  281 RVVDASERFIRKLKNIV------DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGT  331 (520)
Q Consensus       281 ~~vda~~~Fl~~L~gv~------DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGT  331 (520)
                      ...-..+.=+++|..|.      |+-.=|--++   +-...+.+++++ +++++-|-
T Consensus       289 e~~ft~qegidal~eVI~hLETYDvttIRastp---myLlsr~Ikk~g-vkmvlSGE  341 (543)
T KOG0571         289 EHTFTIQEGIDALDEVIYHLETYDVTTIRASTP---MYLLSRKIKKLG-VKMVLSGE  341 (543)
T ss_pred             EEEECHHHHHHHHHHHHEEEECCCCCEEECCCC---HHHHHHHHHHCC-EEEEEECC
T ss_conf             899758887778887742410134415861774---678999997655-28998157


No 210
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=87.13  E-value=1  Score=25.29  Aligned_cols=73  Identities=21%  Similarity=0.398  Sum_probs=46.3

Q ss_pred             CCEEEEE-------------ECCCCHHHHHHHHHHHCCCEEEEECCCC------------------CHHH----HHHCCC
Q ss_conf             8869999-------------8897057889988886594069852898------------------9889----972399
Q gi|254780414|r    7 SSKVLII-------------DFGSQFTQLIARRVRESKVYCEVIAFKN------------------ALDY----FKEQNP   51 (520)
Q Consensus         7 ~~~IlIl-------------DfGSQytqLIaRriRelgVyseI~P~~~------------------~~e~----i~~~~p   51 (520)
                      +.+|+||             ||++ . | -+..+|++|.-+.++.||-                  +.|.    +...+|
T Consensus       573 Kk~~lvlGSGp~RIGqgvEFDYc~-V-h-~~~aLr~~Gye~ImiN~NPETVSTDyD~sDrLYFEplt~E~Vm~I~e~E~~  649 (1089)
T TIGR01369       573 KKKVLVLGSGPNRIGQGVEFDYCC-V-H-AVLALREAGYETIMINYNPETVSTDYDTSDRLYFEPLTFEDVMNIIELEKP  649 (1089)
T ss_pred             CCEEEEECCCCEECCCCEEEHHHH-H-H-HHHHHHHCCCEEEEEECCCCCCCCCHHHHHHCCCCCCCCCCCEEHEEECCC
T ss_conf             856899878451406631205678-9-9-999998729959999778997436666510115876350310011000586


Q ss_pred             CEEEECCCCCCCCCCCCCCCCHHHHHCC-CCEEEECH
Q ss_conf             7999985388999999975376898089-98899778
Q gi|254780414|r   52 QAIILSGSPASSLDIDSPQIPKEILESN-IPLLGICY   87 (520)
Q Consensus        52 ~GIILSGGP~SV~d~~ap~~~~~I~~~~-iPILGICy   87 (520)
                      +|||.+=|=+     -+..+.+++-+.+ +||||-=.
T Consensus       650 ~GVIVq~GGQ-----tp~nlA~~L~~~GG~~iLGTS~  681 (1089)
T TIGR01369       650 EGVIVQFGGQ-----TPLNLAKELEEAGGVPILGTSP  681 (1089)
T ss_pred             CEEEEECCCH-----HHHHHHHHHHHCCCCEEECCCH
T ss_conf             6799974873-----2678999999708931736885


No 211
>PRK11574 hypothetical protein; Provisional
Probab=86.90  E-value=0.49  Score=27.62  Aligned_cols=57  Identities=19%  Similarity=0.232  Sum_probs=38.4

Q ss_pred             CCCCCHHHHHHCCCCEEEECCC-CCCCCCCCCCCC---CHHHHHCCCCEEEECHHHHH-HHH
Q ss_conf             2898988997239979999853-889999999753---76898089988997789999-899
Q gi|254780414|r   38 AFKNALDYFKEQNPQAIILSGS-PASSLDIDSPQI---PKEILESNIPLLGICYGQQI-MCQ   94 (520)
Q Consensus        38 P~~~~~e~i~~~~p~GIILSGG-P~SV~d~~ap~~---~~~I~~~~iPILGICyG~Ql-La~   94 (520)
                      ..|..++++...++++|||.|| |..-+-.+++.+   -++..+.+.+|-.||-|=|+ ++.
T Consensus        54 ~aD~~l~~v~~~~yD~ivlPGG~~ga~~L~~~~~v~~~lk~~~~~gK~iAAICAaP~~vL~~  115 (196)
T PRK11574         54 LADAPLVEVADGEYDVIVLPGGIKGAECFRDSPLLVETVKQFHRSGRIVAAICAAPATVLVP  115 (196)
T ss_pred             ECCCCHHHCCCCCCCEEECCCCCHHHHHHHHCHHHHHHHHHHHHCCCEEEEECHHHHHHHHH
T ss_conf             57867777782558889917880379998739899999999998799199982406999987


No 212
>KOG2303 consensus
Probab=86.49  E-value=0.43  Score=28.02  Aligned_cols=29  Identities=31%  Similarity=0.622  Sum_probs=23.4

Q ss_pred             HHHHHHCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             997650444036640564047799999986
Q gi|254780414|r  215 RIKEQVGNERVICAVSGGVDSTVAAFLIYE  244 (520)
Q Consensus       215 ~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~k  244 (520)
                      .+| ..|-.--++-|||||||+-+|++++-
T Consensus       343 yLR-Rs~~aGfflPLSGG~DSsatA~iV~s  371 (706)
T KOG2303         343 YLR-RSGQAGFFLPLSGGVDSSATAAIVYS  371 (706)
T ss_pred             HHH-HCCCCCEEEECCCCCCCHHHHHHHHH
T ss_conf             998-63887447764788640589999999


No 213
>COG4090 Uncharacterized protein conserved in archaea [Function unknown]
Probab=85.55  E-value=1.5  Score=24.12  Aligned_cols=70  Identities=31%  Similarity=0.475  Sum_probs=42.8

Q ss_pred             CHHHHHHHHHHHCCCEE------------EEECCCCCHHHHHHCC-CCEEEECCCCCCCCCCCCCCCCHHHHH--CCCCE
Q ss_conf             05788998888659406------------9852898988997239-979999853889999999753768980--89988
Q gi|254780414|r   18 QFTQLIARRVRESKVYC------------EVIAFKNALDYFKEQN-PQAIILSGSPASSLDIDSPQIPKEILE--SNIPL   82 (520)
Q Consensus        18 QytqLIaRriRelgVys------------eI~P~~~~~e~i~~~~-p~GIILSGGP~SV~d~~ap~~~~~I~~--~~iPI   82 (520)
                      -+.+|.+-.+|+..-|-            ++.++-..+++....| .+.++|-||-+-..-.-.|.-.+++++  .+.|+
T Consensus        40 PFAeL~~favRDke~~fipd~d~ek~rkl~~~d~G~ql~e~e~~n~aDvvVLlGGLaMP~~gv~~d~~kel~ee~~~kkl  119 (154)
T COG4090          40 PFAELLAFAVRDKEQYFIPDLDFEKARKLELTDHGYQLGEREELNSADVVVLLGGLAMPKIGVTPDDAKELLEELGNKKL  119 (154)
T ss_pred             CHHHHHHHHHHCHHEEECCCCCHHHHHEEEEECCCEECCCCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCE
T ss_conf             48999888850320044677586673224651243542775666644589997564467678997999999984389865


Q ss_pred             EEECH
Q ss_conf             99778
Q gi|254780414|r   83 LGICY   87 (520)
Q Consensus        83 LGICy   87 (520)
                      .|+||
T Consensus       120 iGvCf  124 (154)
T COG4090         120 IGVCF  124 (154)
T ss_pred             EEEEH
T ss_conf             87518


No 214
>PRK07334 threonine dehydratase; Provisional
Probab=85.16  E-value=3.2  Score=21.79  Aligned_cols=90  Identities=14%  Similarity=0.143  Sum_probs=52.7

Q ss_pred             HHHHCCCCEEEEECCC-CHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH-
Q ss_conf             7650444036640564-047799999986223-6569999738955156278999988623698579975889999996-
Q gi|254780414|r  217 KEQVGNERVICAVSGG-VDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKL-  293 (520)
Q Consensus       217 r~~vg~~kVi~~lSGG-VDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L-  293 (520)
                      +....+++|.|-|||| +|.+...-++.|++= +...+.|.=+===|.+.-.++.+.+.+ .+-|+.-++....|.+.- 
T Consensus       287 ~~~~~gk~Vv~vlsGGNiD~~~l~~ii~r~l~~~gr~~~~~v~ipd~PG~l~~~~~~i~~-~~ani~~i~h~r~~~~~~~  365 (399)
T PRK07334        287 PERFRGRKVGLVLCGGNIDTRLLANVLLRGLVRAGRLARLRVDIRDRPGALAKVTALIGE-AGANIIEVHHQRLFTTLPA  365 (399)
T ss_pred             HHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHH-CCCCEEEEEEEECCCCCCC
T ss_conf             166469819999686886988999999998885599899999888899679999999821-7997699998871577887


Q ss_pred             --------CCCCCHHHHHHHHH
Q ss_conf             --------68988899998875
Q gi|254780414|r  294 --------KNIVDPETKRKVIG  307 (520)
Q Consensus       294 --------~gv~DPE~KRkiIG  307 (520)
                              -.+.|+|...+++.
T Consensus       366 ~~~~v~~~~Et~~~~h~~~l~~  387 (399)
T PRK07334        366 KGAELELVIETRDAAHIQEVMA  387 (399)
T ss_pred             CEEEEEEEEEECCHHHHHHHHH
T ss_conf             7389999999399999999999


No 215
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]
Probab=82.68  E-value=4  Score=21.08  Aligned_cols=174  Identities=17%  Similarity=0.212  Sum_probs=92.6

Q ss_pred             CEEEEE-----ECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCC---CCCCCCHHH---H
Q ss_conf             869999-----88970578899888865940698528989889972399799998538899999---997537689---8
Q gi|254780414|r    8 SKVLII-----DFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI---DSPQIPKEI---L   76 (520)
Q Consensus         8 ~~IlIl-----DfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~---~ap~~~~~I---~   76 (520)
                      .||+|-     +|-  |-+++ +.+|++|.  ||++++--.++-...+.++|-|.||-=-++.+   ++....+.|   .
T Consensus       246 ~rIAVA~D~AF~Fy--Y~~nl-~~Lr~~GA--elv~FSPL~D~~lP~~~D~vYlgGGYPElfA~~L~~n~~~~~~i~~~~  320 (451)
T COG1797         246 VRIAVARDAAFNFY--YPENL-ELLREAGA--ELVFFSPLADEELPPDVDAVYLGGGYPELFAEELSANESMRRAIKAFA  320 (451)
T ss_pred             CEEEEEECCHHCCC--CHHHH-HHHHHCCC--EEEEECCCCCCCCCCCCCEEEECCCCHHHHHHHHHHCHHHHHHHHHHH
T ss_conf             36999854510003--29999-99997797--799857867777997788899689774889999844799999999998


Q ss_pred             HCCCCEEEECHHHHHHHHHC---CCEEE----------ECCCC--CCCEEEEEECCCCCCCCC-CCCCCCCEEEEEECCC
Q ss_conf             08998899778999989970---96999----------86986--610366752388622278-7266553368600220
Q gi|254780414|r   77 ESNIPLLGICYGQQIMCQSL---GGKTK----------NSQSR--EFGRAFIEIKKNCSLLKG-MWEKGSKQQVWMSHGD  140 (520)
Q Consensus        77 ~~~iPILGICyG~QlLa~~~---GG~V~----------~~~~~--EyG~~~I~i~~~~~lf~g-l~~~~~~~~VwmSH~D  140 (520)
                      ..+.||+|=|=|+-.|+..+   .|...          ++..|  -.|+........+.+... ..-..-.+     |.-
T Consensus       321 ~~G~piyaECGGlMYL~~~le~~~G~~~~M~Gvlp~~~~m~~Rl~~lGY~~~~~~~d~~~~~~G~~irGHEF-----HyS  395 (451)
T COG1797         321 AAGKPIYAECGGLMYLGESLEDADGDTYEMVGVLPGSTRMTKRLQALGYREAEAVDDTLLLRAGEKIRGHEF-----HYS  395 (451)
T ss_pred             HCCCCEEEECCCCEEEHHHEECCCCCEEEEEEEECCCHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEEEEE-----EEE
T ss_conf             769945885155112101204268966543300033013543343166069984377634568863663210-----300


Q ss_pred             HHHCCC-CCCCEEECCCCC---CEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             110124-442112323983---178898635001124652122215202577998755010
Q gi|254780414|r  141 QVEHIP-EGFEVIASSDST---PFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       141 ~V~~lP-~gf~viA~S~~~---~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                      .+...+ ..+-.-.....+   --.++...  +..+--.|   .|-.....+..+|+ .-|
T Consensus       396 ~~~~~~~~~~a~~~~~g~g~~~~~~G~~~g--nv~asY~H---~H~~s~~~~~~~~v-~~~  450 (451)
T COG1797         396 RLITEEDAEPAFRVRRGDGIDNGRDGYRSG--NVLASYLH---LHFASNPAFAARFV-AAA  450 (451)
T ss_pred             ECCCCCCCCEEEEEECCCCCCCCCCCEEEC--CEEEEEEE---EECCCCHHHHHHHH-HHH
T ss_conf             123577675103553255766665403667--76799875---51155889999999-731


No 216
>pfam08497 Radical_SAM_N Radical SAM N-terminal. This domain tends to occur to the N-terminus of the pfam04055 domain in hypothetical bacterial proteins.
Probab=80.90  E-value=3  Score=22.05  Aligned_cols=98  Identities=23%  Similarity=0.376  Sum_probs=63.9

Q ss_pred             HHCCCHHHHHHHHHHHHHCC------CCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC-CHHHHHHHHHHHHCCCCEE
Q ss_conf             22152025779987550106------4411140678999999997650444036640564-0477999999862236569
Q gi|254780414|r  179 VVHTVGGSQLIDNFVHHVAG------IQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGG-VDSTVAAFLIYEAIGINLT  251 (520)
Q Consensus       179 V~hT~~G~~iL~NFl~~Ic~------~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGG-VDStV~A~Ll~kAig~~l~  251 (520)
                      |.|--+|.-|+..+| +-.|      +.++|+...       .++ +.|.-+..+|+|+| +||-|+-.-..|-.  |-.
T Consensus        28 VDHPsFG~AiIgR~L-e~~GyrVgIIaQPdw~~~~-------df~-~lG~PrLffgVsaGn~DSMVn~YTa~kK~--R~~   96 (298)
T pfam08497        28 VDHPSFGMAIIGRVL-EAQGFRVGIIAQPDWRSDE-------DFK-RLGRPRLFFGVTAGNMDSMVNHYTADKKL--RSD   96 (298)
T ss_pred             CCCCCHHHHHHHHHH-HHCCCEEEEEECCCCCCHH-------HHH-HHCCCCEEEEECCCCHHHHHHHHCCCCCC--CCC
T ss_conf             568530689999999-9869659897189989847-------899-72998479886366488888761444443--454


Q ss_pred             EEEECCCCC--CCCCHHHH-----HHHHHHCCCCCEEE--EEHHHHHH
Q ss_conf             999738955--15627899-----99886236985799--75889999
Q gi|254780414|r  252 CVLVDHGFM--RKNEVENI-----ISLFKGYPNFPLRV--VDASERFI  290 (520)
Q Consensus       252 ~vfVD~Gll--RknE~~~v-----~~~~~~~~~~~l~~--vda~~~Fl  290 (520)
                      .-|--.|-.  |-+-+--|     .+.|+   +++++.  +.||-|=+
T Consensus        97 DaYtPgG~~g~RPDRA~iVY~n~~r~~f~---~vPiiiGGIEASLRR~  141 (298)
T pfam08497        97 DAYTPGGEGGKRPDRAVIVYTNRIREAFK---DVPVVIGGIEASLRRF  141 (298)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCCEEECCHHHHHHHH
T ss_conf             68698997888987025799999999869---9998971225766655


No 217
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain.  AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal.  AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=80.79  E-value=2.1  Score=23.05  Aligned_cols=55  Identities=15%  Similarity=0.353  Sum_probs=35.6

Q ss_pred             CCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH---HHCCCCEEEECHHHHHHHHH
Q ss_conf             8989889972399799998538899999997537689---80899889977899998997
Q gi|254780414|r   39 FKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEI---LESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        39 ~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I---~~~~iPILGICyG~QlLa~~   95 (520)
                      .+..+++.  ..++-+|+.||+........|.+..++   ...+..+.|||-|..+||.+
T Consensus        55 ~d~~~~~~--~~~D~livpgg~~~~~~~~~~~l~~~L~~~~~~~~~l~~ictG~~~LA~a  112 (187)
T cd03137          55 ADAGLDAL--AAADTVIVPGGPDVDGRPPPPALLAALRRAAARGARVASVCTGAFVLAEA  112 (187)
T ss_pred             CCCCHHHC--CCCCEEEECCCCCHHHCCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHC
T ss_conf             37653345--64699998898861102599999999999975386688753140988745


No 218
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus.   PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source.  Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=80.72  E-value=3.2  Score=21.78  Aligned_cols=57  Identities=7%  Similarity=0.218  Sum_probs=36.5

Q ss_pred             ECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCH---HHHHCCCCEEEECHHHHHHHHH
Q ss_conf             5289898899723997999985388999999975376---8980899889977899998997
Q gi|254780414|r   37 IAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPK---EILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        37 ~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~---~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +..+.++++.  .+++-+|+.||+........|.+..   .....+..+.+||-|.-+||.+
T Consensus        51 v~~d~~~~~~--~~~D~lvvpGg~~~~~~~~~~~l~~~Lr~~~~~g~~i~siCtGa~~LA~a  110 (183)
T cd03139          51 VLPDTSFADP--PDLDVLLVPGGGGTRALVNDPALLDFIRRQAARAKYVTSVCTGALLLAAA  110 (183)
T ss_pred             EECCCCHHHC--CCCCEEEECCCCCHHHHCCCHHHHHHHHHHHHCCCEEEEECHHHHHHHHC
T ss_conf             9605884466--75899998799874530489899999999876198389873767999974


No 219
>TIGR01184 ntrCD nitrate ABC transporter, ATP-binding proteins C and D; InterPro: IPR005890   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase. ; GO: 0015112 nitrate transmembrane transporter activity, 0015706 nitrate transport, 0016020 membrane.
Probab=79.95  E-value=4.2  Score=20.97  Aligned_cols=55  Identities=22%  Similarity=0.404  Sum_probs=37.1

Q ss_pred             CCEEEEEE--CCCCHH-------HHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCC
Q ss_conf             88699998--897057-------8899888865940698528989889972399799998538899
Q gi|254780414|r    7 SSKVLIID--FGSQFT-------QLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASS   63 (520)
Q Consensus         7 ~~~IlIlD--fGSQyt-------qLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV   63 (520)
                      .+++|+||  ||+=-.       .-+-+=..|..+.|.++.||.+-..+...  .-|.|+.||.|-
T Consensus       132 RP~~LlLDEPFGALDAlTr~~LQe~L~~I~~e~~~T~~MvTHDvDEAllLsD--R~VMlTnGP~a~  195 (230)
T TIGR01184       132 RPKVLLLDEPFGALDALTRGNLQEELLQIVEEARVTVVMVTHDVDEALLLSD--RVVMLTNGPAAK  195 (230)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHC--CEEEEECCCCCC
T ss_conf             7601231087405667526889999999873169748998524457888735--102430777422


No 220
>KOG2764 consensus
Probab=79.14  E-value=2.3  Score=22.89  Aligned_cols=62  Identities=23%  Similarity=0.304  Sum_probs=40.1

Q ss_pred             EEECCCCCHHHHHHCCCCEEEECCC-CCCCCCCCCCCC---CHHHHHCCCCEEEECHHHHHHHHHCCC
Q ss_conf             9852898988997239979999853-889999999753---768980899889977899998997096
Q gi|254780414|r   35 EVIAFKNALDYFKEQNPQAIILSGS-PASSLDIDSPQI---PKEILESNIPLLGICYGQQIMCQSLGG   98 (520)
Q Consensus        35 eI~P~~~~~e~i~~~~p~GIILSGG-P~SV~d~~ap~~---~~~I~~~~iPILGICyG~QlLa~~~GG   98 (520)
                      .++|-+ .+.+....+++.|||.|| |.+.+-.+.+.+   .++-.+.+.+|..||-|- +++.+-+|
T Consensus        53 ~~~~d~-~l~D~~~~~yDviilPGG~~g~e~L~~~~~v~~lvK~q~~~gkLIaaICaap-~~al~a~g  118 (247)
T KOG2764          53 HILPDN-ALFDVVDSKYDVIILPGGLPGAETLSECEKVVDLVKEQAESGKLIAAICAAP-LTALAAHG  118 (247)
T ss_pred             EECCCC-CCHHHCCCCCCEEEECCCCHHHHHHHHCHHHHHHHHHHHHCCCEEEEEECCH-HHHHHHCC
T ss_conf             762553-1012113566689946996056665306889999999875299699862056-98974165


No 221
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein.  This group includes proteins similar to S. cerevisiae Ydr533c.  Ydr533c is upregulated in response to various stress conditions along with the heat shock family.  The catalytic triad typical of GATase1domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. This Cys together with a different His and Glu residue form a different catalytic triad from the typical GATase1domain.  Ydr533c protein is a homodimer.
Probab=78.97  E-value=1.2  Score=24.80  Aligned_cols=57  Identities=14%  Similarity=0.262  Sum_probs=42.8

Q ss_pred             CCCCHHHHHHCCCCEEEECCCCCCCCC-CCCC---CCCHHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             898988997239979999853889999-9997---53768980899889977899998997
Q gi|254780414|r   39 FKNALDYFKEQNPQAIILSGSPASSLD-IDSP---QIPKEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        39 ~~~~~e~i~~~~p~GIILSGGP~SV~d-~~ap---~~~~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      ...+++++...++++|.+.||....+| .+++   ++-.++++.+.||-.||-|-=.|+.+
T Consensus        83 ~t~~l~~v~~~~YdaVf~pGGhG~m~Dl~~~~~l~~ll~~~~~~gk~vaaVCHGpaaLl~~  143 (231)
T cd03147          83 NIKKADEVNPDDYGIFFVAGGHGTLFDFPHATNLQKIAQQIYANGGVVAAVCHGPAILANL  143 (231)
T ss_pred             CCCCHHHCCHHHCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCHHHHHHHC
T ss_conf             7689568898782599988988530324239999999999997599799980688997616


No 222
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea. Catalysis of the enzymes proceeds via a Schiff-base mechanism like other class I aldolases, although this subfamily is clearly divergent based on sequence similarity to other class I and class II  (metal dependent) aldolase subfamilies.
Probab=77.82  E-value=2.3  Score=22.82  Aligned_cols=10  Identities=30%  Similarity=0.212  Sum_probs=3.9

Q ss_pred             CEEEEEECCC
Q ss_conf             5699997389
Q gi|254780414|r  249 NLTCVLVDHG  258 (520)
Q Consensus       249 ~l~~vfVD~G  258 (520)
                      .-.++.|+-|
T Consensus        91 daV~~~v~~G  100 (235)
T cd00958          91 DAVGVTVYVG  100 (235)
T ss_pred             CEEEEEEECC
T ss_conf             6799998689


No 223
>PRK08198 threonine dehydratase; Provisional
Probab=76.11  E-value=6.4  Score=19.68  Aligned_cols=90  Identities=17%  Similarity=0.216  Sum_probs=59.3

Q ss_pred             HHHHCCCCEEEEECCC-CHHHHHHHHHHHHC-CC-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHH-
Q ss_conf             7650444036640564-04779999998622-36-56999973895515627899998862369857997588999999-
Q gi|254780414|r  217 KEQVGNERVICAVSGG-VDSTVAAFLIYEAI-GI-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRK-  292 (520)
Q Consensus       217 r~~vg~~kVi~~lSGG-VDStV~A~Ll~kAi-g~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~-  292 (520)
                      +....+++|+|-+||| +|.++.+-.+.|++ ++ |+..+.|.- -=|-+.-.++.+.+.+. +-|+.-++....|..- 
T Consensus       293 ~~~~~gk~Vv~ilsGGNiD~~~l~~i~er~l~~~gr~~~~~v~i-~d~PG~l~~~~~~i~~~-~anI~~i~h~R~~~~~~  370 (406)
T PRK08198        293 KVKVRGKKVVAVLSGGNIDVLLLSRVIERGLVAAGRYLKLRVEL-PDRPGQLAKLLSIIAEL-RANVIDVDHDRFSPGLR  370 (406)
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEC-CCCCCHHHHHHHHHHHC-CCCEEEEEEEECCCCCC
T ss_conf             73347984999972578798999999999877659979999982-78996799999999757-99379999887257788


Q ss_pred             --------HCCCCCHHHHHHHHHH
Q ss_conf             --------6689888999988756
Q gi|254780414|r  293 --------LKNIVDPETKRKVIGQ  308 (520)
Q Consensus       293 --------L~gv~DPE~KRkiIG~  308 (520)
                              --.+.|+|..+.++..
T Consensus       371 ~~~~~v~~~iEt~~~~h~~~i~~~  394 (406)
T PRK08198        371 LGEVEVELTLETRGPEHIDEILAA  394 (406)
T ss_pred             CCEEEEEEEEEECCHHHHHHHHHH
T ss_conf             664899999992999999999999


No 224
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. This group includes the ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. They are members of the LacI-GalR family of repressor proteins which are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=75.65  E-value=6.5  Score=19.60  Aligned_cols=72  Identities=21%  Similarity=0.301  Sum_probs=44.8

Q ss_pred             EEEEECCCCH----HHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             9999889705----788998888659406985289898-------89972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQF----TQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQy----tqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      |++=|+..-|    -.-|.+..++.|....+.+.+.+.       +.+...+++|+|+.|...     ..+.....+.+.
T Consensus         4 vivp~~~n~f~~~~~~gi~~~a~~~gy~lll~~t~~~~~~e~~~i~~l~~~~vDGiIi~~~~~-----~~~~~~~~l~~~   78 (268)
T cd06289           4 LVINDLTNPFFAELAAGLEEVLEEAGYTVFLANSGEDVERQEQLLSTMLEHGVAGIILCPAAG-----TSPDLLKRLAES   78 (268)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----CCHHHHHHHHHC
T ss_conf             997899759999999999999998699899995899989999999999965999899946888-----999999999975


Q ss_pred             CCCEEEEC
Q ss_conf             99889977
Q gi|254780414|r   79 NIPLLGIC   86 (520)
Q Consensus        79 ~iPILGIC   86 (520)
                      ++|+.-|+
T Consensus        79 ~iPvV~i~   86 (268)
T cd06289          79 GIPVVLVA   86 (268)
T ss_pred             CCCEEEEC
T ss_conf             99899836


No 225
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=75.64  E-value=6.5  Score=19.60  Aligned_cols=71  Identities=14%  Similarity=0.223  Sum_probs=36.7

Q ss_pred             CCEEEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC--CCCEE
Q ss_conf             886999988-970578899888865940698528989889972399799998538899999997537689808--99889
Q gi|254780414|r    7 SSKVLIIDF-GSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES--NIPLL   83 (520)
Q Consensus         7 ~~~IlIlDf-GSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~--~iPIL   83 (520)
                      .+|++++|- +..|+.....+|++      ++         ...+++-||+.=     .++|.-...+.+++.  +.+|.
T Consensus        42 deK~aLIDtv~~~f~~e~l~~L~~------~i---------d~~~IDYIIvnH-----~EpDHSGsL~~Lle~~P~~~Iv  101 (479)
T PRK05452         42 EEKNVLIDTVDHKFSREFVQNLRM------EI---------DLADIDYIVINH-----AEEDHAGALTELMAQIPDTPIY  101 (479)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHH------HC---------CCCCCCEEEECC-----CCCCHHHHHHHHHHHCCCCEEE
T ss_conf             898899929976289999999997------45---------966798899689-----9975476899999988999999


Q ss_pred             EECHHHHHHHHHCC
Q ss_conf             97789999899709
Q gi|254780414|r   84 GICYGQQIMCQSLG   97 (520)
Q Consensus        84 GICyG~QlLa~~~G   97 (520)
                      +-=-|...|...+.
T Consensus       102 ~s~~a~~~l~~~~~  115 (479)
T PRK05452        102 CTANAIDSINGHHH  115 (479)
T ss_pred             ECHHHHHHHHHHHC
T ss_conf             87899999998527


No 226
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional
Probab=74.89  E-value=6.8  Score=19.47  Aligned_cols=72  Identities=15%  Similarity=0.242  Sum_probs=40.3

Q ss_pred             CCEEEEEEC-CCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC--CCCEE
Q ss_conf             886999988-970578899888865940698528989889972399799998538899999997537689808--99889
Q gi|254780414|r    7 SSKVLIIDF-GSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES--NIPLL   83 (520)
Q Consensus         7 ~~~IlIlDf-GSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~--~iPIL   83 (520)
                      .++++++|- ...|++.-..+|++      +++         ..+++=||+.-     .++|.-..-+.+++.  +..|.
T Consensus        40 ~ek~aLiDtv~~~f~~e~l~~l~~------vi~---------~~~IdYiVvnH-----~EPDHsg~l~~ll~~~p~~~vv   99 (395)
T PRK11921         40 DEKTVLIDTVWAPFAKEFVENLKK------EID---------LDKIDYIVANH-----GEIDHSGALPELMKEIPDTPIY   99 (395)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHH------HCC---------CCCCCEEEECC-----CCCCHHHHHHHHHHHCCCCEEE
T ss_conf             897899928984389999999996------459---------65699999389-----9975789999999988999999


Q ss_pred             EECHHHHHHHHHCCC
Q ss_conf             977899998997096
Q gi|254780414|r   84 GICYGQQIMCQSLGG   98 (520)
Q Consensus        84 GICyG~QlLa~~~GG   98 (520)
                      +-=-|.+.|-..++.
T Consensus       100 ~s~~~~~~l~~~~~~  114 (395)
T PRK11921        100 CTANGAKSLKGHYHQ  114 (395)
T ss_pred             ECHHHHHHHHHHHCC
T ss_conf             878999999987288


No 227
>PRK00955 hypothetical protein; Provisional
Probab=74.13  E-value=5.9  Score=19.91  Aligned_cols=48  Identities=25%  Similarity=0.329  Sum_probs=29.4

Q ss_pred             EECCCCHHHHHHHHHHHCCCEEEEEC-CC-CCHHHHHHC-CCC-EEEECCCC
Q ss_conf             98897057889988886594069852-89-898899723-997-99998538
Q gi|254780414|r   13 IDFGSQFTQLIARRVRESKVYCEVIA-FK-NALDYFKEQ-NPQ-AIILSGSP   60 (520)
Q Consensus        13 lDfGSQytqLIaRriRelgVyseI~P-~~-~~~e~i~~~-~p~-GIILSGGP   60 (520)
                      +|-=|==.-+|.|-+...|.-.-|++ +| .+.+.++.+ .|. +.-+|+|.
T Consensus        25 VDHPsFG~AiIgR~Le~~GyrVgIIaQPdw~~~~df~~lG~PrLffgVsaGn   76 (599)
T PRK00955         25 VDHPSFGTAIIGRVLEAEGFRVGIIAQPNWRDLEDFKKLGKPRLFFLVSAGN   76 (599)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCCEEEEECCCC
T ss_conf             5686404899999999769659897289989847799728985787764654


No 228
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=73.84  E-value=7.2  Score=19.29  Aligned_cols=55  Identities=22%  Similarity=0.375  Sum_probs=33.9

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEE-CCC----------------------CCHHHHHHCCCCEEEECCCCC
Q ss_conf             448869999889705788998888659406985-289----------------------898899723997999985388
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVI-AFK----------------------NALDYFKEQNPQAIILSGSPA   61 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~-P~~----------------------~~~e~i~~~~p~GIILSGGP~   61 (520)
                      ..-++|+|+|+|+      .-.+++|||.-.+. |..                      -++|.|...+|+-||.||--+
T Consensus        56 knPekVvv~D~ga------LD~ld~lGve~~~v~~~~~~P~yL~~y~~dky~nvGtlfEPD~Eai~a~kPdLIIiggR~a  129 (320)
T COG4607          56 KNPEKVVVLDLGA------LDTLDALGVEVVAVGPGKNLPAYLQKYKDDKYANVGTLFEPDYEAIAAAKPDLIIIGGRAA  129 (320)
T ss_pred             CCCCEEEEECCHH------HHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCEEEECCHHH
T ss_conf             8875589954115------6668872972022368778637899714678666675358788999744998899774777


Q ss_pred             CCCC
Q ss_conf             9999
Q gi|254780414|r   62 SSLD   65 (520)
Q Consensus        62 SV~d   65 (520)
                      --||
T Consensus       130 k~yd  133 (320)
T COG4607         130 KAYD  133 (320)
T ss_pred             HHHH
T ss_conf             7799


No 229
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1. Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1. This group includes, proteins similar to ES1, Escherichia coli enhancing lycopene biosynthesis protein 2, Azospirillum brasilense iaaC and, human HES1.  The catalytic triad typical of GATase1domains is not conserved in this GATase1-like domain. However, in common with GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. Zebrafish ES1 is expressed specifically in adult photoreceptor cells and appears to be a cytoplasmic protein. A. brasilense iaaC is involved in controlling IAA biosynthesis.
Probab=73.61  E-value=7.3  Score=19.25  Aligned_cols=57  Identities=19%  Similarity=0.389  Sum_probs=41.4

Q ss_pred             CCHHHHHHCCCCEEEECCCCCCC-----CCCC--CCCCCHH-------HHHCCCCEEEECHHHHHHHHHCC
Q ss_conf             89889972399799998538899-----9999--9753768-------98089988997789999899709
Q gi|254780414|r   41 NALDYFKEQNPQAIILSGSPASS-----LDID--SPQIPKE-------ILESNIPLLGICYGQQIMCQSLG   97 (520)
Q Consensus        41 ~~~e~i~~~~p~GIILSGGP~SV-----~d~~--ap~~~~~-------I~~~~iPILGICyG~QlLa~~~G   97 (520)
                      .++.+++..+++++|+.||-...     |..+  ...++++       ..+.++||=.||-.=-++|+.||
T Consensus        73 ~~l~~~~~~d~DaLiiPGGfGaAKNLs~fA~~g~~~~v~~~V~~~i~~f~~a~KPiG~iCIAP~l~a~vl~  143 (213)
T cd03133          73 KDLAKLKAADFDALIFPGGFGAAKNLSDFAVKGADCTVNPEVERLVREFHQAGKPIGAICIAPALAAKILG  143 (213)
T ss_pred             CCHHHCCHHHCCEEEECCCHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHHCCCCEEEECHHHHHHHHHCC
T ss_conf             56456998678989978851455531002105887569899999999999849999997578999999818


No 230
>PRK08813 threonine dehydratase; Provisional
Probab=73.22  E-value=3.7  Score=21.36  Aligned_cols=53  Identities=21%  Similarity=0.199  Sum_probs=29.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEE
Q ss_conf             44036640564047799999986223656999973895515627899998862369857997
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV  283 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~v  283 (520)
                      .+-|+|+ |.|=-. -+.++..+.+|-..+-+      |-.+-.+.-.+..+. +|-+++..
T Consensus        81 ~~GVV~a-SaGNHa-qavA~aA~~~gi~a~Iv------mP~~ap~~Ki~~~r~-~GA~Vi~~  133 (349)
T PRK08813         81 ERPVICA-SAGNHA-QGVAWSAYRLGVQAITV------MPHGAPQTKIAGVAH-WGATVRQH  133 (349)
T ss_pred             CCCEEEE-CCCHHH-HHHHHHHHHCCCCEEEE------ECCCCCHHHHHHHHH-CCCEEEEE
T ss_conf             7867998-864899-99999999869998999------689998999999997-29869995


No 231
>PRK05408 hypothetical protein; Provisional
Probab=72.51  E-value=2.1  Score=23.16  Aligned_cols=44  Identities=18%  Similarity=0.237  Sum_probs=29.3

Q ss_pred             HCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             199988942688898311122100036789999999999999999
Q gi|254780414|r  386 LRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEI  430 (520)
Q Consensus       386 Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l  430 (520)
                      |+-.-+=+.+.||||| ||-||...|.++-=+.=..-...+|+|-
T Consensus        10 ~~~e~~gL~~pP~PG~-lG~~I~~~vSk~AW~~W~~~QTmLINE~   53 (90)
T PRK05408         10 LQKEAEGLDFPPYPGE-LGKRIYENVSKEAWQEWLKHQTMLINEK   53 (90)
T ss_pred             HCCCCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             4685778999999968-8899999988999999999889997141


No 232
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=72.23  E-value=2.5  Score=22.60  Aligned_cols=105  Identities=24%  Similarity=0.392  Sum_probs=70.5

Q ss_pred             ECCCHH----HCCCCCCCEEECCCCCCEEEEEECCCCEEE----EEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             022011----012444211232398317889863500112----465212221520257799875501064411140678
Q gi|254780414|r  137 SHGDQV----EHIPEGFEVIASSDSTPFAFIADEKRKYYA----VQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSY  208 (520)
Q Consensus       137 SH~D~V----~~lP~gf~viA~S~~~~iaai~~~~~~iyG----VQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~  208 (520)
                      |||..|    .++|++..|+.....||=.-.+..-..=+|    +--|||-..+-.|..+-.-+...+-+-+..---..|
T Consensus       131 aHGfnI~~~~i~~r~di~V~MvAPK~PG~~VR~~y~~G~GvP~LiAvh~~~d~~g~~~~~a~aya~~~Gg~raGvlettF  210 (489)
T PRK05225        131 SHGFNIVEEGEQIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSF  210 (489)
T ss_pred             CCCCEEEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCEEECCH
T ss_conf             45650553123168886389975899964899998627997449997013598753899999999851897555363106


Q ss_pred             HHHHHHHHHHHHCCCCEEEE-------------ECCCCHHHHHHHHHHH
Q ss_conf             99999999765044403664-------------0564047799999986
Q gi|254780414|r  209 HKEIVSRIKEQVGNERVICA-------------VSGGVDSTVAAFLIYE  244 (520)
Q Consensus       209 ~~~~i~~Ir~~vg~~kVi~~-------------lSGGVDStV~A~Ll~k  244 (520)
                      .+++-.+   --|..-|+||             ++-|+|+.-++.|++-
T Consensus       211 ~~E~etD---LfGEQ~vLCG~lq~gsil~~~kmi~~g~~~~ya~kliq~  256 (489)
T PRK05225        211 VAEVKSD---LMGEQTILCGMLQAGSLLCFDKLVADGTDPAYAEKLIQF  256 (489)
T ss_pred             HHHHHHH---HHCCHHHHHHHHCCHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             8776643---210055543001101588788898726671578999986


No 233
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism]
Probab=72.09  E-value=4.9  Score=20.52  Aligned_cols=47  Identities=21%  Similarity=0.365  Sum_probs=33.0

Q ss_pred             EEEEEECCCCH--HHHHHHHH----HHCCCEEEEECCCCCHHHHHHCCCCEEEEC
Q ss_conf             69999889705--78899888----865940698528989889972399799998
Q gi|254780414|r    9 KVLIIDFGSQF--TQLIARRV----RESKVYCEVIAFKNALDYFKEQNPQAIILS   57 (520)
Q Consensus         9 ~IlIlDfGSQy--tqLIaRri----RelgVyseI~P~~~~~e~i~~~~p~GIILS   57 (520)
                      ++||+ |++++  |+-||+++    ||.|.-|+|.|...- .++...++++||+.
T Consensus         2 k~LIl-Ystr~GqT~kIA~~iA~~L~e~g~qvdi~dl~~~-~~~~l~~ydavVIg   54 (175)
T COG4635           2 KTLIL-YSTRDGQTRKIAEYIASHLRESGIQVDIQDLHAV-EEPALEDYDAVVIG   54 (175)
T ss_pred             CEEEE-EECCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH-HCCCHHHCCEEEEE
T ss_conf             16999-8347775899999999975541770565365654-02684117569982


No 234
>COG1628 Endonuclease V homolog [Replication, recombination, and repair]
Probab=71.64  E-value=8.1  Score=18.94  Aligned_cols=75  Identities=27%  Similarity=0.309  Sum_probs=48.5

Q ss_pred             CCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEH----HHHHHHHHCC-CCCHHHHHH
Q ss_conf             6404779999998622365-699997389551562789999886236985799758----8999999668-988899998
Q gi|254780414|r  231 GGVDSTVAAFLIYEAIGIN-LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDA----SERFIRKLKN-IVDPETKRK  304 (520)
Q Consensus       231 GGVDStV~A~Ll~kAig~~-l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda----~~~Fl~~L~g-v~DPE~KRk  304 (520)
                      +|.|+|.+..=+-++.+.. +.+||-|-=-.-=--.-.+...++. .++++.+|=.    -+++-++|+. ..|+|+++|
T Consensus        50 DG~D~T~~i~~~v~~~~~~~~rvVlLdGIt~aGFNivDi~~l~~~-tg~PVi~V~~k~P~~e~i~~Al~k~f~d~e~R~r  128 (185)
T COG1628          50 DGLDVTDAISDMVNRSKRRDLRVVLLDGITFAGFNIVDIEALYKE-TGLPVIVVYRKKPDIERIESALRKHFDDAEERIR  128 (185)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCEEEECCEEECCCEEECHHHHHHH-HCCCEEEEEECCCCHHHHHHHHHHHCCCHHHHHH
T ss_conf             682388999999998525561189987720305248428998876-1996899996379878999999975887999999


Q ss_pred             HH
Q ss_conf             87
Q gi|254780414|r  305 VI  306 (520)
Q Consensus       305 iI  306 (520)
                      +|
T Consensus       129 ii  130 (185)
T COG1628         129 II  130 (185)
T ss_pred             HH
T ss_conf             99


No 235
>PRK08526 threonine dehydratase; Provisional
Probab=71.29  E-value=8.2  Score=18.89  Aligned_cols=84  Identities=12%  Similarity=0.147  Sum_probs=45.3

Q ss_pred             CCCCEEEEECCC-CHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH-HHC--
Q ss_conf             444036640564-047799999986223-6-5699997389551562789999886236985799758899999-966--
Q gi|254780414|r  221 GNERVICAVSGG-VDSTVAAFLIYEAIG-I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR-KLK--  294 (520)
Q Consensus       221 g~~kVi~~lSGG-VDStV~A~Ll~kAig-~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~-~L~--  294 (520)
                      .+++|.|-|||| +|.+..+-++.+++= + |++.+.|+- ==|.+.-.++.+.+.+ .+-|+..+.....+.+ .+.  
T Consensus       294 ~gk~Vv~ilsGGNiD~~~l~~ii~r~l~~~gr~~~~~v~~-~d~pG~l~~~~~~i~~-~~~ni~~~~~~r~~~~~~~~~~  371 (403)
T PRK08526        294 KGAKIGVVLSGGNIDVQMLNVIIEKGLIKSYRKMKLHVTL-VDKPGALMGLTDILKI-ANANIVKIDYDRFSTKLDYGDA  371 (403)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEC-CCCCCHHHHHHHHHCC-CCCCEEEEEEEECCCCCCCCCE
T ss_conf             6997999971588898899999999888559989999986-8899679999999725-8995799998862577887736


Q ss_pred             ------CCCCHHHHHHHH
Q ss_conf             ------898889999887
Q gi|254780414|r  295 ------NIVDPETKRKVI  306 (520)
Q Consensus       295 ------gv~DPE~KRkiI  306 (520)
                            ...++|...+++
T Consensus       372 ~v~~~~Et~~~~h~~~l~  389 (403)
T PRK08526        372 NISITLETKGKEHQEEIR  389 (403)
T ss_pred             EEEEEEEECCHHHHHHHH
T ss_conf             999999949999999999


No 236
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=71.19  E-value=8.2  Score=18.87  Aligned_cols=83  Identities=23%  Similarity=0.389  Sum_probs=50.4

Q ss_pred             CCCCCCCCEEEEEECCC----C-----H--HHHHHHHHHHCCCEEEEECCCC------------------CHH----HHH
Q ss_conf             98634488699998897----0-----5--7889988886594069852898------------------988----997
Q gi|254780414|r    1 MHKRERSSKVLIIDFGS----Q-----F--TQLIARRVRESKVYCEVIAFKN------------------ALD----YFK   47 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGS----Q-----y--tqLIaRriRelgVyseI~P~~~------------------~~e----~i~   47 (520)
                      |.+...-.|||||-=|.    |     |  +| ..+.+||.|+...++.+|-                  +.+    -|.
T Consensus         1 MPkr~dikkvLiiGsGpi~IGqa~EfDysg~q-A~~aLkeeG~~vvlvN~NPaTi~TD~~~ad~vY~ePlt~e~v~~Ii~   79 (1068)
T PRK12815          1 MPKRTDIKKILVIGSGPIIIGQAAEFDYSGTQ-ACKALKEEGYQVVLVNPNPATIMTDPEPADTVYFEPLTLEFVKRIIR   79 (1068)
T ss_pred             CCCCCCCCEEEEECCCCCHHCCHHHHHHHHHH-HHHHHHHCCCEEEEECCCCCHHHCCCCCCCEEEECCCCHHHHHHHHH
T ss_conf             98867788899989881531234465656999-99999986998999889832620898744437885898999999999


Q ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCHHHHH------CCCCEEEECHHH
Q ss_conf             239979999853889999999753768980------899889977899
Q gi|254780414|r   48 EQNPQAIILSGSPASSLDIDSPQIPKEILE------SNIPLLGICYGQ   89 (520)
Q Consensus        48 ~~~p~GIILSGGP~SV~d~~ap~~~~~I~~------~~iPILGICyG~   89 (520)
                      ..+|+||+.+=|-.     .+..+..++.+      .++++||.-.-.
T Consensus        80 ~E~Pd~il~~~GGq-----taLnla~~L~~~GiL~k~~v~llGt~~~~  122 (1068)
T PRK12815         80 REKPDALLATLGGQ-----TALNLAVKLLEAGILEQYGVELLGTNVEA  122 (1068)
T ss_pred             HHCCCEEEECCCCH-----HHHHHHHHHHHCCCHHHCCCEEECCCHHH
T ss_conf             74999898677784-----79999999997597786596496799999


No 237
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31). Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31).  This group includes proteins similar to EcHsp31.  EcHsp31 has chaperone activity.  EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A.   The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. This Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain.  EcHsp31 is a homodimer.
Probab=70.83  E-value=2.8  Score=22.25  Aligned_cols=48  Identities=10%  Similarity=0.252  Sum_probs=35.9

Q ss_pred             HHCCCCEEEECCCCCCCCC-CCCC---CCCHHHHHCCCCEEEECHHHHHHHH
Q ss_conf             7239979999853889999-9997---5376898089988997789999899
Q gi|254780414|r   47 KEQNPQAIILSGSPASSLD-IDSP---QIPKEILESNIPLLGICYGQQIMCQ   94 (520)
Q Consensus        47 ~~~~p~GIILSGGP~SV~d-~~ap---~~~~~I~~~~iPILGICyG~QlLa~   94 (520)
                      ...++++|.+.||....+| .+.+   ++..++++.+.||-.+|-|-=.|..
T Consensus        93 d~~~Ydavf~pGGHG~m~Dl~~~~~l~~ll~~~~~~gk~vaaVCHGpaaLl~  144 (232)
T cd03148          93 DDSEYAAVFIPGGHGALIGIPESQDVAAALQWAIKNDRFVITLCHGPAAFLA  144 (232)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCHHHHHHC
T ss_conf             8422228996799753057757999999999999859979998674798740


No 238
>pfam03358 FMN_red NADPH-dependent FMN reductase.
Probab=70.18  E-value=8.7  Score=18.72  Aligned_cols=34  Identities=29%  Similarity=0.393  Sum_probs=13.2

Q ss_pred             EEEEECCCCHHH-HHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             366405640477-99999986223656999973895
Q gi|254780414|r  225 VICAVSGGVDST-VAAFLIYEAIGINLTCVLVDHGF  259 (520)
Q Consensus       225 Vi~~lSGGVDSt-V~A~Ll~kAig~~l~~vfVD~Gl  259 (520)
                      .+++.|||-... .+...+...+. .+.++.+..+.
T Consensus       105 ~~i~~~~g~~g~~~~~~~l~~~l~-~~g~~~~~~~~  139 (147)
T pfam03358       105 AIVSVSGGRSGGLRALEHLRQVLA-ELGAVVVPSGV  139 (147)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHHH-HCCCEECCCCE
T ss_conf             999989970458999999999999-87999867667


No 239
>COG2247 LytB Putative cell wall-binding domain [Cell envelope biogenesis, outer membrane]
Probab=69.91  E-value=8.8  Score=18.68  Aligned_cols=61  Identities=23%  Similarity=0.318  Sum_probs=42.7

Q ss_pred             HHHHHHHHH-CCCEEEEECCCC----CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             889988886-594069852898----98899723997999985388999999975376898089988997
Q gi|254780414|r   21 QLIARRVRE-SKVYCEVIAFKN----ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        21 qLIaRriRe-lgVyseI~P~~~----~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      +++|-.+-| ++.-..+-||+.    ..+++.++||+-|++=|||..|    +|.+..++-+.|+++.-|
T Consensus        41 ~~lA~~iaellNA~Vlttpwg~ynes~~~eI~~lnpd~VLIIGGp~AV----s~~yE~~Lks~GitV~Ri  106 (337)
T COG2247          41 LLLALPIAELLNAPVLTTPWGIYNESVLDEIIELNPDLVLIIGGPIAV----SPNYENALKSLGITVKRI  106 (337)
T ss_pred             HHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCC----CHHHHHHHHHCCCEEEEE
T ss_conf             887567999758905726754213999999996198659997898757----865899998579579993


No 240
>pfam09897 DUF2124 Uncharacterized protein conserved in archaea (DUF2124). This domain, found in various hypothetical archaeal proteins, has no known function.
Probab=68.49  E-value=4.6  Score=20.71  Aligned_cols=80  Identities=23%  Similarity=0.413  Sum_probs=43.2

Q ss_pred             CCCCEEEEEECCC-----CHHHHHHHHHHHCCCEEEEECCCCCH----------------HHHHHCCCCEEEECCCCCCC
Q ss_conf             4488699998897-----05788998888659406985289898----------------89972399799998538899
Q gi|254780414|r    5 ERSSKVLIIDFGS-----QFTQLIARRVRESKVYCEVIAFKNAL----------------DYFKEQNPQAIILSGSPASS   63 (520)
Q Consensus         5 ~~~~~IlIlDfGS-----QytqLIaRriRelgVyseI~P~~~~~----------------e~i~~~~p~GIILSGGP~SV   63 (520)
                      ...++|+-  .||     -+.+|.+-.||+.....--+|. ..+                ++....+|+.++|-||=+-.
T Consensus        17 ~~~~kIvf--~Gs~GvC~PFaeL~~yaIR~~~~e~~FiP~-~~~e~a~~i~~~~~G~q~~~~~~~~~~D~lVlmGGLAMP   93 (147)
T pfam09897        17 KDGEKIVY--YGSPGVCTPFAELFGYAIRDTVLEQYFIPD-TDEEKARKIEVTDVGMQVLGENTDLNPDVLVLLGGLAMP   93 (147)
T ss_pred             CCCCEEEE--ECCCEEECCHHHHHEEEEECCCCCEEECCC-CCHHHCEEEEECCCCEEECCCCCCCCCCEEEEECCCCCC
T ss_conf             58867999--789853326696521132046665487678-896682288735873377177678999899996765579


Q ss_pred             CCCCCCCCCHHHHH--CCCCEEEECH
Q ss_conf             99999753768980--8998899778
Q gi|254780414|r   64 LDIDSPQIPKEILE--SNIPLLGICY   87 (520)
Q Consensus        64 ~d~~ap~~~~~I~~--~~iPILGICy   87 (520)
                      .-.-.|.-.+++.+  ....|.||||
T Consensus        94 ~~~vt~e~v~~li~k~~~~kviGvCF  119 (147)
T pfam09897        94 KSGVTPEDVKELIEKLNPKKVIGVCF  119 (147)
T ss_pred             CCCCCHHHHHHHHHHCCCCCEEEEEH
T ss_conf             99989999999999649987899974


No 241
>PRK06382 threonine dehydratase; Provisional
Probab=68.14  E-value=9.5  Score=18.43  Aligned_cols=87  Identities=14%  Similarity=0.216  Sum_probs=51.7

Q ss_pred             HHCCCCEEEEECCC-CHHHHHHHHHHHHCC-C-CEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH--
Q ss_conf             50444036640564-047799999986223-6-569999738955156278999988623698579975889999996--
Q gi|254780414|r  219 QVGNERVICAVSGG-VDSTVAAFLIYEAIG-I-NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKL--  293 (520)
Q Consensus       219 ~vg~~kVi~~lSGG-VDStV~A~Ll~kAig-~-~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L--  293 (520)
                      ...+++|.|-|||| +|.+..+-++.|++- + |+.-+.|+- ==|-+.-.++.+.+.+ .+.|+..+.-...|.+.-  
T Consensus       290 ~~~gk~Vv~vlsGGNiD~~~l~~ii~r~l~~~gr~~~~~v~i-~d~pG~L~~~~~~i~~-~~~ni~~i~~~r~~~~~~~~  367 (400)
T PRK06382        290 DVKGKKVAIVVSGGNINPLLMSKIIYKELENLGQLVRIECNI-PDRPGNLYRIANAIAS-NGGNIYHAEVDNLRKETPPG  367 (400)
T ss_pred             HHCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEC-CCCCCHHHHHHHHHHC-CCCCEEEEEEEEECCCCCCC
T ss_conf             537984999963788797899999999888639979999986-8899779999999706-89957999987602557876


Q ss_pred             -------CCCCCHHHHHHHHH
Q ss_conf             -------68988899998875
Q gi|254780414|r  294 -------KNIVDPETKRKVIG  307 (520)
Q Consensus       294 -------~gv~DPE~KRkiIG  307 (520)
                             -.+.|+|...+|+.
T Consensus       368 ~~~v~~~iEt~~~~h~~~i~~  388 (400)
T PRK06382        368 FQSVTFTVNVRGQDHLDRILN  388 (400)
T ss_pred             EEEEEEEEEECCHHHHHHHHH
T ss_conf             268999998099999999999


No 242
>PRK07226 fructose-bisphosphate aldolase; Provisional
Probab=67.82  E-value=7.4  Score=19.22  Aligned_cols=19  Identities=26%  Similarity=0.298  Sum_probs=7.0

Q ss_pred             CEEEEEECCCCCCCCCHHHHH
Q ss_conf             569999738955156278999
Q gi|254780414|r  249 NLTCVLVDHGFMRKNEVENII  269 (520)
Q Consensus       249 ~l~~vfVD~GllRknE~~~v~  269 (520)
                      .-.++.|.-|-  .+|.+.+.
T Consensus       108 daV~~~v~~Gs--~~E~~~l~  126 (266)
T PRK07226        108 DAVSVHVNVGS--ETEAEMLE  126 (266)
T ss_pred             CEEEEEEECCC--CCHHHHHH
T ss_conf             78999854799--83799999


No 243
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Ubiquitin-E1 is a single-chain protein with a weakly conserved two-fold repeat. This CD represents the first repeat of Ub-E1.
Probab=66.92  E-value=5.8  Score=19.98  Aligned_cols=66  Identities=17%  Similarity=0.113  Sum_probs=42.2

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCE-EEECHHH
Q ss_conf             788998888659406985289898899723997999985388999999975376898089988-9977899
Q gi|254780414|r   20 TQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPL-LGICYGQ   89 (520)
Q Consensus        20 tqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPI-LGICyG~   89 (520)
                      ....+.|++|||=+++|-..+...++-...+.+.||++.-+.    +..-+++...-+.++|. .+=|+|+
T Consensus        75 a~~~~~~l~~lNp~v~v~~~~~~~~~~~~~~fdvVv~t~~~~----~~~~~iN~~cR~~~i~Fi~~~~~G~  141 (286)
T cd01491          75 AEASQARLAELNPYVPVTVSTGPLTTDELLKFQVVVLTDASL----EDQLKINEFCHSPGIKFISADTRGL  141 (286)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCHHHHCCCCEEEEECCCH----HHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             999999999648982589635777888853888899918998----9999998888775981999505775


No 244
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092   Members of this family are examples of pyruvate oxidase (1.2.3.3 from EC), an enzyme with FAD and TPP as cofactors that catalyses the reaction pyruvate + phosphate + O2 + H2O = acetyl phosphate + CO2 + H2O2. It should not be confused with pyruvate dehydrogenase (1.2.2.2 from EC) as in Escherichia coli PoxB, although the E. coli enzyme is closely homologous and has pyruvate oxidase as an alternate name..
Probab=66.40  E-value=5.5  Score=20.13  Aligned_cols=139  Identities=12%  Similarity=0.164  Sum_probs=86.7

Q ss_pred             CCEEEE-CCCCCCCCCCCCCCCCHHHHHC---CCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEEC-----CCCCC
Q ss_conf             979999-8538899999997537689808---99889977899998997096999869866103667523-----88622
Q gi|254780414|r   51 PQAIIL-SGSPASSLDIDSPQIPKEILES---NIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-----KNCSL  121 (520)
Q Consensus        51 p~GIIL-SGGP~SV~d~~ap~~~~~I~~~---~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~-----~~~~l  121 (520)
                      --||=+ |+||+      +-++..-+++.   ++|+|.|          .|         .++++.++.+     +..|+
T Consensus        63 kIGVafGSAGPG------AvhLlNGlYDA~eD~vP~LAl----------vG---------q~~~~~mNmD~FQe~ne~Pi  117 (577)
T TIGR02720        63 KIGVAFGSAGPG------AVHLLNGLYDAKEDHVPVLAL----------VG---------QVPTTEMNMDAFQEMNEEPI  117 (577)
T ss_pred             CEEEEEECCCCH------HHHHHHHHHHHHHCCCCEEEE----------EC---------CCCCCCCCHHHHHHHHCCCC
T ss_conf             338985178731------454431111132168850442----------40---------33666563068888504886


Q ss_pred             CCCCCCCCCCEEEEEECCCHHHCCC---CCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCC
Q ss_conf             2787266553368600220110124---4421123239831788986350011246521222152025779987550106
Q gi|254780414|r  122 LKGMWEKGSKQQVWMSHGDQVEHIP---EGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAG  198 (520)
Q Consensus       122 f~gl~~~~~~~~VwmSH~D~V~~lP---~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~  198 (520)
                      |+++...+.+.       =.-+.||   +..--.|.+.++ +|.++.+..  ||.|==||-.            -+.-+.
T Consensus       118 f~DvAvyN~t~-------~~Ae~LP~v~DeAiR~Ay~~~G-vAVv~IP~d--fG~~eI~~~~------------y~~as~  175 (577)
T TIGR02720       118 FDDVAVYNRTV-------MTAESLPKVIDEAIRAAYAHNG-VAVVTIPVD--FGWQEIPDND------------YYAASV  175 (577)
T ss_pred             CCCCCCCCCEE-------CCCCCCCCHHHHHHHHHHHHCC-CEEEECCCC--CCCCCCCCCC------------CCCCCC
T ss_conf             47701010000-------2621067057899999985079-889985787--7843155434------------433445


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCC--CEEEEECCCCHHH
Q ss_conf             4411140678999999997650444--0366405640477
Q gi|254780414|r  199 IQDNWVMSSYHKEIVSRIKEQVGNE--RVICAVSGGVDST  236 (520)
Q Consensus       199 ~~~~W~~~~~~~~~i~~Ir~~vg~~--kVi~~lSGGVDSt  236 (520)
                      -.+....-..-++.|..+-+.+.+-  -||-.--|+++-+
T Consensus       176 ~~~~~~~P~~~~~~v~~~~~~l~aA~~P~iY~G~Ga~~A~  215 (577)
T TIGR02720       176 SEKLVLLPAPDEEEVKKAVKLLKAAKRPVIYVGVGARKAG  215 (577)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHH
T ss_conf             4111458887888999999999841897699830752478


No 245
>cd01425 RPS2 Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome. It has been shown that in Escherichia coli RPS2 is essential for the binding of ribosomal protein S1 to the 30s ribosomal subunit. In humans, most likely in all vertebrates, and perhaps in all metazoans, the protein also functions as the 67 kDa laminin receptor (LAMR1 or 67LR), which is formed from a 37 kDa precursor, and is overexpressed in many tumors. 67LR is a cell surface receptor which interacts with a variety of ligands, laminin-1 and others. It is assumed that the ligand interactions are mediated via the conserved C-terminus, which becomes extracellular as the protein undergoes conformational changes which are not well understood. Specifically, a conserved palindromic motif, LMWWML, may participate in the interactions. 67LR plays essential roles in the adhesion of cells to the basement membrane an
Probab=66.37  E-value=10  Score=18.20  Aligned_cols=26  Identities=12%  Similarity=0.202  Sum_probs=11.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCC
Q ss_conf             88699998897057889988886594
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESKV   32 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelgV   32 (520)
                      ..+||++.--.|+..+|...-+..+.
T Consensus        56 ~g~ILfVgtk~~~~~~v~~~a~~~~~   81 (193)
T cd01425          56 GGKILFVGTKPQAQRAVKKFAERTGS   81 (193)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             99599997578999999999998399


No 246
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional
Probab=64.99  E-value=11  Score=18.02  Aligned_cols=58  Identities=17%  Similarity=0.297  Sum_probs=41.6

Q ss_pred             CCHHHHHHCCCCEEEECCCCCCC-----CCCC--CCCCCHH-------HHHCCCCEEEECHHHHHHHHHCCC
Q ss_conf             89889972399799998538899-----9999--9753768-------980899889977899998997096
Q gi|254780414|r   41 NALDYFKEQNPQAIILSGSPASS-----LDID--SPQIPKE-------ILESNIPLLGICYGQQIMCQSLGG   98 (520)
Q Consensus        41 ~~~e~i~~~~p~GIILSGGP~SV-----~d~~--ap~~~~~-------I~~~~iPILGICyG~QlLa~~~GG   98 (520)
                      .++.+++..+++++|+.||-..+     |..+  ...++++       ....++||=.||-.--+++..||-
T Consensus        76 ~~l~~~~~~d~DaLI~PGGfGaAKNLs~fA~~G~~~~V~p~V~~~i~~f~~a~KPiG~iCIaP~l~a~vl~~  147 (217)
T PRK11780         76 KDLAEADAEDFDALIVPGGFGAAKNLSNFAFKGAECSVDPEVKALARAFHQAGKPIGFICIAPAMLPKILGE  147 (217)
T ss_pred             CCHHHCCHHHCCEEEECCCCHHHHCCCCHHHCCCCCEECHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCC
T ss_conf             674569975678799678620443110165349986487899999999998099989860768999997288


No 247
>KOG2946 consensus
Probab=64.16  E-value=6.2  Score=19.75  Aligned_cols=54  Identities=31%  Similarity=0.392  Sum_probs=39.2

Q ss_pred             EEEEECCCC--HHHHHC-CCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC-CCCEEE
Q ss_conf             344302320--113203-202237898738999999998199988942688898-311122
Q gi|254780414|r  350 IKSHHNVGG--LPEHMD-MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG-PGLAIR  406 (520)
Q Consensus       350 IKsHHNvgg--lp~~~~-~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG-PGLaiR  406 (520)
                      =++--|-|+  +-+.-. ..+=||+++--|-++|++|..|.   ..++-||.|+ +|-++|
T Consensus        39 ~~~~~nsg~g~~~~~~e~dTldePv~~TlkrDl~~I~~kl~---~VlyP~py~~dk~~~lR   96 (234)
T KOG2946          39 GNSAGNSGFGWLLEVNEEDTLDEPVLETLKRDLRAIGSKLK---HVLYPHPYFEDKGQLLR   96 (234)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCEE---EEECCCCCCCCCCCEEE
T ss_conf             66345667531026688885410699999889999876057---99715888665310010


No 248
>PRK10717 cysteine synthase A; Provisional
Probab=63.62  E-value=11  Score=17.84  Aligned_cols=48  Identities=25%  Similarity=0.336  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHHHHHHH-HHHHC--CCCEEEEEECCCC
Q ss_conf             99999997650444036640564047799999-98622--3656999973895
Q gi|254780414|r  210 KEIVSRIKEQVGNERVICAVSGGVDSTVAAFL-IYEAI--GINLTCVLVDHGF  259 (520)
Q Consensus       210 ~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~L-l~kAi--g~~l~~vfVD~Gl  259 (520)
                      ++.+.-.|.-..++.++++.|+|.  +++|++ +.+-+  |+++.|||=|+|.
T Consensus       259 ~ea~~~~~~L~~~eGi~vg~Ssga--~~aaa~~~~~~~~~g~~VV~Il~D~G~  309 (334)
T PRK10717        259 EEALSIAYRLLEEEGLCLGGSSGI--NVAAAVRLARELGPGHTIVTILCDSGE  309 (334)
T ss_pred             HHHHHHHHHHHHHHCCEECHHHHH--HHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             999999999999839677307999--999999999870986979999798974


No 249
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. This group contains proteins similar to the extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB.  Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Cyanophycinase is believed to be a serine-type exopeptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow.
Probab=62.83  E-value=12  Score=17.75  Aligned_cols=92  Identities=10%  Similarity=0.213  Sum_probs=57.0

Q ss_pred             CCCCEEEEEECCCC----HHHHHHHHHHHCCCEE-EEECCCC-----CHHHH-HHCCCCEEEECCCCCCCC----C-CCC
Q ss_conf             44886999988970----5788998888659406-9852898-----98899-723997999985388999----9-999
Q gi|254780414|r    5 ERSSKVLIIDFGSQ----FTQLIARRVRESKVYC-EVIAFKN-----ALDYF-KEQNPQAIILSGSPASSL----D-IDS   68 (520)
Q Consensus         5 ~~~~~IlIlDfGSQ----ytqLIaRriRelgVys-eI~P~~~-----~~e~i-~~~~p~GIILSGGP~SV~----d-~~a   68 (520)
                      ..+.+|+++.-.|.    |...-....+.+|+.. ++++.+.     +.+.+ .-.+.++|.++||-.+-+    . ...
T Consensus        27 ~~~~ri~viptAs~~~~~~~~~~~~~f~~lG~~~v~~l~~~~r~~a~~~~~~~~l~~a~~i~~~GG~q~~~~~~~~~t~~  106 (217)
T cd03145          27 GAGARIVVIPAASEEPAEVGEEYRDVFERLGAREVEVLVIDSREAANDPEVVARLRDADGIFFTGGDQLRITSALGGTPL  106 (217)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCHHHHHHHHCCCEEEECCCCHHHHHHHHHCCCH
T ss_conf             99875999858878859999999999998399950598226835448989999996499899938999999999963969


Q ss_pred             CCCCHHHHHCCCCEEEECHHHHHHHHHC
Q ss_conf             7537689808998899778999989970
Q gi|254780414|r   69 PQIPKEILESNIPLLGICYGQQIMCQSL   96 (520)
Q Consensus        69 p~~~~~I~~~~iPILGICyG~QlLa~~~   96 (520)
                      ...-++.++.+.|+.|.-=|+-+|+...
T Consensus       107 ~~~l~~~~~~G~vi~G~SAGA~~~~~~~  134 (217)
T cd03145         107 LDALRKVYRGGVVIGGTSAGAAVMSDTM  134 (217)
T ss_pred             HHHHHHHHHCCCEEEECCHHHHHHHHHC
T ss_conf             9999999986994884117888745421


No 250
>PRK01254 hypothetical protein; Provisional
Probab=62.77  E-value=12  Score=17.74  Aligned_cols=42  Identities=17%  Similarity=0.213  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHCCCEEEEEC-CC-CCHHHHHHC-CCC-EEEECCCCC
Q ss_conf             7889988886594069852-89-898899723-997-999985388
Q gi|254780414|r   20 TQLIARRVRESKVYCEVIA-FK-NALDYFKEQ-NPQ-AIILSGSPA   61 (520)
Q Consensus        20 tqLIaRriRelgVyseI~P-~~-~~~e~i~~~-~p~-GIILSGGP~   61 (520)
                      .-+|.|-+...|.-.-|++ +| .+.+.++.+ .|. +.-+|+|..
T Consensus        57 ~AiIgR~LE~~GfrVGIIaQPdW~~~~df~~LG~PrLffgVtaGnm  102 (742)
T PRK01254         57 MAIIGRMLEAQGFRVGIIAQPDWSSKDDFMRLGKPNLFFGVTAGNM  102 (742)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCCEEEEECCCCH
T ss_conf             8999999998696598971799998588997289847888636548


No 251
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237   This family of conserved hypothetical proteins has no known function. Homologous proteins related to MJ0570 of Methanococcus jannaschii include both the apparent orthologs in the family, the much longer protein YLR143W from Saccharomyces cerevisiae (Baker's yeast), and second homologous proteins from Archaeoglobus fulgidus and Pyrococcus horikoshii that appear to represent a second orthologous group..
Probab=62.22  E-value=8.2  Score=18.89  Aligned_cols=113  Identities=21%  Similarity=0.296  Sum_probs=68.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC-----CEEEEEECCC--CCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCC
Q ss_conf             0366405640477999999862236-----5699997389--55156278999988623698579975889999996689
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGI-----NLTCVLVDHG--FMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI  296 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~-----~l~~vfVD~G--llRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv  296 (520)
                      ||=...|||=||+.|   ||+|+.+     -|..|+=||-  .|=+==--...++..+-.|+||+        =..-+|+
T Consensus         2 kvAvLySGGKDS~~A---Ly~al~eG~eV~~LV~v~seN~eSyMfH~pN~Hl~~l~AEavGiPL~--------klyt~Ge   70 (227)
T TIGR00289         2 KVAVLYSGGKDSILA---LYKALEEGFEVKYLVGVISENEESYMFHVPNVHLTDLVAEAVGIPLI--------KLYTSGE   70 (227)
T ss_pred             EEEEEECCCHHHHHH---HHHHHHCCCCEEEEEEEECCCCCCCEEECHHHHHHHHHHHHCCCCHH--------HHHCCCC
T ss_conf             068985187136899---99998628854785100028898620534257899999976176625--------6302786


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             88899998875658999999997439--97099864622024542024677763034430232011320320223789
Q gi|254780414|r  297 VDPETKRKVIGQLFIEVFEEEAKKIG--GAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       297 ~DPE~KRkiIG~~Fi~vf~~~a~~~~--~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      .+-|          ++-.-....++.  +++=+..|.+|..-=.|         -|-      -..+.+.+|.+-||=
T Consensus        71 eEkE----------VedLag~l~~lderGvea~~~Ga~~S~YQK~---------Rid------~vCrelGlks~APLW  123 (227)
T TIGR00289        71 EEKE----------VEDLAGQLEELDERGVEAVVIGAIESEYQKS---------RID------KVCRELGLKSIAPLW  123 (227)
T ss_pred             CCCH----------HHHHHHHHHHHHHCCCCEEEECCEECCHHHH---------HHH------HHHHHHCCHHCCCCC
T ss_conf             5211----------7666215544553054547885341011233---------577------887771410027601


No 252
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=61.88  E-value=12  Score=17.63  Aligned_cols=75  Identities=15%  Similarity=0.190  Sum_probs=44.4

Q ss_pred             HHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCC-CC-----CCHHHHHHHHH
Q ss_conf             1101244421123239831788986350011246521222152025779987550106441-11-----40678999999
Q gi|254780414|r  141 QVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQD-NW-----VMSSYHKEIVS  214 (520)
Q Consensus       141 ~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~-~W-----~~~~~~~~~i~  214 (520)
                      .|.++-++|..-|.         .-.+--+=|||-|=     -+| -+|..|+....+-.. .|     +--.|.-+.++
T Consensus       144 eI~~ii~~f~~AA~---------rA~~AGfDgVEIHa-----ahG-YLl~qFlSp~~N~RtDeYGGS~enR~Rf~~Eii~  208 (370)
T cd02929         144 DIKRVRRWYVDAAL---------RARDAGFDIVYVYA-----AHG-YLPLQFLLPRYNKRTDEYGGSLENRARFWRETLE  208 (370)
T ss_pred             HHHHHHHHHHHHHH---------HHHHCCCCEEEECC-----CCC-HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999999---------99985989899771-----135-5999734774578777468988999899999999


Q ss_pred             HHHHHHCCCC-EEEEEC
Q ss_conf             9976504440-366405
Q gi|254780414|r  215 RIKEQVGNER-VICAVS  230 (520)
Q Consensus       215 ~Ir~~vg~~k-Vi~~lS  230 (520)
                      .||+.||++. |.+-+|
T Consensus       209 aVr~~vg~df~i~~R~s  225 (370)
T cd02929         209 DTKDAVGDDCAVATRFS  225 (370)
T ss_pred             HHHHHHCCCCEEEEEEC
T ss_conf             99997199875999989


No 253
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH.    FtsH is a membrane-anchored ATP-dependent protease that degrades misfolded or misassembled membrane proteins as well as a subset of cytoplasmic regulatory proteins. FtsH is a 647-residue protein of 70 kDa, with two putative transmembrane segments towards its N terminus which anchor the protein to the membrane, giving rise to a periplasmic domain of 70 residues and a cytoplasmic segment of 520 residues containing the ATPase and protease domains . ; GO: 0004222 metalloendopeptidase activity, 0030163 protein catabolic process, 0016020 membrane.
Probab=61.66  E-value=6.4  Score=19.67  Aligned_cols=47  Identities=21%  Similarity=0.530  Sum_probs=31.2

Q ss_pred             EEECCCCCHH---HHHHCCCCEEEECCCCCCCCCCCCCCCCHHHH-HCCCCEEEE
Q ss_conf             9852898988---99723997999985388999999975376898-089988997
Q gi|254780414|r   35 EVIAFKNALD---YFKEQNPQAIILSGSPASSLDIDSPQIPKEIL-ESNIPLLGI   85 (520)
Q Consensus        35 eI~P~~~~~e---~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~-~~~iPILGI   85 (520)
                      ||+.|=..++   .+-.+=|+||+|+|-|.    .+.--+.+++- |.++|.|-|
T Consensus        73 EiVdFLK~P~kf~~LGaKIPKGVLLvGPPG----TGKTLLAKAvAGEA~VPFF~i  123 (505)
T TIGR01241        73 EIVDFLKNPSKFTKLGAKIPKGVLLVGPPG----TGKTLLAKAVAGEAGVPFFSI  123 (505)
T ss_pred             HHHHHCCCCHHHHHCCCCCCCCEEEECCCC----CCHHHHHHHHHCCCCCCCEEE
T ss_conf             134222696379872788987147317878----424678875202588962474


No 254
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=61.12  E-value=5.3  Score=20.25  Aligned_cols=68  Identities=22%  Similarity=0.359  Sum_probs=40.4

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC--CCCEEEEC
Q ss_conf             6999988970578899888865940698528989889972399799998538899999997537689808--99889977
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES--NIPLLGIC   86 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~--~iPILGIC   86 (520)
                      |+.|+.-+++.++-++..++++=..     +...   ..+.+|+-+|-=||-.+..     +........  ++|+|||-
T Consensus         2 k~~iv~~~~~~s~~~~~~~~~~l~~-----~~~~---~~~~~~Dlvi~iGGDGT~L-----~a~~~~~~~~~~vPilGIN   68 (265)
T PRK04885          2 KVAIISNGDEKSKRVASKLKKYLKD-----FGFI---LDEKNPDIVISVGGDGTLL-----SAFHRYENQLDKVRFVGVH   68 (265)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHHH-----CCCC---CCCCCCCEEEEECCCHHHH-----HHHHHHHCCCCCCCEEEEE
T ss_conf             6999969698999999999999987-----6985---5877899999988739999-----9999863036797589873


Q ss_pred             HHH
Q ss_conf             899
Q gi|254780414|r   87 YGQ   89 (520)
Q Consensus        87 yG~   89 (520)
                      .|+
T Consensus        69 ~G~   71 (265)
T PRK04885         69 TGH   71 (265)
T ss_pred             CCC
T ss_conf             585


No 255
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5.1.3.1 from EC) (also known as pentose-5-phosphate 3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In Alcaligenes eutrophus two copies of the gene coding for PPE are known , one is chromosomally encoded P40117 from SWISSPROT, the other one is on a plasmid Q04539 from SWISSPROT. PPE has been found in a wide range of bacteria, archaebacteria, fungi and plants. All the proteins have from 209 to 241 amino acid residues. The enzyme has a TIM barrel structure.; GO: 0004750 ribulose-phosphate 3-epimerase activity, 0005975 carbohydrate metabolic process.
Probab=60.27  E-value=13  Score=17.44  Aligned_cols=69  Identities=19%  Similarity=0.350  Sum_probs=42.0

Q ss_pred             EEEEEEHHHCCCHHHHHHHHHHHHHCC------CCCCCCCHHHHHHHHHHHHH---HHC----CCCEEEEECCCCHHHHH
Q ss_conf             246521222152025779987550106------44111406789999999976---504----44036640564047799
Q gi|254780414|r  172 AVQFHPEVVHTVGGSQLIDNFVHHVAG------IQDNWVMSSYHKEIVSRIKE---QVG----NERVICAVSGGVDSTVA  238 (520)
Q Consensus       172 GVQFHPEV~hT~~G~~iL~NFl~~Ic~------~~~~W~~~~~~~~~i~~Ir~---~vg----~~kVi~~lSGGVDStV~  238 (520)
                      |+=|=|.   |+  ...|+++| .-|.      ..|-+.=+.||...+++||+   -+.    +..+.+-+=|||+-.-+
T Consensus       110 G~v~NP~---TP--l~~~~~~L-~~~D~VLlMSVnPGFgGQkFIP~~~~Kir~~R~~id~~~~~~~~~ieVDGGv~~~ni  183 (216)
T TIGR01163       110 GIVLNPA---TP--LEALEYVL-EDVDLVLLMSVNPGFGGQKFIPETLEKIRELRKMIDKLELGLSILIEVDGGVNEDNI  183 (216)
T ss_pred             EEEECCC---CC--HHHHHHHH-HHCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHH
T ss_conf             6886799---99--87899898-762989988760799884110578999999999998602799558997179897679


Q ss_pred             HHHHHHHCCC
Q ss_conf             9999862236
Q gi|254780414|r  239 AFLIYEAIGI  248 (520)
Q Consensus       239 A~Ll~kAig~  248 (520)
                      +. +.+| |-
T Consensus       184 ~~-~~~A-GA  191 (216)
T TIGR01163       184 AE-VAEA-GA  191 (216)
T ss_pred             HH-HHHC-CC
T ss_conf             99-9975-89


No 256
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional
Probab=60.04  E-value=13  Score=17.41  Aligned_cols=68  Identities=18%  Similarity=0.282  Sum_probs=36.9

Q ss_pred             EEECCC---CHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE---HHHHHHHHHCCCCC
Q ss_conf             640564---0477999999862236569999738955156278999988623698579975---88999999668988
Q gi|254780414|r  227 CAVSGG---VDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD---ASERFIRKLKNIVD  298 (520)
Q Consensus       227 ~~lSGG---VDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vd---a~~~Fl~~L~gv~D  298 (520)
                      ..+|||   +-.--+..|+.+|=...+++.+.-||+.++.+ +.+.+.+.   .+++..+|   ..+.+..++-|+..
T Consensus        74 VT~SGGEPllq~ef~~~l~~~~k~~gi~taidTnG~~~~~~-~~~~~ll~---~~D~vl~DiK~~d~~~h~~~tG~~n  147 (246)
T PRK11145         74 VTASGGEAILQAEFVRDWFRACKKEGIHTCLDTNGFVRRYD-PVIDELLD---VTDLVMLDLKQMNDEIHQNLVGVSN  147 (246)
T ss_pred             EEEECCCEECCHHHHHHHHHHHHHCCCCEEEECCCCCCCCH-HHHHHHHH---HCCEEEECCCCCCHHHHHHHHCCCC
T ss_conf             89869951268999999999998879989998999987557-99999886---3234576466689899999988891


No 257
>TIGR02611 TIGR02611 conserved hypothetical protein TIGR02611; InterPro: IPR013434    Proteins in this entry are putative Actinobacterial proteins of about 150 amino acids in length, with three predicted transmembrane helices and an unusual motif with consensus sequence PGPGW..
Probab=59.76  E-value=3.1  Score=21.89  Aligned_cols=14  Identities=50%  Similarity=0.885  Sum_probs=8.9

Q ss_pred             CCCCCCCCEEEECC
Q ss_conf             88898311122100
Q gi|254780414|r  396 HPCPGPGLAIRCIG  409 (520)
Q Consensus       396 hPFPGPGLaiRi~g  409 (520)
                      =||||||=.+==+|
T Consensus        48 iP~PGPGWl~~FiG   61 (126)
T TIGR02611        48 IPLPGPGWLTIFIG   61 (126)
T ss_pred             CCCCCCCHHHHHHH
T ss_conf             18576607467999


No 258
>pfam10288 DUF2392 Protein of unknown function (DUF2392). This is a family of proteins conserved from plants to humans. The function is not known. It carries a characteristic GRG sequence motif.
Probab=59.70  E-value=6.1  Score=19.79  Aligned_cols=32  Identities=25%  Similarity=0.509  Sum_probs=27.7

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHC
Q ss_conf             03202237898738999999998199988942
Q gi|254780414|r  363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVE  394 (520)
Q Consensus       363 ~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~  394 (520)
                      ..++++-||||+++.|+....+..+++..++.
T Consensus        29 ~~i~~~~PLRD~l~~Ei~~Y~~~~~l~~~~~~   60 (104)
T pfam10288        29 NDIKILRPLRDLLLKEIEAYCSLKNLPPLLIN   60 (104)
T ss_pred             CCCEEEEEHHHHHHHHHHHHHHHHCCCHHCCC
T ss_conf             88347737588569999999998087400135


No 259
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group are belonging to the type I periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.
Probab=59.26  E-value=14  Score=17.32  Aligned_cols=72  Identities=18%  Similarity=0.230  Sum_probs=43.0

Q ss_pred             EEEEECCCCHH----HHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             99998897057----88998888659406985289898-------89972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQFT----QLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQyt----qLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      ++|=|+...|-    +-|.+..++.|+...+...+.+.       +.+...+++|||++.--.   + ..+..-+.+.+.
T Consensus         4 vivp~l~npff~~~~~gi~~~a~~~Gy~~~i~~s~~~~~~e~~~i~~l~~~~vdgiI~~p~~~---~-~~~~~i~~~~~~   79 (268)
T cd06323           4 LSVSTLNNPFFVTLKDGAQKEAKELGYELTVLDAQNDAAKQLNDIEDLITRGVDAIIINPTDS---D-AVVPAVKAANEA   79 (268)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCC---C-CCHHHHHHHHHC
T ss_conf             998889799999999999999997599899981999999999999999964999899756542---1-246999999976


Q ss_pred             CCCEEEE
Q ss_conf             9988997
Q gi|254780414|r   79 NIPLLGI   85 (520)
Q Consensus        79 ~iPILGI   85 (520)
                      ++|+.-+
T Consensus        80 ~iPvV~i   86 (268)
T cd06323          80 GIPVFTI   86 (268)
T ss_pred             CCCEEEE
T ss_conf             9968996


No 260
>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase; InterPro: IPR011800    Requiring thioredoxin as an electron donor, phosphoadenosine phosphosulphate reductase catalyzes the reduction of 3'-phosphoadenylylsulphate (PAPS) to sulphite and phospho-adenosine-phosphate (PAP). Found in enterobacteria, cyanobacteria, and yeast, PAPS reductase is related to a group of plant (IPR004508 from INTERPRO) and bacterial (IPR011798 from INTERPRO) enzymes preferring 5'-adenylylsulphate (APS) over PAPS as a substrate for reduction to sulphite.; GO: 0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity, 0019344 cysteine biosynthetic process.
Probab=58.52  E-value=14  Score=17.24  Aligned_cols=71  Identities=11%  Similarity=0.228  Sum_probs=49.5

Q ss_pred             HHHCCCCEEEEECCCCHHHHHHHHHHHHCC---CCEEEEEECCCCCCCCCHHHHHHHHHHC------CCCCEEEEE---H
Q ss_conf             650444036640564047799999986223---6569999738955156278999988623------698579975---8
Q gi|254780414|r  218 EQVGNERVICAVSGGVDSTVAAFLIYEAIG---INLTCVLVDHGFMRKNEVENIISLFKGY------PNFPLRVVD---A  285 (520)
Q Consensus       218 ~~vg~~kVi~~lSGGVDStV~A~Ll~kAig---~~l~~vfVD~GllRknE~~~v~~~~~~~------~~~~l~~vd---a  285 (520)
                      +..+.+.-+.-=|=|||..|.-=|+.+-..   .+.=-||+|||++=. |+-+..+-+++.      ..||+.+.+   +
T Consensus        23 ~~~P~G~Lv~tsaFg~~~lV~~hll~~~~keky~~~pvif~DTly~F~-~Tl~l~~~~~~~y~qPkn~~L~~~~~~~~~s  101 (239)
T TIGR02057        23 ETFPTGELVQTSAFGIQALVILHLLSSILKEKYPDIPVIFIDTLYLFP-QTLELVDELTEKYKQPKNLDLNLYKYDDVES  101 (239)
T ss_pred             HHCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCH-HHHHHHHHHHHHHCCCCCCCCEEEECCCCCC
T ss_conf             755999745301020478999999999876217998678621113627-8999999999986276556330331688887


Q ss_pred             HHHH
Q ss_conf             8999
Q gi|254780414|r  286 SERF  289 (520)
Q Consensus       286 ~~~F  289 (520)
                      .+.|
T Consensus       102 ~a~~  105 (239)
T TIGR02057       102 EAAF  105 (239)
T ss_pred             HHHH
T ss_conf             8989


No 261
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair]
Probab=57.70  E-value=14  Score=17.14  Aligned_cols=81  Identities=19%  Similarity=0.180  Sum_probs=52.5

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHH-CC-CCE
Q ss_conf             4488699998897057889988886594069852898988997239979999853889999999753768980-89-988
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILE-SN-IPL   82 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~-~~-iPI   82 (520)
                      +-.+.|+|+|+|..+.  ..   .-+||.- |+|...-+.+.. .+.+||+||-|..     |..---+.++. .+ +||
T Consensus        28 e~~~~i~i~D~G~~fp--~~---~~~gvDl-iIPd~~yl~~n~-~kvkgI~lTHgHe-----DHIGaip~ll~~~~~~pi   95 (555)
T COG0595          28 EYGDDIIILDAGLKFP--ED---DLLGVDL-IIPDFSYLEENK-DKVKGIFLTHGHE-----DHIGALPYLLKQVLFAPI   95 (555)
T ss_pred             EECCCEEEEECCCCCC--CC---CCCCCCE-EECCHHHHHHCC-CCCEEEEECCCCH-----HHCCCHHHHHHCCCCCCE
T ss_conf             9789689997765668--64---3555558-825827743150-0213999468744-----432346789852776844


Q ss_pred             EEECHHHHHHHHHCC
Q ss_conf             997789999899709
Q gi|254780414|r   83 LGICYGQQIMCQSLG   97 (520)
Q Consensus        83 LGICyG~QlLa~~~G   97 (520)
                      .|-=+...++-..+.
T Consensus        96 y~s~lt~~Li~~k~~  110 (555)
T COG0595          96 YASPLTAALIKEKLK  110 (555)
T ss_pred             ECCHHHHHHHHHHHH
T ss_conf             447766999998988


No 262
>cd01139 TroA_f Periplasmic binding protein TroA_f.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=57.33  E-value=15  Score=17.10  Aligned_cols=57  Identities=14%  Similarity=0.302  Sum_probs=37.2

Q ss_pred             CCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH----------HHHHHHHHCCC
Q ss_conf             989889972399799998538899999997537689808998899778----------99998997096
Q gi|254780414|r   40 KNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY----------GQQIMCQSLGG   98 (520)
Q Consensus        40 ~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy----------G~QlLa~~~GG   98 (520)
                      +.+.|.+.+.+|+-||++.+...  ..........+-+.|||++.+=|          -+.+|+..+|-
T Consensus        81 ~~n~E~il~l~PDvVi~~~~~~~--~~~~~~~~~~l~~~GIpVv~~~~~~~~~e~~~~~i~~lG~ilg~  147 (342)
T cd01139          81 DFSVEKVLTLKPDLVILNIWAKT--TAEESGILEKLEQAGIPVVFVDFRQKPLKNTTPSMRLLGKALGR  147 (342)
T ss_pred             CCCHHHHHHCCCCEEEEECCCCC--CCCCHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCC
T ss_conf             85999996219988999443456--54456799999971998899946875088899999999998298


No 263
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=57.16  E-value=8.7  Score=18.69  Aligned_cols=77  Identities=14%  Similarity=0.291  Sum_probs=41.0

Q ss_pred             CEEEEE-ECCCC----HHHHHHHHHHHCCCEEEEECCCCCH------------H-----HHHHCCCCEEEECCCCCCCCC
Q ss_conf             869999-88970----5788998888659406985289898------------8-----997239979999853889999
Q gi|254780414|r    8 SKVLII-DFGSQ----FTQLIARRVRESKVYCEVIAFKNAL------------D-----YFKEQNPQAIILSGSPASSLD   65 (520)
Q Consensus         8 ~~IlIl-DfGSQ----ytqLIaRriRelgVyseI~P~~~~~------------e-----~i~~~~p~GIILSGGP~SV~d   65 (520)
                      .+|+|+ ..+++    ..+.|++.+++.|+-+.+...+...            +     .....+.+-+|--||-.++  
T Consensus         5 R~V~IV~k~~~~~a~~~a~~l~~~L~~~g~~v~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlvi~lGGDGT~--   82 (303)
T PRK03372          5 RTVLLVAHTGRDEATESARRVVKQLGDAGIGVRVLAAEAADLPDDMRALGVEIEVVDADPDAADGCELVLVLGGDGTF--   82 (303)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCHHH--
T ss_conf             889999708998999999999999997889899970401002444555565422345322335785589997787899--


Q ss_pred             CCCCCCCHHHHHCCCCEEEECHHH
Q ss_conf             999753768980899889977899
Q gi|254780414|r   66 IDSPQIPKEILESNIPLLGICYGQ   89 (520)
Q Consensus        66 ~~ap~~~~~I~~~~iPILGICyG~   89 (520)
                         .+........++|||||-+|+
T Consensus        83 ---L~aar~~~~~~iPilGiN~G~  103 (303)
T PRK03372         83 ---LRAAELARNADVPVLGVNLGH  103 (303)
T ss_pred             ---HHHHHHHCCCCCCEEEEECCC
T ss_conf             ---999998444799889872598


No 264
>PRK10693 response regulator of RpoS; Provisional
Probab=56.23  E-value=15  Score=16.98  Aligned_cols=56  Identities=18%  Similarity=0.213  Sum_probs=40.6

Q ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHCCCCEEEE
Q ss_conf             986344886999988970578899888865940698528-98988997239979999
Q gi|254780414|r    1 MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAF-KNALDYFKEQNPQAIIL   56 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~-~~~~e~i~~~~p~GIIL   56 (520)
                      |++.....||||+|=-.-...++.+.++..|........ ...++.+....|+-||+
T Consensus         1 m~~pl~gkkILIVDDd~~~r~~l~~~L~~~G~~V~~A~nG~eAl~~l~~~~pDLIi~   57 (337)
T PRK10693          1 MTQPLVGKQILIVEDEPVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMIC   57 (337)
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCCCCCEEEE
T ss_conf             998888998999949999999999999978999999899999999986589999999


No 265
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=55.79  E-value=9.1  Score=18.57  Aligned_cols=77  Identities=18%  Similarity=0.236  Sum_probs=43.6

Q ss_pred             CCEEEEEE-CCCCHHH----HHHHHHHHCCCEEEEECCCCC---HHHH---HHCCCCEEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             88699998-8970578----899888865940698528989---8899---72399799998538899999997537689
Q gi|254780414|r    7 SSKVLIID-FGSQFTQ----LIARRVRESKVYCEVIAFKNA---LDYF---KEQNPQAIILSGSPASSLDIDSPQIPKEI   75 (520)
Q Consensus         7 ~~~IlIlD-fGSQytq----LIaRriRelgVyseI~P~~~~---~e~i---~~~~p~GIILSGGP~SV~d~~ap~~~~~I   75 (520)
                      -.+|+|+- .++.-.+    .+++.+.+.|+-+-+.+.+..   .+..   ....++-+|--||-.++     .+....+
T Consensus         3 lk~VlIV~k~~~~~A~~~a~~l~~~L~~rGi~v~~~~~~~~~~~~~~~~~~~~~~~Dlvi~lGGDGT~-----L~aar~~   77 (304)
T PRK02645          3 LKLVIIAYKAGSPQAKEAAERCAKQLEARGIKVLMGPSGPKDNPYPVFLASAEELPDLAIVLGGDGTV-----LAAARHL   77 (304)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCEEEEECCCHHH-----HHHHHHH
T ss_conf             45999998589999999999999999988899998444344477762001446688899997868899-----9999985


Q ss_pred             HHCCCCEEEECH-H
Q ss_conf             808998899778-9
Q gi|254780414|r   76 LESNIPLLGICY-G   88 (520)
Q Consensus        76 ~~~~iPILGICy-G   88 (520)
                      ...++|||||-+ |
T Consensus        78 ~~~~iPilGiN~~G   91 (304)
T PRK02645         78 APHDIPILSFNVGG   91 (304)
T ss_pred             CCCCCCEEEEECCC
T ss_conf             42699889982486


No 266
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II; InterPro: IPR011287   This entry represents the class II subfamily of poly(R)-hydroxyalkanoate synthases, which polymerises hydroxyacyl-CoAs, typically with six to fourteen carbons in the hydroxyacyl backbone into aliphatic esters termed poly(R)-hydroxyalkanoic acids . These polymers accumulate as carbon and energy storage inclusions in many species and can amount to 90 percent of the dry weight of cell.; GO: 0008415 acyltransferase activity, 0042619 poly-hydroxybutyrate biosynthetic process.
Probab=55.75  E-value=14  Score=17.31  Aligned_cols=91  Identities=24%  Similarity=0.361  Sum_probs=58.0

Q ss_pred             CCCCCCCCCHHHH---HHHHHHHHHHHCCC--CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCH-HHHHH
Q ss_conf             0644111406789---99999997650444--036640564047799999986223656999973895515627-89999
Q gi|254780414|r  197 AGIQDNWVMSSYH---KEIVSRIKEQVGNE--RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEV-ENIIS  270 (520)
Q Consensus       197 c~~~~~W~~~~~~---~~~i~~Ir~~vg~~--kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~-~~v~~  270 (520)
                      -...+.|-++.|+   ++.|+-.|+..|++  ..+-|.|||+  |++|.+-|-+...+          +||=.+ .-.+.
T Consensus       259 ~~~~REWGLStYv~AL~~A~~~~~~ItG~~d~Nl~GACaGGl--T~aAL~GHl~~~~~----------~RkV~s~T~LVS  326 (560)
T TIGR01839       259 DKAHREWGLSTYVDALEEAVDAVRAITGSRDLNLLGACAGGL--TVAALLGHLQAKRQ----------LRKVNSLTYLVS  326 (560)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCHHH--HHHHHHHHHHHHHH----------CCHHHHHHHHHH
T ss_conf             710132540679999999999987514887600110151478--99999989999753----------021456777777


Q ss_pred             HHHHCCCCCEEEEEHHHHHH------HHHCCCCCHH
Q ss_conf             88623698579975889999------9966898889
Q gi|254780414|r  271 LFKGYPNFPLRVVDASERFI------RKLKNIVDPE  300 (520)
Q Consensus       271 ~~~~~~~~~l~~vda~~~Fl------~~L~gv~DPE  300 (520)
                      ++-..+.-+.. .-+-|.-|      +.-+||-|=.
T Consensus       327 lLDs~~~~~~~-LF~DEQTlEaaKR~SYQ~GVLdG~  361 (560)
T TIGR01839       327 LLDSKMESPAA-LFADEQTLEAAKRRSYQAGVLDGS  361 (560)
T ss_pred             HHHCCCCCCEE-EEEHHHHHHHHHHHHHHCCCCCHH
T ss_conf             66314566401-110034566653234421564523


No 267
>pfam07882 Fucose_iso_N2 L-fucose isomerase, second N-terminal domain. The members of this family are similar to L-fucose isomerase expressed by E. coli (EC:5.3.1.3). This enzyme corresponds to glucose-6-phosphate isomerase in glycolysis, and converts an aldo-hexose to a ketose to prepare it for aldol cleavage. The enzyme is a hexamer, with each subunit being wedge-shaped and composed of three domains. Both domains 1 and 2 contain central parallel beta- sheets with surrounding alpha helices. The active centre is shared between pairs of subunits related along the molecular three-fold axis, with domains 2 and 3 from one subunit providing most of the substrate-contacting residues.
Probab=55.12  E-value=16  Score=16.86  Aligned_cols=38  Identities=29%  Similarity=0.420  Sum_probs=28.1

Q ss_pred             HHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             99886236985799758899999966898889999887
Q gi|254780414|r  269 ISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI  306 (520)
Q Consensus       269 ~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiI  306 (520)
                      .++|.+.+|+.+..||.++.--..=.|+-|||+-.|..
T Consensus        20 ~~f~q~ylGmrvE~VDm~Ei~RR~~~~iyD~~E~e~Al   57 (181)
T pfam07882        20 PDFFQDYLGMRVEYVDMTEIVRRIEEEIYDPEEFEKAL   57 (181)
T ss_pred             HHHHHHHHCCCCCEECHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             99999995992001229999999872688999999999


No 268
>TIGR01383 not_thiJ DJ-1 family protein; InterPro: IPR006287    These sequences represent the DJ-1 clade of the so-called ThiJ/PfpI family of proteins. PfpI, represented by IPR006286 from INTERPRO, is a putative intracellular cysteine protease. DJ-1 is described as an oncogene that acts cooperatively with H-Ras . Many members of the DJ-1 clade are annotated (apparently incorrectly) as ThiJ (thiamine pyridinylase), a protein of thiamine biosynthesis. However, published reports of ThiJ activity and identification of a ThiJ/ThiD bifunctional protein describe an unrelated locus mapping near ThiM, rather than the DJ-1 homolog of Escherichia coli. The ThiJ designation for this family may be spurious; the cited paper  refers to a locus near thiD and thiM in E. coli, unlike the gene represented here. Current public annotation reflects ThiJ/ThiD bifunctional activity, apparently a property of ThiD and not of this locus.   This group of proteins are classified as either DJ-1 putative peptidases or non-peptidase homologs in MEROPS peptidase family C56 (clan PC(C)). .
Probab=54.84  E-value=8.7  Score=18.71  Aligned_cols=59  Identities=19%  Similarity=0.268  Sum_probs=39.8

Q ss_pred             ECCCCCHHHHHHCCCCEEEECCC-CCCCCCCCCCCCC---HHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             52898988997239979999853-8899999997537---68980899889977899998997
Q gi|254780414|r   37 IAFKNALDYFKEQNPQAIILSGS-PASSLDIDSPQIP---KEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        37 ~P~~~~~e~i~~~~p~GIILSGG-P~SV~d~~ap~~~---~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +-.|.++++++..++|.|+|.|| |.|-+=.|+-.+.   ++.-+.+.=|=.||=.==++..+
T Consensus        53 ~~AD~~l~d~~~~~fD~ivLPGG~pGa~nL~~S~~l~~~lk~~~~~gkl~AAICAaP~vll~~  115 (186)
T TIGR01383        53 ILADASLEDVDDEEFDLIVLPGGMPGAENLRDSKLLENLLKKQESKGKLVAAICAAPIVLLAA  115 (186)
T ss_pred             ECCCCCHHHCCCCCCCEEEECCCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEEHHHHHHHHHC
T ss_conf             734871412577776778936982266642025789999999997499388420458986302


No 269
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=54.83  E-value=16  Score=16.82  Aligned_cols=58  Identities=28%  Similarity=0.415  Sum_probs=39.9

Q ss_pred             CCCCCCCCEEEEEECCC----C-----H--HHHHHHHHHHCCCEEEEECCCC------------------CHH----HHH
Q ss_conf             98634488699998897----0-----5--7889988886594069852898------------------988----997
Q gi|254780414|r    1 MHKRERSSKVLIIDFGS----Q-----F--TQLIARRVRESKVYCEVIAFKN------------------ALD----YFK   47 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGS----Q-----y--tqLIaRriRelgVyseI~P~~~------------------~~e----~i~   47 (520)
                      |.+...-.|||||-=|.    |     |  +| ..+.+||.|+.+.++.+|.                  +.+    -|.
T Consensus         1 MP~~~~ikkvLviGsGp~~IGqa~EfDysg~q-a~~al~e~g~~vilvN~NpaTv~Td~~~ad~vY~ePlt~e~v~~Ii~   79 (1063)
T PRK05294          1 MPKRTDIKKILIIGSGPIVIGQACEFDYSGTQ-ACKALREEGYRVVLVNSNPATIMTDPEMADATYIEPITPEFVEKIIE   79 (1063)
T ss_pred             CCCCCCCCEEEEECCCCCHHCCHHHHHHHHHH-HHHHHHHCCCEEEEECCCCCHHCCCCCCCCEEEECCCCHHHHHHHHH
T ss_conf             99877878899989882510372332656999-99999986998999879854410787766437872798999999999


Q ss_pred             HCCCCEEEECCC
Q ss_conf             239979999853
Q gi|254780414|r   48 EQNPQAIILSGS   59 (520)
Q Consensus        48 ~~~p~GIILSGG   59 (520)
                      ..+|+||+.+=|
T Consensus        80 ~E~Pd~il~~~G   91 (1063)
T PRK05294         80 KERPDAILPTMG   91 (1063)
T ss_pred             HHCCCEEEECCC
T ss_conf             759997886677


No 270
>cd01399 GlcN6P_deaminase GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.
Probab=54.77  E-value=16  Score=16.82  Aligned_cols=105  Identities=11%  Similarity=0.079  Sum_probs=53.9

Q ss_pred             HHHHHHHC-CCCEEEEECCCCHHHHHHHHHHH-----HCC-CCEEEEEECCCC-CCCCCHHHHHHHHHHCCCCCEEEEEH
Q ss_conf             99976504-44036640564047799999986-----223-656999973895-51562789999886236985799758
Q gi|254780414|r  214 SRIKEQVG-NERVICAVSGGVDSTVAAFLIYE-----AIG-INLTCVLVDHGF-MRKNEVENIISLFKGYPNFPLRVVDA  285 (520)
Q Consensus       214 ~~Ir~~vg-~~kVi~~lSGGVDStV~A~Ll~k-----Aig-~~l~~vfVD~Gl-lRknE~~~v~~~~~~~~~~~l~~vda  285 (520)
                      +.|.+.+. ++++.++||||---.-....|.+     .+- ++++..++|-=. +-.+..+-....+++.+--++ -+..
T Consensus         9 ~~i~~~i~~~~~~~ialsGG~tP~~~y~~L~~~~~~~~i~w~~v~~f~~DE~~~v~~~~~~Sn~~~~~~~ll~~~-~i~~   87 (232)
T cd01399           9 ELIAELIREKPPAVLGLATGSTPLGVYEELIELHKEGGLSFSNVTTFNLDEYVGLPPDHPQSYHYFMRENLFDHI-DIKP   87 (232)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCC-CCCH
T ss_conf             999999997798699989987899999999998863499757938992742347895055889999999864257-9998


Q ss_pred             HHHHHHHHCCC-CCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             89999996689-888999988756589999999974399709986
Q gi|254780414|r  286 SERFIRKLKNI-VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQ  329 (520)
Q Consensus       286 ~~~Fl~~L~gv-~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~Q  329 (520)
                      +..|  .+.|. .|||+-        .+-+++..++.++.+++.-
T Consensus        88 ~~i~--~~~~~~~~~~~~--------a~~y~~~i~~~~~~Dl~lL  122 (232)
T cd01399          88 ENIH--IPDGNAADLEAE--------CRRYEALIAEAGGIDLQLL  122 (232)
T ss_pred             HHCC--CCCCCCCCHHHH--------HHHHHHHHHHCCCCCEEEE
T ss_conf             9857--889875699999--------9999999987289858998


No 271
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit; InterPro: IPR012754   DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length . The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel.   RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.  Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kD, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits.   This entry represents the beta-prime subunit, RpoC, found in most bacteria. It excludes some, mainly cyanobacterial, species where RpoC is replaced by two homologous proteins that include an additional domain. One arm of the "claw" is predominantly formed by this subunit, the other being predominantly formed by the beta subunit. The active site of the enzyme is defined by three invariant aspartate residues within the beta-prime subunit .; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription.
Probab=54.34  E-value=3.5  Score=21.57  Aligned_cols=31  Identities=23%  Similarity=0.114  Sum_probs=14.5

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEECCCCHH
Q ss_conf             0678999999997650444036640564047
Q gi|254780414|r  205 MSSYHKEIVSRIKEQVGNERVICAVSGGVDS  235 (520)
Q Consensus       205 ~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDS  235 (520)
                      ++.|+=..-++|++.+.+..+.-.+|==+=|
T Consensus       697 p~~fi~~~~~~i~~~i~~~~~~~p~~kK~i~  727 (1552)
T TIGR02386       697 PKKFIVEKGEDIKEVIEKIQVVEPLSKKEIS  727 (1552)
T ss_pred             HHHHHHHCCCCHHHHHHHCCCCCCCCCHHHH
T ss_conf             3677631583578899743333665503678


No 272
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=53.87  E-value=5.9  Score=19.94  Aligned_cols=44  Identities=32%  Similarity=0.346  Sum_probs=27.7

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             6640564047799999986223656999973895515627899998862
Q gi|254780414|r  226 ICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG  274 (520)
Q Consensus       226 i~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~  274 (520)
                      |-|-||-=-||++. ++.+    +|-+-|+|+|.||..|..+.......
T Consensus         4 IdGpagsGKsT~ak-~lA~----~l~~~~ldtG~ir~~ev~~~~s~ia~   47 (147)
T cd02020           4 IDGPAGSGKSTVAK-LLAK----KLGLPYLDTGGIRTEEVGKLASEVAA   47 (147)
T ss_pred             EECCCCCCHHHHHH-HHHH----HHCCEEECCCCCCCHHHHHHHHHHCC
T ss_conf             86899789899999-9999----90990776654254899899999819


No 273
>PRK06608 threonine dehydratase; Provisional
Probab=53.84  E-value=16  Score=16.88  Aligned_cols=97  Identities=14%  Similarity=0.181  Sum_probs=52.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHH
Q ss_conf             44036640564047799999986223656999973895515627899998862369857997588999999668988899
Q gi|254780414|r  222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPET  301 (520)
Q Consensus       222 ~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~  301 (520)
                      .+.|+|+=||---  .+.++..+++|-+.+.+      |-.+=++.-.+..+. +|-+++.++..+.--.+.+-    .+
T Consensus        73 ~~~vv~aSsGNhG--~alA~aa~~~G~~~~I~------mP~~~~~~Ki~~i~~-~GAeVi~~~~~~~~~~~~~~----~~  139 (330)
T PRK06608         73 PDKIVAYSTGNHG--IAVAYASKLFGIKTRIY------LPLNTSKVKQQAALY-YGGEVILTNTRQEAEEKAKE----DE  139 (330)
T ss_pred             CCCEEEECCCCHH--HHHHHHHHHCCCCEEEE------ECCCCCHHHHHHHHH-CCCEEEEECCHHHHHHHHHH----HH
T ss_conf             7837986788669--99999998549863898------456588999999998-79999998985899999998----61


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHH
Q ss_conf             998875658999999997439970998646220245420
Q gi|254780414|r  302 KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESI  340 (520)
Q Consensus       302 KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~  340 (520)
                      +   =|..|+.-|+.      ...+-.|||+-..++|.-
T Consensus       140 ~---~~~~~i~~~d~------~~~iaG~~Ti~~Ei~eq~  169 (330)
T PRK06608        140 K---QGFYYIHPSDS------DSIIAGAGTLCYEALQQL  169 (330)
T ss_pred             H---CCCEEECCCCC------CCHHCCCCHHHHHHHHHH
T ss_conf             4---58889578788------001046433999999981


No 274
>TIGR00992 3a0901s03IAP75 chloroplast envelope protein translocase, IAP75 family; InterPro: IPR005689   Chloroplast function requires the import of nuclear encoded proteins from the cytoplasm across the chloroplast double membrane. This is accompished by two protein complexes, the Toc complex located at the outer membrane and the Tic complex loacted at the inner membrane . The Toc complex recognises specific proteins by a cleavable N-terminal sequence and is primarily responsible for translocation through the outer membrane, while the Tic complex translocates the protein through the inner membrane.   This entry represents Toc750, a core component of the Toc complex. This protein is deeply embedded in the outer membrane and forms the voltage-dependent translocation channel . Toc75 itself appears to be capable of at least some discrimination between substrate and non-substrate proteins, with recognition based on based on both conformational and electrostatic interactions. ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0009707 chloroplast outer membrane.
Probab=53.71  E-value=11  Score=18.07  Aligned_cols=51  Identities=24%  Similarity=0.414  Sum_probs=25.0

Q ss_pred             HCCCCEEEEECCC-CCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCC-----CHHHHHHHH
Q ss_conf             4399709986462-202454202467776303443023201132032-----022378987
Q gi|254780414|r  320 KIGGAQFLGQGTL-YPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM-----KLVEPLKEL  374 (520)
Q Consensus       320 ~~~~~~~L~QGTl-ypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~-----~liEPl~~l  374 (520)
                      +....|=.+-|-= .| +.-| ...+|  ..-=.|-|.+|+-+.+..     ..+.|=++|
T Consensus       391 evsteWSI~~G~GG~P-~~~S-~~~~G--ti~f~~RNL~G~N~~l~~~~~~~nflnPQ~~L  447 (768)
T TIGR00992       391 EVSTEWSIVPGRGGAP-ILAS-SQLGG--TITFEERNLQGLNRSLGGSVTVSNFLNPQDDL  447 (768)
T ss_pred             EEEEEEEEECCCCCCC-CEEC-CCCCC--EEEEEECCCCCCCCEEEEEEEECCCCCCCHHH
T ss_conf             3310025514888864-1000-26762--16772015677561478988871445731131


No 275
>PRK05282 peptidase E; Validated
Probab=53.43  E-value=17  Score=16.67  Aligned_cols=88  Identities=14%  Similarity=0.306  Sum_probs=57.8

Q ss_pred             CCCEEEEEECC------CCHHHHHHHHHHHCCCEEE-EECCCCCHHHHHHCCCCEEEECCCCC-----CCCCCCCCCCCH
Q ss_conf             48869999889------7057889988886594069-85289898899723997999985388-----999999975376
Q gi|254780414|r    6 RSSKVLIIDFG------SQFTQLIARRVRESKVYCE-VIAFKNALDYFKEQNPQAIILSGSPA-----SSLDIDSPQIPK   73 (520)
Q Consensus         6 ~~~~IlIlDfG------SQytqLIaRriRelgVyse-I~P~~~~~e~i~~~~p~GIILSGGP~-----SV~d~~ap~~~~   73 (520)
                      ..++|+-+-|-      ..||+.....+..+|+-.. |+.++.+.+.+..  -++|.++||..     ..++.+.-..-+
T Consensus        30 ~~k~ilFIPyA~~~~~~d~Yt~~v~~af~~lg~~v~gih~~~dp~~AI~~--Ad~I~vgGGNTF~Ll~~L~~~gl~~~ir  107 (233)
T PRK05282         30 GRRKAVFIPYAGVTQSWDDYTAKVAEVLAPLGIEVTGIHRVEDPVAAIEN--ADGIIVGGGNTFQLLKQLYERGLLAPIR  107 (233)
T ss_pred             CCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHH--CCEEEECCCCHHHHHHHHHHCCCHHHHH
T ss_conf             79659997588887988999999999998669828876245898999974--9979986973999999999858299999


Q ss_pred             HHHHCCCCEEEECHHHHHHHHH
Q ss_conf             8980899889977899998997
Q gi|254780414|r   74 EILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        74 ~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +..+.+.|.+|.-=|.-+.+..
T Consensus       108 ~~V~~G~pYiG~SAGsnia~pt  129 (233)
T PRK05282        108 EAVKNGTPYIGWSAGANVACPT  129 (233)
T ss_pred             HHHHCCCCEEEECCHHHHCCCC
T ss_conf             9998499779626415405786


No 276
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=52.62  E-value=13  Score=17.40  Aligned_cols=76  Identities=13%  Similarity=0.173  Sum_probs=41.3

Q ss_pred             CEEEEEEC-C----CCHHHHHHHHHHHCCCEEEEEC-------C-C---CCHHHHHHCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             86999988-9----7057889988886594069852-------8-9---8988997239979999853889999999753
Q gi|254780414|r    8 SKVLIIDF-G----SQFTQLIARRVRESKVYCEVIA-------F-K---NALDYFKEQNPQAIILSGSPASSLDIDSPQI   71 (520)
Q Consensus         8 ~~IlIlDf-G----SQytqLIaRriRelgVyseI~P-------~-~---~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~   71 (520)
                      .+|.|+-- .    .+..+.|.+.+++.|+.+-+-+       . +   .++.++. .+.+-+|--||-.+     -.+.
T Consensus         6 k~IgIi~k~~~~~a~~~~~~l~~~L~~~g~~v~ld~~~a~~l~~~~~~~~~~~~~~-~~~Dlvi~lGGDGT-----~L~a   79 (292)
T PRK03378          6 KCIGIVGHPRHPTALTTHEMLYRWLCTKGYEVIVEQQIAHELQLKNVKTGTLAEIG-QQADLAVVVGGDGN-----MLGA   79 (292)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCHHHHC-CCCCEEEEECCCHH-----HHHH
T ss_conf             89999952798589999999999999789989983478765299865547866853-05689999777889-----9999


Q ss_pred             CHHHHHCCCCEEEECHHH
Q ss_conf             768980899889977899
Q gi|254780414|r   72 PKEILESNIPLLGICYGQ   89 (520)
Q Consensus        72 ~~~I~~~~iPILGICyG~   89 (520)
                      .......++|||||-+|.
T Consensus        80 ar~~~~~~~PilGIN~G~   97 (292)
T PRK03378         80 ARTLARYDIKVIGINRGN   97 (292)
T ss_pred             HHHHCCCCCCEEEEECCC
T ss_conf             998543699689883798


No 277
>pfam05350 GSK-3_bind Glycogen synthase kinase-3 binding. Glycogen synthase kinase-3 (GSK-3) sequentially phosphorylates four serine residues on glycogen synthase (GS), in the sequence SxxxSxxxSxxx-SxxxS(p), by recognising and phosphorylating the first serine in the sequence motif SxxxS(P) (where S(p) represents a phosphoserine). Interaction of GSK-3 with a peptide derived from GSK-3 binding protein (this family) prevents GSK-3 interaction with Axin. This interaction thereby inhibits the Axin-dependent phosphorylation of beta-catenin by GSK-3.
Probab=52.38  E-value=11  Score=18.09  Aligned_cols=26  Identities=38%  Similarity=0.526  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHCCCCCCCCC
Q ss_conf             9873899999999819998894268889831
Q gi|254780414|r  372 KELFKDEVRLLGKELRLPDSFVERHPCPGPG  402 (520)
Q Consensus       372 ~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPG  402 (520)
                      -+|-|.-||.|-..-.+|.     ||||||+
T Consensus       135 GnLIkEAVrRlq~~~~~p~-----~~~~g~~  160 (160)
T pfam05350       135 GNLIKEAVRRLQFAAEPPD-----HDIPGSV  160 (160)
T ss_pred             CCHHHHHHHHHHHCCCCCC-----CCCCCCC
T ss_conf             5089999999883157987-----7677879


No 278
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR). Ligand-binding domain of DNA transcription repressor specific for xylose (XylR), a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of XylR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=51.96  E-value=18  Score=16.51  Aligned_cols=67  Identities=22%  Similarity=0.416  Sum_probs=41.3

Q ss_pred             EEEECCCCHH----HHHHHHHHHCCCEEEEECCCCC---HHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             9998897057----8899888865940698528989---88997239979999853889999999753768980899889
Q gi|254780414|r   11 LIIDFGSQFT----QLIARRVRESKVYCEVIAFKNA---LDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus        11 lIlDfGSQyt----qLIaRriRelgVyseI~P~~~~---~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      ++.|....|.    +=|.+..|+.|.+..+...+..   ++.+....++|||.+.        ..+.....+.+.++|+.
T Consensus         4 ll~disn~f~~~vi~GIe~~a~~~Gy~~il~~~~~~~~~~~~l~~~~VDGiI~~~--------~~~~~~~~l~~~~iPvV   75 (265)
T cd01543           4 LLVETSSSYGRGVLRGIARYAREHGPWSIYLEPRGLQEPLRWLKDWQGDGIIARI--------DDPEMAEALQKLGIPVV   75 (265)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCEEEEEC--------CCHHHHHHHHHCCCCEE
T ss_conf             9963887779999999999999749989998382348999999837988899727--------99899999984799599


Q ss_pred             EE
Q ss_conf             97
Q gi|254780414|r   84 GI   85 (520)
Q Consensus        84 GI   85 (520)
                      -|
T Consensus        76 ~i   77 (265)
T cd01543          76 DV   77 (265)
T ss_pred             EE
T ss_conf             98


No 279
>pfam08010 Phage_30_3 Bacteriophage protein GP30.3. Proteins in this family are bacteriophage GP30.3 proteins. Their function is poorly characterized.
Probab=51.60  E-value=18  Score=16.48  Aligned_cols=43  Identities=37%  Similarity=0.546  Sum_probs=27.2

Q ss_pred             EHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEECCCC
Q ss_conf             588999999668988899998875658999999997439--97099864622
Q gi|254780414|r  284 DASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIG--GAQFLGQGTLY  333 (520)
Q Consensus       284 da~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~--~~~~L~QGTly  333 (520)
                      ..-|-||..|| ..+||++|.+-.     .+-++|+..+  ..+|=+| |||
T Consensus        30 as~EGFLQ~lK-fk~pe~Qr~v~~-----l~Gk~AK~~G~k~~~~~~q-tLy   74 (146)
T pfam08010        30 ASMEGFLQSLK-FKNPEMQRHVCG-----LVGKAAKFRGKKKKWWRTQ-TLY   74 (146)
T ss_pred             CCHHHHHHHCC-CCCHHHHHHHHH-----HHHHHHHHCCCHHHHCCCC-CEE
T ss_conf             21899987724-798789899998-----7238888636244422466-047


No 280
>PRK04155 chaperone protein HchA; Provisional
Probab=51.50  E-value=13  Score=17.51  Aligned_cols=30  Identities=27%  Similarity=0.568  Sum_probs=14.6

Q ss_pred             CCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHH
Q ss_conf             622024542024677763034430232011320320223789
Q gi|254780414|r  331 TLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLK  372 (520)
Q Consensus       331 TlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~  372 (520)
                      |.+||-.|.+..            -.|.||..|.+.+-|-|+
T Consensus       212 t~FpDa~d~~t~------------~iGympG~l~w~l~e~L~  241 (288)
T PRK04155        212 CVFPDALDKQTP------------EIGYMPGHLTWLFGEELK  241 (288)
T ss_pred             EECCCHHHHCCC------------CCCCCCCCCCCHHHHHHH
T ss_conf             723986884464------------225578776307999998


No 281
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins. This group contains proteins similar to the aspartyl dipeptidases Salmonella typhimurium peptidase E and Xenopus laevis peptidase E and, extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB. In bacteria peptidase E is believed to play a role in degrading peptides generated by intracellular protein breakdown or imported into the cell as nutrient sources. Peptidase E uniquely hydrolyses only Asp-X dipeptides (where X is any amino acid), and one tripeptide Asp-Gly-Gly.  Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Peptidase E and cyanophycinases are thought to have a Ser-His-Glu catalytic triad which differs from
Probab=50.69  E-value=18  Score=16.38  Aligned_cols=90  Identities=13%  Similarity=0.161  Sum_probs=56.9

Q ss_pred             CCCEEEEEECCC----CHHHHHHHHHHHCCCEEEEECCCC---CHHHH-HHCCCCEEEECCCCCCCCC---CCC--CCCC
Q ss_conf             488699998897----057889988886594069852898---98899-7239979999853889999---999--7537
Q gi|254780414|r    6 RSSKVLIIDFGS----QFTQLIARRVRESKVYCEVIAFKN---ALDYF-KEQNPQAIILSGSPASSLD---IDS--PQIP   72 (520)
Q Consensus         6 ~~~~IlIlDfGS----QytqLIaRriRelgVyseI~P~~~---~~e~i-~~~~p~GIILSGGP~SV~d---~~a--p~~~   72 (520)
                      .+.+|+++...|    -|.....++.+.+|+....++...   +.+.. .-.+.++|+++||..+-+-   .+.  ...-
T Consensus        28 ~~~~i~~iptAs~~~~~~~~~~~~~~~~lG~~~~~l~~~~~a~~~~~~~~l~~ad~i~~~GG~~~~~~~~~~~t~~~~~l  107 (210)
T cd03129          28 AGARVLFIPTASGDRDEYGEEYRAAFERLGVEVVHLLLIDTANDPDVVARLLEADGIFVGGGNQLRLLSVLRETPLLDAI  107 (210)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCEEEECCCCHHHHHHHHHHCCHHHHH
T ss_conf             99649999489888089999999999974994887512256787169999971999998898899999999748899999


Q ss_pred             HHHHHCCCCEEEECHHHHHHHHH
Q ss_conf             68980899889977899998997
Q gi|254780414|r   73 KEILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        73 ~~I~~~~iPILGICyG~QlLa~~   95 (520)
                      .+.+..++++.|.-=|+-++...
T Consensus       108 ~~~~~~G~v~~G~SAGa~~~~~~  130 (210)
T cd03129         108 LKRVARGVVIGGTSAGAAVMGET  130 (210)
T ss_pred             HHHHHCCCEEEEECHHHHHCCCC
T ss_conf             99998499099735578862876


No 282
>CHL00148 orf27 Ycf27; Reviewed
Probab=50.10  E-value=19  Score=16.32  Aligned_cols=93  Identities=23%  Similarity=0.400  Sum_probs=59.2

Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHCCCCEEEECCC-CCCCCCCCCCCCCHHHH-HCC
Q ss_conf             6344886999988970578899888865940698528-98988997239979999853-88999999975376898-089
Q gi|254780414|r    3 KRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAF-KNALDYFKEQNPQAIILSGS-PASSLDIDSPQIPKEIL-ESN   79 (520)
Q Consensus         3 ~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~-~~~~e~i~~~~p~GIILSGG-P~SV~d~~ap~~~~~I~-~~~   79 (520)
                      ++..+.||||+|=-.+..++|...++..|..+..... ....+.+....|+-|||-=+ |    +.+...+-+++- ..+
T Consensus         2 ~~~~k~kILiVEDd~~l~~~l~~~L~~~G~~v~~a~~g~~a~~~~~~~~~DlviLDi~LP----~~dG~~l~~~iR~~~~   77 (240)
T CHL00148          2 KKSSKEKILVVDDEASIRRILETRLSIIGYEVITASDGEEALKLFHQEQPDLVILDVMMP----KLDGYGVCQEIRKESD   77 (240)
T ss_pred             CCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEECCCC----CCCCCEEEECCCCCCC
T ss_conf             989998299993989999999999997899999989999999999747999999979999----8886630541403799


Q ss_pred             CCEEEEC----HHHHHHHHHCCCE
Q ss_conf             9889977----8999989970969
Q gi|254780414|r   80 IPLLGIC----YGQQIMCQSLGGK   99 (520)
Q Consensus        80 iPILGIC----yG~QlLa~~~GG~   99 (520)
                      +||+=+.    ---++.|...|+.
T Consensus        78 ~PII~LTa~~~~~d~v~gl~~GAD  101 (240)
T CHL00148         78 VPIIMLTALGDVSDRITGLELGAD  101 (240)
T ss_pred             CCEEEEECCCCHHHHHHHHHCCCC
T ss_conf             548998167898999999976997


No 283
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=50.02  E-value=17  Score=16.68  Aligned_cols=66  Identities=18%  Similarity=0.186  Sum_probs=35.6

Q ss_pred             CHHHHHHHHHHHCCCEEEEEC-------CC--CCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHH
Q ss_conf             057889988886594069852-------89--898899723997999985388999999975376898089988997789
Q gi|254780414|r   18 QFTQLIARRVRESKVYCEVIA-------FK--NALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus        18 QytqLIaRriRelgVyseI~P-------~~--~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG   88 (520)
                      +..+.+++.+.+.|+.+-+-+       ..  .+...+...+++-+|--||-.++.     +. ......++|||||-+|
T Consensus        16 ~~a~~l~~~L~~~g~~v~ld~~~~~~~~~~~~~~~~~~~~~~~Dlvi~lGGDGT~L-----~a-~~~~~~~iPilGiN~G   89 (278)
T PRK03708         16 KLAYRVYDFLKVSGYEVVVDSDTYEHLPQFSEEDVLPLEEFDVDFILAIGGDGTIL-----RI-EHKTKKEIPILSINMG   89 (278)
T ss_pred             HHHHHHHHHHHHCCCEEEEEHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCHHHH-----HH-HHHCCCCCCEEEEECC
T ss_conf             99999999999889989997478656665555676754357878999987868999-----99-9964789988988358


Q ss_pred             H
Q ss_conf             9
Q gi|254780414|r   89 Q   89 (520)
Q Consensus        89 ~   89 (520)
                      .
T Consensus        90 ~   90 (278)
T PRK03708         90 T   90 (278)
T ss_pred             C
T ss_conf             7


No 284
>TIGR01819 F420_cofD LPPG:Fo 2-phospho-L-lactate transferase; InterPro: IPR010115   This entry represents LPPG:Fo 2-phospho-L-lactate transferase (CofD), which catalyses the fourth step in the biosynthesis of coenzyme F420, a flavin derivative found in methanogens, Mycobacteria, and several other lineages. This enzyme is characterised so far in Methanococcus jannaschii  but appears restricted to F420-containing species and is predicted to carry out the same function in these other species. .
Probab=49.94  E-value=18  Score=16.41  Aligned_cols=63  Identities=25%  Similarity=0.421  Sum_probs=39.2

Q ss_pred             HHHHHHHHCCC--CEEE--------EECC---------CCHHHHHHHHHHHHCCCC-----EEEEEECCCCCCCCCHHHH
Q ss_conf             99997650444--0366--------4056---------404779999998622365-----6999973895515627899
Q gi|254780414|r  213 VSRIKEQVGNE--RVIC--------AVSG---------GVDSTVAAFLIYEAIGIN-----LTCVLVDHGFMRKNEVENI  268 (520)
Q Consensus       213 i~~Ir~~vg~~--kVi~--------~lSG---------GVDStV~A~Ll~kAig~~-----l~~vfVD~GllRknE~~~v  268 (520)
                      +.-||+...|+  ||+.        ++||         |+|||++++  .++-++.     |=|..||++     ..+. 
T Consensus       255 l~Gire~Lrda~~kVVavSPIvG~~~vsGpA~Klm~A~G~dvsa~gV--ae~Y~dfCatG~lD~~vvD~~-----D~~~-  326 (359)
T TIGR01819       255 LPGIREALRDATVKVVAVSPIVGDKPVSGPAGKLMAAVGVDVSAAGV--AEHYGDFCATGLLDVLVVDEA-----DKAD-  326 (359)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHCCCCCCCCCCHHHH--HHHHHHHHCCCCEEEEEECCC-----CHHH-
T ss_conf             25689999836973899716406888758434204223436344899--998886520030346786012-----5589-


Q ss_pred             HHHHHHCCCCCEEEEE
Q ss_conf             9988623698579975
Q gi|254780414|r  269 ISLFKGYPNFPLRVVD  284 (520)
Q Consensus       269 ~~~~~~~~~~~l~~vd  284 (520)
                      ++.++. +|.....+|
T Consensus       327 ~~r~~~-~Gv~v~~t~  341 (359)
T TIGR01819       327 LDRVEA-LGVEVVATD  341 (359)
T ss_pred             HHHHHH-CCCEEEECC
T ss_conf             999984-796388816


No 285
>pfam01715 IPPT IPP transferase. This is a family of IPP transferases EC:2.5.1.8 also known as tRNA delta(2)-isopentenylpyrophosphate transferase. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37).
Probab=48.93  E-value=15  Score=16.92  Aligned_cols=98  Identities=14%  Similarity=0.330  Sum_probs=56.2

Q ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCC--EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--
Q ss_conf             998755010644111406789999999976504440--3664056404779999998622365699997389551562--
Q gi|254780414|r  189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNER--VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE--  264 (520)
Q Consensus       189 L~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~k--Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE--  264 (520)
                      ...++++++.....|+...|.+++.+.|.+....++  ++||-||   -=+=|+|               +|+--..+  
T Consensus        22 ipHhlid~~~~~e~~sv~~f~~~a~~~i~~i~~~~k~PIiVGGTg---lYl~all---------------~g~~~~p~~~   83 (253)
T pfam01715        22 VPHHLIDILDPTESYSAAEFQRDALEAIAEIRARGKIPLLVGGTG---LYFKALL---------------DGLSDTPSAD   83 (253)
T ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCH---HHHHHHH---------------CCCCCCCCCC
T ss_conf             997545566899876199999999999999996699728983808---9999997---------------6987788877


Q ss_pred             ---HHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHH--------HHHHHHHHHHHHHHHH
Q ss_conf             ---789999886236985799758899999966898889--------9998875658999999
Q gi|254780414|r  265 ---VENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE--------TKRKVIGQLFIEVFEE  316 (520)
Q Consensus       265 ---~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE--------~KRkiIG~~Fi~vf~~  316 (520)
                         .+++.+.+..         .-.+.+++.|+-+ |||        .+|+|+-.  +|||..
T Consensus        84 ~~~r~~~~~~~~~---------~g~~~l~~~L~~~-DP~~a~~i~~nd~~Ri~RA--lEi~~~  134 (253)
T pfam01715        84 PKVRAKLEEQLEE---------LGNDYLHAELASV-DPEAAAKIHPNDGRRIVRA--LEVFYA  134 (253)
T ss_pred             HHHHHHHHHHHHH---------HHHHHHHHHHHHH-CHHHHHCCCCCCHHHHHHH--HHHHHH
T ss_conf             7799999999998---------5199999999874-9697854796436678999--999999


No 286
>KOG3498 consensus
Probab=48.52  E-value=13  Score=17.46  Aligned_cols=20  Identities=40%  Similarity=0.791  Sum_probs=16.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHH
Q ss_conf             20223789873899999999
Q gi|254780414|r  365 MKLVEPLKELFKDEVRLLGK  384 (520)
Q Consensus       365 ~~liEPl~~l~KdEVR~lg~  384 (520)
                      .+++||+|+++||-.|-+-|
T Consensus         5 ~~~~~~~~~f~k~s~rf~kr   24 (67)
T KOG3498           5 DQLVEPLRDFAKDSIRFVKR   24 (67)
T ss_pred             HHHCCHHHHHHHHHHHHHHH
T ss_conf             77500389999999999998


No 287
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain.  AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal.  AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.
Probab=47.96  E-value=20  Score=16.09  Aligned_cols=54  Identities=17%  Similarity=0.327  Sum_probs=32.5

Q ss_pred             CCCHHHHHHCCCCEEEECCCCCCC---CCCCCCCCCH---HHHHCCCCEEEECHHHHHHHHH
Q ss_conf             989889972399799998538899---9999975376---8980899889977899998997
Q gi|254780414|r   40 KNALDYFKEQNPQAIILSGSPASS---LDIDSPQIPK---EILESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        40 ~~~~e~i~~~~p~GIILSGGP~SV---~d~~ap~~~~---~I~~~~iPILGICyG~QlLa~~   95 (520)
                      +.++++.  ..++-+|+.|+..+.   .....|.+..   ...+.+.++.|||-|.-+||.+
T Consensus        61 d~~~~~~--~~~D~livpg~~~~~~~~~~~~~~~l~~~L~~~~~~g~~i~sictGa~~LA~a  120 (195)
T cd03138          61 DATLADV--PAPDLVIVPGLGGDPDELLLADNPALIAWLRRQHANGATVAAACTGVFLLAEA  120 (195)
T ss_pred             CCCHHHC--CCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEECCCHHHHHHHHC
T ss_conf             8684456--65688997576678630123369999999998665271784165899999973


No 288
>TIGR00683 nanA N-acetylneuraminate lyase; InterPro: IPR005264    N-acetylneuraminate lyase catalyzes the cleavage of N-acetylneuraminic acid (sialic acid) to form pyruvate and N-acetyl-D-mannosamine. The enzyme plays an important role in the regulation of sialic acid metabolism in bacteria..
Probab=47.66  E-value=19  Score=16.27  Aligned_cols=57  Identities=12%  Similarity=0.238  Sum_probs=25.7

Q ss_pred             EEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             1232398317889863500112465212221520257799875501064411140678999999997650
Q gi|254780414|r  151 VIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQV  220 (520)
Q Consensus       151 viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~v  220 (520)
                      +|++++..+. .+.+-- -+-||..--|     +=.++.+|=  ++-+.+  +|..++-  +.++||+.-
T Consensus       122 II~~~~G~~M-~VY~IP-~L~GV~l~~~-----Q~~~L~~~P--~V~~~K--~T~GDlY--~lE~~~~~~  178 (294)
T TIGR00683       122 IIDEADGLNM-VVYSIP-ALSGVKLTLD-----QINELVKLP--KVLALK--FTAGDLY--LLERLKKEY  178 (294)
T ss_pred             HHHHCCCCCE-EEEECC-CCCCHHHHHH-----HHHHHHHCC--CCEEEE--ECCCHHH--HHHHHHHHC
T ss_conf             9852489823-787453-2012122188-----888875178--721452--0400588--999998755


No 289
>pfam04943 Pox_F11 Poxvirus F11 protein. The protein F11 is an early virus protein.
Probab=47.57  E-value=20  Score=16.05  Aligned_cols=85  Identities=19%  Similarity=0.249  Sum_probs=46.1

Q ss_pred             CCEEEECCCCCCCEEEEEECCC--CCCC--CCCCCCCCCEEEEEECCCHHHC----CC--CCCCEEECCCCCCEEEEEEC
Q ss_conf             9699986986610366752388--6222--7872665533686002201101----24--44211232398317889863
Q gi|254780414|r   97 GGKTKNSQSREFGRAFIEIKKN--CSLL--KGMWEKGSKQQVWMSHGDQVEH----IP--EGFEVIASSDSTPFAFIADE  166 (520)
Q Consensus        97 GG~V~~~~~~EyG~~~I~i~~~--~~lf--~gl~~~~~~~~VwmSH~D~V~~----lP--~gf~viA~S~~~~iaai~~~  166 (520)
                      +|....+..-+|++.++.+...  ..++  +|.++....+-|-+.||+...+    .|  -||..+--=.|.-++++.-+
T Consensus        55 ~~~~~~~~~~~y~~kkV~i~~~~l~~l~D~eg~Fev~d~~lvkL~HGn~f~~~~~~~~~s~gF~A~ICIkNeG~Sgi~V~  134 (366)
T pfam04943        55 TGSKTKSTLFTYSWKKVPVDSIKLRFLLDAEGYFEVSDCFLVKLEHGNGFMKGALYVDNSAGFTAVICIKNEGRSGIMVN  134 (366)
T ss_pred             CCCCCCCCCCCCCEEEECCCHHHHHHHHCCCCCEEHHHEEEEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEC
T ss_conf             75532124432313661256677766512247521124689996136751247511587455079999737870588737


Q ss_pred             ----------------CCCEEEEEEEEHHHC
Q ss_conf             ----------------500112465212221
Q gi|254780414|r  167 ----------------KRKYYAVQFHPEVVH  181 (520)
Q Consensus       167 ----------------~~~iyGVQFHPEV~h  181 (520)
                                      .+..+|+||=|.+-+
T Consensus       135 ~t~~l~~~m~~Gd~iVsRssrgi~fLPQIgG  165 (366)
T pfam04943       135 HTNVLQTNMQEGDYIVSRSSRGIQFLPQIGG  165 (366)
T ss_pred             CCCCEEEEEEECCEEEEEHHHHHHHHHHCCC
T ss_conf             9751355543067999860001232012176


No 290
>TIGR02079 THD1 threonine dehydratase; InterPro: IPR011820    This entry represents threonine dehydratase, the first step in the pathway converting threonine into isoleucine. At least two other clades of biosynthetic threonine dehydratases are described by IPR005787 from INTERPRO and IPR005789 from INTERPRO. The sequences described by this entry are exclusively found in species containing the rest of the isoleucine pathway and which are generally lacking in members of the other two clades of threonine dehydratases. The sequences associated with this entry are often cluster with other elements of the isoleucine pathway.; GO: 0004794 L-threonine ammonia-lyase activity, 0030170 pyridoxal phosphate binding, 0009097 isoleucine biosynthetic process.
Probab=47.09  E-value=9.6  Score=18.41  Aligned_cols=110  Identities=24%  Similarity=0.397  Sum_probs=65.8

Q ss_pred             HHHHH-HHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCC-CEEEEE------
Q ss_conf             99997-6504440366405640477999999862236569999738955156278999988623698-579975------
Q gi|254780414|r  213 VSRIK-EQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNF-PLRVVD------  284 (520)
Q Consensus       213 i~~Ir-~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~-~l~~vd------  284 (520)
                      .+..+ +++.++.|+|-+|||                       ||-.-|..|.++=--.|+   || +--.|+      
T Consensus       290 L~~~~r~ei~gKTVVC~vSGG-----------------------NNDi~R~~Ei~eRsl~y~---GLKhYFiv~FPQRpG  343 (415)
T TIGR02079       290 LEELSREEIKGKTVVCVVSGG-----------------------NNDIERTEEIRERSLLYE---GLKHYFIVRFPQRPG  343 (415)
T ss_pred             HHHHCHHCCCCCEEEEEEECC-----------------------CCCCCCCHHHHHHHHHHC---CCCEEEEECCCCCCC
T ss_conf             875122004697279995277-----------------------575331367898888731---770368752789886


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHH-
Q ss_conf             8899999966898889999887565899999999743997099864622024542024677763034430232011320-
Q gi|254780414|r  285 ASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM-  363 (520)
Q Consensus       285 a~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~-  363 (520)
                      |=.+||+.+=|=+|-           |--|| +.||-..              |.|+..=|  --..+.-|--||-++| 
T Consensus       344 ALreFln~vLGP~DD-----------IT~FE-Y~KK~nR--------------e~GpaliG--iel~~~~D~~GLL~Rm~  395 (415)
T TIGR02079       344 ALREFLNDVLGPNDD-----------ITKFE-YTKKSNR--------------ETGPALIG--IELSDKEDFEGLLERMA  395 (415)
T ss_pred             HHHHHHHHHCCCCCC-----------CCCCE-EEECCCC--------------CCCCEEEE--EECCCCCHHHHHHHHHH
T ss_conf             368876540678875-----------23310-0020147--------------87877998--75036100677999998


Q ss_pred             ----CCCHHHHHHHHHH
Q ss_conf             ----3202237898738
Q gi|254780414|r  364 ----DMKLVEPLKELFK  376 (520)
Q Consensus       364 ----~~~liEPl~~l~K  376 (520)
                          ....|+|=+.||.
T Consensus       396 A~~i~Y~~in~n~~L~~  412 (415)
T TIGR02079       396 AADIHYEAINENSILYE  412 (415)
T ss_pred             HCCCCEEEECCCHHHHH
T ss_conf             55994164088538898


No 291
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit; InterPro: IPR012715    Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacteria, GroEL/GroES. This family consists exclusively of the CCT alpha chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes.; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding.
Probab=46.81  E-value=16  Score=16.80  Aligned_cols=86  Identities=20%  Similarity=0.359  Sum_probs=49.1

Q ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCC-CCHHHHHHCC-------C-------CEEEEC-CCCCCCC
Q ss_conf             9863448869999889705788998888659406985289-8988997239-------9-------799998-5388999
Q gi|254780414|r    1 MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFK-NALDYFKEQN-------P-------QAIILS-GSPASSL   64 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~-~~~e~i~~~~-------p-------~GIILS-GGP~SV~   64 (520)
                      |.+.-++.||+.|||+=|-.++      .|||-  |+.-| ..+|.|....       .       .-|||+ +|=    
T Consensus       221 Mp~~i~~aKIA~LDF~L~K~k~------~lGv~--i~v~Dp~~LE~IR~~E~dI~k~Ri~~il~AGAnVvLTT~GI----  288 (540)
T TIGR02340       221 MPKRIKKAKIACLDFNLQKAKM------ALGVQ--IVVDDPAKLEKIRQREADITKERIKKILKAGANVVLTTGGI----  288 (540)
T ss_pred             CCHHHHCCCEEEEECCHHHHHH------HCCEE--EEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCH----
T ss_conf             5111101130322035132211------05338--87258578899988888899999999997499189807774----


Q ss_pred             CCCCCCCCHHHHHCCCCEEEE--CH--HHHHHHHHCCCEEEEC
Q ss_conf             999975376898089988997--78--9999899709699986
Q gi|254780414|r   65 DIDSPQIPKEILESNIPLLGI--CY--GQQIMCQSLGGKTKNS  103 (520)
Q Consensus        65 d~~ap~~~~~I~~~~iPILGI--Cy--G~QlLa~~~GG~V~~~  103 (520)
                      |+   -+.+.+.|.+  ++|+  |-  =|.-||++-||++-.+
T Consensus       289 DD---~c~K~fVEag--~mavRR~~K~DLk~iAKATG~~l~~t  326 (540)
T TIGR02340       289 DD---LCLKYFVEAG--AMAVRRCKKEDLKRIAKATGGTLVST  326 (540)
T ss_pred             HH---HHHHHHHHCC--EEEEECCCHHHHHHHHHHHCCHHHHH
T ss_conf             56---7612453246--04785047788898876625113013


No 292
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily. Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. The sugar-binding domain of the periplasmic proteins in this group is also homologous to the ligand-binding domain of eukaryotic receptors such as metabotropic glutamate receptor (mGluR), DNA-binding transcriptional repressors such as LacI and GalR.
Probab=46.59  E-value=21  Score=15.95  Aligned_cols=73  Identities=19%  Similarity=0.177  Sum_probs=43.7

Q ss_pred             EEEEEE--CCCCHHHHHHHH----HHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             699998--897057889988----88659406985289898-------89972399799998538899999997537689
Q gi|254780414|r    9 KVLIID--FGSQFTQLIARR----VRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEI   75 (520)
Q Consensus         9 ~IlIlD--fGSQytqLIaRr----iRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I   75 (520)
                      ||.++=  +...|-+.+.+-    -.++|+...+...+.+.       +.+...+++|||++....+.   -.|. -+++
T Consensus         1 kIa~~~~~~~~~f~~~~~~G~~~~A~~~G~~~~v~d~~~d~~~Q~~~i~~~i~~~vDgIii~p~d~~~---~~~~-l~~a   76 (273)
T cd06305           1 RIAVVRYGGSGDFDQAYLAGTKAEAEALGGDLRVYDAGGDDAKQADQIDQAIAQKVDAIIIQHGRAEV---LKPW-VKRA   76 (273)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCHHH---HHHH-HHHH
T ss_conf             98999717889799999999999999749989997399999999999999998599999994687144---4899-9999


Q ss_pred             HHCCCCEEEE
Q ss_conf             8089988997
Q gi|254780414|r   76 LESNIPLLGI   85 (520)
Q Consensus        76 ~~~~iPILGI   85 (520)
                      .+.+|||..+
T Consensus        77 ~~aGIPVV~~   86 (273)
T cd06305          77 LDAGIPVVAF   86 (273)
T ss_pred             HHCCCCEEEE
T ss_conf             9859978998


No 293
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=46.23  E-value=14  Score=17.25  Aligned_cols=124  Identities=17%  Similarity=0.191  Sum_probs=56.2

Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH-------------HHHHHHCCCEEE------------ECCC
Q ss_conf             979999853889999999753768980899889977899-------------998997096999------------8698
Q gi|254780414|r   51 PQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ-------------QIMCQSLGGKTK------------NSQS  105 (520)
Q Consensus        51 p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~-------------QlLa~~~GG~V~------------~~~~  105 (520)
                      .+-+|--||-.+     -.+....+...++|||||-+|.             +.+...+-|+..            +...
T Consensus        69 ~Dl~IvlGGDGT-----~L~aar~~~~~~iPilGIN~G~LGFLt~i~~~~~~~~l~~il~g~y~ie~R~~L~~~v~~~~~  143 (305)
T PRK02649         69 MKFAIVLGGDGT-----VLSAARQTAPCGIPLLTINTGHLGFLTEAYLNQLDEAIDQLLAGQYTIEERTMLTVSVMRGDQ  143 (305)
T ss_pred             CCEEEEECCCHH-----HHHHHHHHCCCCCCEEEEECCCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEEEEEECCCC
T ss_conf             339999837699-----999999853369978989448623404479889999999998299658886568999704895


Q ss_pred             CCC---CEEEEEECCCC--CCCCCCCCCCCCEEEEEECCCHH-HCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHH
Q ss_conf             661---03667523886--22278726655336860022011-0124442112323983178898635001124652122
Q gi|254780414|r  106 REF---GRAFIEIKKNC--SLLKGMWEKGSKQQVWMSHGDQV-EHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV  179 (520)
Q Consensus       106 ~Ey---G~~~I~i~~~~--~lf~gl~~~~~~~~VwmSH~D~V-~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV  179 (520)
                      .-+   .-.++.+.+..  .+. .+.-.-+...+...++|.+ ..-|.|-+.-+-|..+||-   +.+  +-+++.-|=.
T Consensus       144 ~~~~~~ALNdvvi~r~~~~~mi-~~~v~id~~~v~~~~~DGlIVsTPTGSTAYslSAGGPIv---~P~--~~~~vltPI~  217 (305)
T PRK02649        144 LRWEALSLNEMVLHREPLTSMC-HFEIAIGRHAPVDIAADGVILSTPTGSTAYSLSAGGPVI---TPD--VPVLQLTPIC  217 (305)
T ss_pred             EEEEEEECCEEEEECCCCCCEE-EEEEEECCEEEEEEECCEEEEECCCCHHHHHHHCCCCCC---CCC--CCEEEEECCC
T ss_conf             0300344141999657876518-999984999989996477999578870450553699540---799--8759995367


Q ss_pred             HCCCHH
Q ss_conf             215202
Q gi|254780414|r  180 VHTVGG  185 (520)
Q Consensus       180 ~hT~~G  185 (520)
                      -||-.-
T Consensus       218 PHsL~~  223 (305)
T PRK02649        218 PHSLAS  223 (305)
T ss_pred             CCCCCC
T ss_conf             664678


No 294
>PRK12338 hypothetical protein; Provisional
Probab=46.07  E-value=12  Score=17.60  Aligned_cols=117  Identities=21%  Similarity=0.251  Sum_probs=66.7

Q ss_pred             ECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEH----HHHHHHHHCCCCCHHHHHH
Q ss_conf             056404779999998622365699997389551562789999886236985799758----8999999668988899998
Q gi|254780414|r  229 VSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDA----SERFIRKLKNIVDPETKRK  304 (520)
Q Consensus       229 lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda----~~~Fl~~L~gv~DPE~KRk  304 (520)
                      =.--||+||+..  +..|-....-++.+|++=+.   +.+-+..+++ |--+.-+..    -..-|.+--||.|+++.  
T Consensus       189 ~N~nid~sV~~i--~~~I~~~~~~~~~~hsVddl---~~e~eII~~~-~~~i~dI~y~ipgfk~pl~r~v~v~d~~e~--  260 (320)
T PRK12338        189 KNDDIDRTVSKV--LSVIREVSVVVKLVHSVEDL---DVEDEIIKEN-NGRITDISYPIPGFKDPLKRSVNIYDRDEA--  260 (320)
T ss_pred             CCCCHHHHHHHH--HHHHHHHHEEEECCCCHHHH---HHHHHHHHHC-CCEEEEEEECCCCCCCCCEEECCCCCHHHH--
T ss_conf             476355689999--99999873465226768888---8878999973-975875100288757431234477870789--


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHHHHHH
Q ss_conf             875658999999997439970998646220245420246777630344302320113203202237898
Q gi|254780414|r  305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKE  373 (520)
Q Consensus       305 iIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liEPl~~  373 (520)
                         +.||++.+++-++-..     -++||.           .++.+-||+=-+.-++.++ .++|-|++
T Consensus       261 ---d~Fik~ln~~p~~ke~-----l~~lY~-----------lsn~vhsh~I~aPD~esl~-~ii~eL~~  309 (320)
T PRK12338        261 ---DKFIKILNEEKKSKED-----LKHLYS-----------LSNNVHSHKICAPDEESLN-RIIEELRE  309 (320)
T ss_pred             ---HHHHHHHHCCHHHHHH-----HHHHHH-----------HCCCCEEEEEECCCHHHHH-HHHHHHHH
T ss_conf             ---9999998308556789-----999998-----------6167325775179979999-99999886


No 295
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional
Probab=45.77  E-value=22  Score=15.86  Aligned_cols=96  Identities=20%  Similarity=0.359  Sum_probs=58.7

Q ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHH-C
Q ss_conf             986344886999988970578899888865940698528-98988997239979999853889999999753768980-8
Q gi|254780414|r    1 MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAF-KNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILE-S   78 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~-~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~-~   78 (520)
                      |.-.+...|||++|=--++.+.+...++..|..+..... ....+.+....|+-||+-=..-   +.+...+-+.+-+ .
T Consensus         4 ~~~~~~~~kILlVEDd~~l~~~l~~~L~~~g~~V~~a~~~~eal~~~~~~~~DliilDi~lp---~~~Gl~l~~~lr~~~   80 (240)
T PRK10710          4 LPIDENTPRILIVEDEPKLGQLLIDYLRAASYAPTLISHGDEVLPYVRQTPPDLILLDLMLP---GTDGLTLCREIRRFS   80 (240)
T ss_pred             CCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEECCCCC---CCCCCCCHHHHHCCC
T ss_conf             99999988799992989999999999998899999989999999999737998999879998---887763211221157


Q ss_pred             CCCEEEECHHH----HHHHHHCCCE
Q ss_conf             99889977899----9989970969
Q gi|254780414|r   79 NIPLLGICYGQ----QIMCQSLGGK   99 (520)
Q Consensus        79 ~iPILGICyG~----QlLa~~~GG~   99 (520)
                      ++||+=+.--.    ++.|...|+.
T Consensus        81 ~~piI~lta~~~~~~~~~al~~GAd  105 (240)
T PRK10710         81 DIPIVMVTAKIEEIDRLLGLEIGAD  105 (240)
T ss_pred             CCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             6468998167888999999986998


No 296
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group includes the ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group belongs to the the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=45.28  E-value=22  Score=15.81  Aligned_cols=62  Identities=6%  Similarity=0.106  Sum_probs=38.8

Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             05788998888659406985289898-------899723997999985388999999975376898089988997
Q gi|254780414|r   18 QFTQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        18 QytqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      +.-+-|.+..++.|+...+...+.+.       +.+...+++|||+.++..      .......+.+.++|+.-|
T Consensus        16 ~l~~gi~~~~~~~gy~~ll~~~~~~~~~e~~~i~~l~~~~vdgiIi~~~~~------~~~~~~~l~~~~iPvV~i   84 (270)
T cd06296          16 EVLRGVEEAAAAAGYDVVLSESGRRTSPERQWVERLSARRTDGVILVTPEL------TSAQRAALRRTGIPFVVV   84 (270)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC------CHHHHHHHHHCCCCEEEE
T ss_conf             999999999998499899997999969999999999954999999906889------999999999749999998


No 297
>PRK10991 fucI L-fucose isomerase; Provisional
Probab=44.28  E-value=23  Score=15.71  Aligned_cols=51  Identities=20%  Similarity=0.224  Sum_probs=31.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECC----CCCHHHHHHH
Q ss_conf             2237898738999999998199988942688898311122100----0367899999
Q gi|254780414|r  367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIG----EITEERINIL  419 (520)
Q Consensus       367 liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g----~vt~e~~~i~  419 (520)
                      .+-|.=++-.+|+.+.=..---+...  +-=|+|-|++-|-+-    .+|--|++++
T Consensus       410 ~mKp~w~it~~d~~~~l~aT~w~pa~--~eYFrGGGfSs~F~T~g~mPvTm~R~Nlv  464 (588)
T PRK10991        410 TMKPHWEISEQEADACLAATEWCPAI--HEYFRGGGYSSRFLTEGGVPFTMTRVNII  464 (588)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCHH--HCCCCCCCCCEEEECCCCCCEEEEEEEHH
T ss_conf             55676657999999998607047402--11025897430221279972365433113


No 298
>COG1609 PurR Transcriptional regulators [Transcription]
Probab=43.78  E-value=23  Score=15.65  Aligned_cols=75  Identities=16%  Similarity=0.245  Sum_probs=45.0

Q ss_pred             CCCCEEEEE--E----CCCCHHHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             448869999--8----89705788998888659406985289898-------8997239979999853889999999753
Q gi|254780414|r    5 ERSSKVLII--D----FGSQFTQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQI   71 (520)
Q Consensus         5 ~~~~~IlIl--D----fGSQytqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~   71 (520)
                      .++..|.++  |    |=++.-+-|.+..++.|....+.+.+.+.       +.+....++|||+.| ..    .+ ...
T Consensus        56 ~~s~~Ig~i~p~~~~~~~~~i~~gi~~~~~~~gy~~~l~~~~~~~~~e~~~~~~l~~~~vdGiIi~~-~~----~~-~~~  129 (333)
T COG1609          56 GRTKTIGLVVPDITNPFFAEILKGIEEAAREAGYSLLLANTDDDPEKEREYLETLLQKRVDGLILLG-ER----PN-DSL  129 (333)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEC-CC----CC-HHH
T ss_conf             7788899994687775899999999999998399899983789869999999999876989899935-87----88-088


Q ss_pred             CHHHHHCCCCEEEE
Q ss_conf             76898089988997
Q gi|254780414|r   72 PKEILESNIPLLGI   85 (520)
Q Consensus        72 ~~~I~~~~iPILGI   85 (520)
                      ...+.+.++|+.-|
T Consensus       130 ~~~l~~~~~P~V~i  143 (333)
T COG1609         130 LELLAAAGIPVVVI  143 (333)
T ss_pred             HHHHHHCCCCEEEE
T ss_conf             99998659998999


No 299
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia. This group includes the ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia.  This regulatory protein is a member of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial trans
Probab=43.70  E-value=23  Score=15.65  Aligned_cols=63  Identities=11%  Similarity=0.140  Sum_probs=39.6

Q ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             7057889988886594069852898988-------99723997999985388999999975376898089988997
Q gi|254780414|r   17 SQFTQLIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        17 SQytqLIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      ++..+-|.+.+++.|+...+...+.+.+       .+...+++|||+.+...     +.+ .-..+.+.++|+.-+
T Consensus        15 ~~~~~gi~~~~~~~gy~~ll~~s~~~~~~e~~~l~~l~~~~vDGiIi~~~~~-----~~~-~~~~l~~~~iPvV~i   84 (265)
T cd06299          15 ASLATAIQDAASAAGYSTIIGNSDENPETENRYLDNLLSQRVDGIIVVPHEQ-----SAE-QLEDLLKRGIPVVFV   84 (265)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCC-----CHH-HHHHHHHCCCCEEEE
T ss_conf             9999999999998599899997899989999999999947999999980679-----989-999999669989983


No 300
>TIGR02635 RhaI_grampos L-rhamnose isomerase; InterPro: IPR013457    The proteins in this entry are closely related to the L-rhamnose isomerases (IPR013451 from INTERPRO) found in Pseudomonas stutzeri  and in a number of the Rhizobiales. They are encoded in similar genomic contexts, close to genes apparently involved in rhamnose catabolism such as rhamnulose-1-phosphate aldolase (IPR013454 from INTERPRO), sugar kinases, and sugar transporters..
Probab=43.28  E-value=24  Score=15.60  Aligned_cols=144  Identities=15%  Similarity=0.236  Sum_probs=87.5

Q ss_pred             CCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCC-------------------HHH
Q ss_conf             4211232398317889863500112465212221520257799875501064411140-------------------678
Q gi|254780414|r  148 GFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVM-------------------SSY  208 (520)
Q Consensus       148 gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~-------------------~~~  208 (520)
                      |.++=|-+.|    -|++.+++ ||=--||+-.==.+-..=+=.-+ +|++-..+=.+                   ++.
T Consensus        82 Gl~~GaiNpN----lFQDDDYK-fGSlThp~~~iR~KAi~h~LeCv-dIa~~tGSkdisLWLADGTnYPGQdD~R~Rk~R  155 (382)
T TIGR02635        82 GLKLGAINPN----LFQDDDYK-FGSLTHPDKRIRRKAIDHLLECV-DIAKKTGSKDISLWLADGTNYPGQDDIRKRKDR  155 (382)
T ss_pred             CCCCCCCCCC----CCCCCCCC-CCCCCCHHHHHHHHHHHHHHHHH-HHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHH
T ss_conf             8844453787----67685435-56765734799999999999899-999860885256221057873588775447889


Q ss_pred             HHHHHHHHHHHHCCCCEEEE---------ECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-HHHHHHHH-H--HC
Q ss_conf             99999999765044403664---------056404779999998622365699997389551562-78999988-6--23
Q gi|254780414|r  209 HKEIVSRIKEQVGNERVICA---------VSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE-VENIISLF-K--GY  275 (520)
Q Consensus       209 ~~~~i~~Ir~~vg~~kVi~~---------lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE-~~~v~~~~-~--~~  275 (520)
                      +++..++|=+.++++.=++-         -.-=|====.|.++.+++|+|- -|.||+|=--.+- .|.|+..| .  +.
T Consensus       156 L~EsL~~vY~~l~~dmRlLiEYKFFEPAfY~TD~pDWGtAY~~~~kLG~rA-~VlVD~GHHa~GTNIE~IVA~LL~e~KL  234 (382)
T TIGR02635       156 LEESLAEVYEHLGDDMRLLIEYKFFEPAFYHTDIPDWGTAYALSKKLGDRA-LVLVDTGHHAQGTNIEFIVATLLDEKKL  234 (382)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCE-EEEEECCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             988899998516988778532204575344578333579999998548923-8986257798777489999988726765


Q ss_pred             CCCCEEEEEHHHHHHHHHCCCCCHH
Q ss_conf             6985799758899999966898889
Q gi|254780414|r  276 PNFPLRVVDASERFIRKLKNIVDPE  300 (520)
Q Consensus       276 ~~~~l~~vda~~~Fl~~L~gv~DPE  300 (520)
                      .|..+...-..+-  +-.-|-.||=
T Consensus       235 GGFhfNsrkYADD--DL~~Ga~nPy  257 (382)
T TIGR02635       235 GGFHFNSRKYADD--DLIVGAINPY  257 (382)
T ss_pred             CCCCCCCCCCCCH--HHHHHHCCHH
T ss_conf             6633455444435--7887501757


No 301
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=43.25  E-value=24  Score=15.60  Aligned_cols=69  Identities=19%  Similarity=0.285  Sum_probs=38.6

Q ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHH-HHHHCCCCCEEEEEHHHHHHHHH
Q ss_conf             9765044403664056404779999998622365699997389551562789999-88623698579975889999996
Q gi|254780414|r  216 IKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIIS-LFKGYPNFPLRVVDASERFIRKL  293 (520)
Q Consensus       216 Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~-~~~~~~~~~l~~vda~~~Fl~~L  293 (520)
                      +++.+.+.|||.|++  -+|+-.|.-+.+.+=+. .|+.-|   -|--|...+++ .|+   +.|+-.+|.=..-.+++
T Consensus       170 ~~el~~~~kVIgG~t--p~~~e~a~~lY~~iv~~-~~~vts---~~tAEm~Kl~EN~fR---dVNIALaNElali~~~~  239 (436)
T COG0677         170 LKELVNNPKVIGGVT--PKCAELAAALYKTIVEG-VIPVTS---ARTAEMVKLTENTFR---DVNIALANELALICNAM  239 (436)
T ss_pred             HHHHHCCCCEEECCC--HHHHHHHHHHHHHHEEE-EEECCC---HHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
T ss_conf             020201782353688--89999999999986177-997577---479999998863346---77899999999999982


No 302
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion]
Probab=43.02  E-value=24  Score=15.57  Aligned_cols=10  Identities=20%  Similarity=0.365  Sum_probs=5.6

Q ss_pred             CEEEECCCCC
Q ss_conf             7999985388
Q gi|254780414|r   52 QAIILSGSPA   61 (520)
Q Consensus        52 ~GIILSGGP~   61 (520)
                      |.=|+.||-.
T Consensus        46 KaQV~aGGRG   55 (387)
T COG0045          46 KAQVHAGGRG   55 (387)
T ss_pred             EEEEEECCCC
T ss_conf             9225305766


No 303
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1. This CD includes the putative rhodanese-related sulfurtransferases of several uncharacterized proteins.
Probab=42.54  E-value=24  Score=15.52  Aligned_cols=52  Identities=29%  Similarity=0.353  Sum_probs=35.0

Q ss_pred             HHHHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCH
Q ss_conf             789999999976504-44036640564047799999986223-656999973895515627
Q gi|254780414|r  207 SYHKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEV  265 (520)
Q Consensus       207 ~~~~~~i~~Ir~~vg-~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~  265 (520)
                      +|+++    +.+++. |..+++--..|+-|..||.+|.++ | ++  +..|..||.=-++.
T Consensus        52 ~f~~~----l~~~~~~d~~ivv~C~sG~RS~~Aa~~L~~~-Gf~n--V~ni~gGfeG~~~~  105 (117)
T cd01522          52 NFLAE----LEEKVGKDRPVLLLCRSGNRSIAAAEAAAQA-GFTN--VYNVLEGFEGDLDA  105 (117)
T ss_pred             HHHHH----HHHHCCCCCEEEEECCCCCHHHHHHHHHHHC-CCCC--EEEECCCCCCCCCC
T ss_conf             27899----9974599986999889981599999999985-9877--79818980358876


No 304
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational
Probab=42.39  E-value=24  Score=15.51  Aligned_cols=63  Identities=14%  Similarity=0.175  Sum_probs=38.3

Q ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             705788998888659406985289898-------899723997999985388999999975376898089988997
Q gi|254780414|r   17 SQFTQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        17 SQytqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      +|..+-|-+..++.|....+...+.+.       +.+...+++|||+.+.-      ..+.....+-+.++|+.-+
T Consensus        15 ~~~~~~ie~~~~~~Gy~~~i~~s~~d~~~e~~~i~~l~~~~vdGiIi~~~~------~~~~~~~~l~~~~iP~V~~   84 (268)
T cd06273          15 ARVIQAFQETLAAHGYTLLVASSGYDLDREYAQARKLLERGVDGLALIGLD------HSPALLDLLARRGVPYVAT   84 (268)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCC------CCHHHHHHHHHCCCCEEEE
T ss_conf             999999999999859999999589998999999999996599999991899------9989999999759989998


No 305
>pfam02142 MGS MGS-like domain. This domain composes the whole protein of methylglyoxal synthetase and the domain is also found in Carbamoyl phosphate synthetase (CPS) where it forms a regulatory domain that binds to the allosteric effector ornithine. This family also includes inosicase. The known structures in this family show a common phosphate binding site.
Probab=41.30  E-value=25  Score=15.40  Aligned_cols=60  Identities=22%  Similarity=0.202  Sum_probs=33.6

Q ss_pred             HHHHHHCCCEEEEECCCC---------CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             988886594069852898---------988997239979999853889999999753768980899889
Q gi|254780414|r   24 ARRVRESKVYCEVIAFKN---------ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus        24 aRriRelgVyseI~P~~~---------~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      ++.+++.|+-|+++-...         ..+.+...+.+-||-...|.+-...+...+...+.+.+||.+
T Consensus        23 a~~L~~~Gi~~~~v~k~~~~~~~~~~~i~d~i~~~~IdlVInt~~~~~~~~~dg~~iRr~a~~~~Ip~~   91 (92)
T pfam02142        23 AKFLKEAGIPTEVVNKTGEGRPGGRVQIGDLIKNGEIDLVINTLYPFKATVHDGYAIRRAAENIDIPLP   91 (92)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHCCCCCEEEECCCCCCEECCCCHHHHHHHHHCCCCCC
T ss_conf             999995599816863406899998476999998299519998389885112588789999992699854


No 306
>TIGR02613 mob_myst_B mobile mystery protein B; InterPro: IPR013436    Proteins in this entry, designated mobile mystery protein B, are more often encoded within mobilisation-related contexts than not. This includes a CRISPR-associated gene region in Geobacter sulfurreducens PCA, and plasmids in Agrobacterium tumefaciens and Coxiella burnetii. They are always found together with mobile mystery protein A (IPR013435 from INTERPRO), a helix-turn-helix putative DNA binding protein. This protein is encoded by the downstream member of the gene pair and belongs to the Fic protein family, where Fic (filamentation induced by cAMP) is a regulator of cell division. The characteristics of having a two-gene operon in a varied context, often on plasmids, with one member affecting cell division and the other able to bind DNA, suggests similarity to addiction modules..
Probab=40.97  E-value=8.8  Score=18.66  Aligned_cols=21  Identities=29%  Similarity=0.447  Sum_probs=14.5

Q ss_pred             CCHHHHCCCCCC-CCCCEEEEC
Q ss_conf             998894268889-831112210
Q gi|254780414|r  388 LPDSFVERHPCP-GPGLAIRCI  408 (520)
Q Consensus       388 lp~~~~~RhPFP-GPGLaiRi~  408 (520)
                      +.+-||.=|||| |=|=-.|++
T Consensus       115 fHHRLV~iHPFaNGNGRHAR~~  136 (189)
T TIGR02613       115 FHHRLVAIHPFANGNGRHARLA  136 (189)
T ss_pred             HHCCEEEECCCCCCCHHHHHHH
T ss_conf             4100023347978864689999


No 307
>pfam01513 NAD_kinase ATP-NAD kinase. Members of this family include ATP-NAD kinases EC:2.7.1.23, which catalyses the phosphorylation of NAD to NADP utilising ATP and other nucleoside triphosphates as well as inorganic polyphosphate as a source of phosphorus. Also includes NADH kinases EC:2.7.1.86.
Probab=40.66  E-value=18  Score=16.52  Aligned_cols=39  Identities=23%  Similarity=0.439  Sum_probs=26.3

Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH
Q ss_conf             97239979999853889999999753768980899889977899
Q gi|254780414|r   46 FKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ   89 (520)
Q Consensus        46 i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~   89 (520)
                      +.+.+++-||.=||-.     -..+......+.++|+|||-+|.
T Consensus        31 ~~~~~~Dlii~lGGDG-----T~L~~~~~~~~~~~PilGin~G~   69 (243)
T pfam01513        31 MVEEGVDLIVVLGGDG-----TALDAARLLGDHDIPILGINTGT   69 (243)
T ss_pred             HHCCCCCEEEEECCCH-----HHHHHHHHHCCCCCCEEEEECCC
T ss_conf             3055988999989878-----99999998456799589985697


No 308
>cd01141 TroA_d Periplasmic binding protein TroA_d.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=40.63  E-value=26  Score=15.32  Aligned_cols=42  Identities=19%  Similarity=0.264  Sum_probs=28.4

Q ss_pred             CCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEEC
Q ss_conf             898988997239979999853889999999753768980899889977
Q gi|254780414|r   39 FKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGIC   86 (520)
Q Consensus        39 ~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGIC   86 (520)
                      .+.+.|.+..++|+-||.+++..      .......+-++++|++-+.
T Consensus        58 ~~pn~E~ilaL~PDlVi~~~~~~------~~~~~~~L~~~gI~v~~~~   99 (186)
T cd01141          58 GSLNVELIVALKPDLVILYGGFQ------AQTILDKLEQLGIPVLYVN   99 (186)
T ss_pred             CCCCHHHHHHHCCCEEEEECCCC------CHHHHHHHHHCCCCEEEEE
T ss_conf             89899999970999999958878------6789999996499579960


No 309
>KOG0912 consensus
Probab=40.60  E-value=26  Score=15.32  Aligned_cols=127  Identities=21%  Similarity=0.282  Sum_probs=80.4

Q ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCC--H
Q ss_conf             9987550106441114067899999999765044403664056404779999998622-365699997389551562--7
Q gi|254780414|r  189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI-GINLTCVLVDHGFMRKNE--V  265 (520)
Q Consensus       189 L~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAi-g~~l~~vfVD~GllRknE--~  265 (520)
                      |-||.-+-|..++  .+...-+++-+.++++--+.||+.|   -||+---+.|..|-- .+-=|-=.+-||.|-+.|  .
T Consensus        17 fv~FyAdWCrFSq--~L~piF~EAa~~~~~e~P~~kvvwg---~VDcd~e~~ia~ky~I~KyPTlKvfrnG~~~~rEYRg   91 (375)
T KOG0912          17 FVNFYADWCRFSQ--MLKPIFEEAAAKFKQEFPEGKVVWG---KVDCDKEDDIADKYHINKYPTLKVFRNGEMMKREYRG   91 (375)
T ss_pred             EEEEEHHHCHHHH--HHHHHHHHHHHHHHHHCCCCCEEEE---ECCCCHHHHHHHHHCCCCCCEEEEEECCCHHHHHHCC
T ss_conf             6663301135888--8768899999999986888645998---7055315677654100348614665543013134313


Q ss_pred             ----HHHHHHHHHCCCCCEEEEEHHHHH--HHHHCCCCCHHHHHHHHHHHH------HHHHHHHHHHCC-CCEEE
Q ss_conf             ----899998862369857997588999--999668988899998875658------999999997439-97099
Q gi|254780414|r  266 ----ENIISLFKGYPNFPLRVVDASERF--IRKLKNIVDPETKRKVIGQLF------IEVFEEEAKKIG-GAQFL  327 (520)
Q Consensus       266 ----~~v~~~~~~~~~~~l~~vda~~~F--l~~L~gv~DPE~KRkiIG~~F------i~vf~~~a~~~~-~~~~L  327 (520)
                          +...+..++.+.      |+=+.|  ++.|.+..+|+ ||-+||--=      .+.|.+.|.-+. +..|+
T Consensus        92 ~RsVeaL~efi~kq~s------~~i~Ef~sl~~l~n~~~p~-K~~vIgyF~~kdspey~~~~kva~~lr~dc~f~  159 (375)
T KOG0912          92 QRSVEALIEFIEKQLS------DPINEFESLDQLQNLDIPS-KRTVIGYFPSKDSPEYDNLRKVASLLRDDCVFL  159 (375)
T ss_pred             CHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             2139999999999743------6888877389988520645-564999844679936899999999876321799


No 310
>TIGR01264 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR005957   This entry describes tyrosine aminotransferase (2.6.1.5 from EC) as found in animals and Trypanosoma cruzi (Euglenozoa). It is the first enzyme of a pathway of tyrosine degradation via homogentisate.  L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate.; GO: 0004838 tyrosine transaminase activity, 0030170 pyridoxal phosphate binding, 0009072 aromatic amino acid family metabolic process.
Probab=40.57  E-value=9.5  Score=18.43  Aligned_cols=92  Identities=23%  Similarity=0.373  Sum_probs=42.2

Q ss_pred             CCEEEEEECC------CCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6569999738------9551562789999886236985799758899999966898889999887565899999999743
Q gi|254780414|r  248 INLTCVLVDH------GFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKI  321 (520)
Q Consensus       248 ~~l~~vfVD~------GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~  321 (520)
                      |+-.|+.|+|      +--++.-.+++..+-.+ ..+.+. -|  |. +.-                   =||.   -|.
T Consensus       176 d~T~~l~vnNPSNPcGSvF~~~Hl~~l~a~A~~-~~Lpi~-AD--EI-Y~~-------------------~VF~---GkD  228 (415)
T TIGR01264       176 DKTKALIVNNPSNPCGSVFRREHLEELLALAER-LKLPII-AD--EI-YGD-------------------MVFK---GKD  228 (415)
T ss_pred             CCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH-CCCCEE-EE--EE-CCC-------------------CCCC---CCC
T ss_conf             674078883757788988787889999999875-387236-64--20-256-------------------5138---867


Q ss_pred             CCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHH-----CCC--HHHHHHHHHHHHHHH
Q ss_conf             997099864622024542024677763034430232011320-----320--223789873899999
Q gi|254780414|r  322 GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM-----DMK--LVEPLKELFKDEVRL  381 (520)
Q Consensus       322 ~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~-----~~~--liEPl~~l~KdEVR~  381 (520)
                      ++++|.+--+|-|.|==            =   --||+-+++     .+.  |+.-=++.+.||+|.
T Consensus       229 PnatF~~lA~L~s~VP~------------~---~cgG~AKr~lVPGWRLGWli~hd~~~~~~~e~~~  280 (415)
T TIGR01264       229 PNATFTPLASLSSKVPI------------L---SCGGLAKRWLVPGWRLGWLIIHDRKGVLRDEVKD  280 (415)
T ss_pred             CCCCEEEECCCCCCCCE------------E---EECCCCCCCCCCCCCCCCEEEECCCCCCCHHHHH
T ss_conf             86422020237799886------------8---7076320022476110247888788865026889


No 311
>TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854    This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems. It appears to be an accessory protein involved in maturation rather than a regulatory protein involved in expression. HypE shows considerable homology to the thiamine-monophosphate kinase ThiL (IPR006283 from INTERPRO) and other enzymes..
Probab=40.36  E-value=16  Score=16.75  Aligned_cols=43  Identities=26%  Similarity=0.305  Sum_probs=22.0

Q ss_pred             HHHCCCCEEE---ECHHHHHHHHHCCCEEEECCCC--CCCEEE-EEECC
Q ss_conf             9808998899---7789999899709699986986--610366-75238
Q gi|254780414|r   75 ILESNIPLLG---ICYGQQIMCQSLGGKTKNSQSR--EFGRAF-IEIKK  117 (520)
Q Consensus        75 I~~~~iPILG---ICyG~QlLa~~~GG~V~~~~~~--EyG~~~-I~i~~  117 (520)
                      |++-|.|+=-   |==-|+--|+..|=++..+.++  |-|+.+ |.|++
T Consensus        99 IlEEGfp~e~L~~iv~Sm~~~A~~aGV~iV~GDTKVV~kG~~D~iFINT  147 (345)
T TIGR02124        99 ILEEGFPIEDLERIVKSMAEAARKAGVKIVAGDTKVVEKGKVDGIFINT  147 (345)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCEEEEEE
T ss_conf             1340787678999999999999973976897573533457756058813


No 312
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=40.34  E-value=26  Score=15.29  Aligned_cols=86  Identities=14%  Similarity=0.089  Sum_probs=46.4

Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCH---HHH-----------------HHCCCCEEEECCCCC
Q ss_conf             863448869999889705788998888659406985289898---899-----------------723997999985388
Q gi|254780414|r    2 HKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNAL---DYF-----------------KEQNPQAIILSGSPA   61 (520)
Q Consensus         2 ~~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~---e~i-----------------~~~~p~GIILSGGP~   61 (520)
                      .....+.+|+|+-.|- -..-.+|.+++.|....+..-+...   +..                 ...+++-||+|.|=.
T Consensus         2 ~~~~~~~kv~V~GLG~-sG~a~a~~L~~~G~~v~v~D~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~~~~d~vV~SPGi~   80 (448)
T COG0771           2 MEDFQGKKVLVLGLGK-SGLAAARFLLKLGAEVTVSDDRPAPEGLAAQPLLLEGIEVELGSHDDEDLAEFDLVVKSPGIP   80 (448)
T ss_pred             CCCCCCCEEEEEECCC-CCHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHCCCCEEECCCCCHHCCCCCCEEEECCCCC
T ss_conf             5100599799992665-109999999977986999838987653234444203722313764110013477899899999


Q ss_pred             CCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHC
Q ss_conf             99999997537689808998899778999989970
Q gi|254780414|r   62 SSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSL   96 (520)
Q Consensus        62 SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~   96 (520)
                          .+.|.+. +....++||+|-   .++-....
T Consensus        81 ----~~~p~v~-~A~~~gi~i~~d---ieL~~r~~  107 (448)
T COG0771          81 ----PTHPLVE-AAKAAGIEIIGD---IELFYRLS  107 (448)
T ss_pred             ----CCCHHHH-HHHHCCCCEEEH---HHHHHHHC
T ss_conf             ----9888999-999869937748---88898744


No 313
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=40.33  E-value=15  Score=17.11  Aligned_cols=102  Identities=15%  Similarity=0.290  Sum_probs=53.2

Q ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCC-CCCHHHHH
Q ss_conf             87550106441114067899999999765044403664056404779999998622365699997389551-56278999
Q gi|254780414|r  191 NFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMR-KNEVENII  269 (520)
Q Consensus       191 NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllR-knE~~~v~  269 (520)
                      .++++++.....|+...|.++..+.|++....+++-..+ ||---=+      +|+=         +|+-. .....++.
T Consensus        61 Hhli~~~~~~e~~sv~~f~~~a~~~i~~i~~~~kiPIiV-GGTglYl------~aLl---------~g~~~~p~~~~~ir  124 (304)
T PRK00091         61 HHLIDILDPTESYSAADFQRDALAAIEDITARGKLPILV-GGTGLYF------KALL---------EGLSFLPPADPEVR  124 (304)
T ss_pred             CEEEEEECCCCCEEHHHHHHHHHHHHHHHHHCCCCCEEE-CCCHHHH------HHHH---------CCCCCCCCCCHHHH
T ss_conf             124345658875449999999999999999769987898-0838999------9997---------18777888898999


Q ss_pred             HHHHHCCCCCEEEEEHHHHHHHHHCCCCCHH--------HHHHHHHHHHHHHHHH
Q ss_conf             9886236985799758899999966898889--------9998875658999999
Q gi|254780414|r  270 SLFKGYPNFPLRVVDASERFIRKLKNIVDPE--------TKRKVIGQLFIEVFEE  316 (520)
Q Consensus       270 ~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE--------~KRkiIG~~Fi~vf~~  316 (520)
                      +.+......     ...+.+++.|+-+ ||+        .+|+++-.  ++|+..
T Consensus       125 ~~l~~~~~~-----~g~~~l~~~L~~~-Dp~~a~~I~~nd~~Rl~RA--lEv~~~  171 (304)
T PRK00091        125 AELEALAAE-----EGWEALHAELAEI-DPVAAARIHPNDPQRIIRA--LEVYEL  171 (304)
T ss_pred             HHHHHHHHH-----HCHHHHHHHHHHH-CHHHHHHCCCCCHHHHHHH--HHHHHH
T ss_conf             999999997-----5899999999875-9999961598612679999--999999


No 314
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component; InterPro: IPR014350   The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) ,  is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars.   The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC . These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).    The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.    An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose , , , .    According to structural and sequence analyses, the PTS EIIB domain (2.7.1.69 from EC) can be divided in five groups , , :  The PTS EIIB type 1 domain, which is found in the Glucose class of PTS, has an average length of about 80 amino acids. It forms a split alpha/beta sandwich composed of an antiparallel sheet (beta 1 to beta 4) and three alpha helices superimposed onto one side of the sheet. The phosphorylation site (Cys) is located at the end of the first beta strand on a protrusion formed by the edge of beta 1 and the reverse turn between beta 1 and beta 2 . The PTS EIIB type 2 domain, which is found in the Mannitol class of PTS, has an average length of about 100 amino acids. It consists of a four stranded parallel beta sheet flanked by two alpha helices (alpha 1 and 3) on one face and helix alpha 2 on the opposite face, with a characteristic Rossmann fold comprising two right-handed beta-alpha-beta motifs. The phosphorylation site (Cys) is located at the N-terminus of the domain, in the first beta strand.  The PTS EIIB type 3 domain, which is found in the Lactose class of PTS, has an average length of about 100 amino acids. It is composed of a central four-stranded parallel open twisted beta sheet, which is flanked by three alpha helices on the concave side and two on the convex side of the beta sheet. The phosphorylation site (Cys) is located in the C-terminal end of the first beta strand . The PTS EIIB type 4 domain, which is found in the Mannose class of PTS, has an average length of about 160 amino acids. It has a central core of seven parallel beta strands surrounded by a total of six alpha-helices. Three helices cover the front face, one the back face with the remaining two capping the central beta sheet at the top and bottom. The phosphorylation site (His) is located at the suface exposed loop between strand 1 and helix 1 .  The PTS EIIB type 5 domain, which is found in the Sorbitol class of PTS, has an average length of about 190 amino acids. The phosphorylation site (Cys) is located in the N-terminus of the domain.      The EIIB type 3 protein is often found downstream of EIIC type 3. This entry hits fewer proteins than IPR013012 from INTERPRO. .
Probab=40.19  E-value=26  Score=15.28  Aligned_cols=71  Identities=18%  Similarity=0.424  Sum_probs=45.4

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHH----HCCCEEEE--ECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCC
Q ss_conf             48869999889705788998888----65940698--5289898899723997999985388999999975376898089
Q gi|254780414|r    6 RSSKVLIIDFGSQFTQLIARRVR----ESKVYCEV--IAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESN   79 (520)
Q Consensus         6 ~~~~IlIlDfGSQytqLIaRriR----elgVyseI--~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~   79 (520)
                      ....||+|=-|+--|-|++.+++    |-|+-..|  +|++..-+.++.  .+=|||  ||+.-|.  .+.+.+.-=.+|
T Consensus        45 n~~~iLl~CaaGmstsLLv~~l~k~A~~~~~~~~i~A~~~~~~~e~~~~--~d~VlL--aPQ~~~~--~~~lk~~t~~~G  118 (142)
T TIGR00853        45 NETNILLLCAAGMSTSLLVNKLNKAAKEYGVPVKIAAVSYGAAMEILDD--ADVVLL--APQVAYM--LPDLKKETDKKG  118 (142)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHH--HCEEEE--HHHHHHH--HHHHHHHCCCCC
T ss_conf             3211688876973547899999999984599758884057634433535--043112--0326755--799998513589


Q ss_pred             CCE
Q ss_conf             988
Q gi|254780414|r   80 IPL   82 (520)
Q Consensus        80 iPI   82 (520)
                      |||
T Consensus       119 ip~  121 (142)
T TIGR00853       119 IPV  121 (142)
T ss_pred             CCE
T ss_conf             753


No 315
>PRK05569 flavodoxin; Provisional
Probab=40.06  E-value=26  Score=15.27  Aligned_cols=50  Identities=22%  Similarity=0.309  Sum_probs=32.9

Q ss_pred             CEEEEEECCCCH--HHHHHH----HHHHCCCEEEEECC-CCCHHHHHHCCCCEEEECCCCC
Q ss_conf             869999889705--788998----88865940698528-9898899723997999985388
Q gi|254780414|r    8 SKVLIIDFGSQF--TQLIAR----RVRESKVYCEVIAF-KNALDYFKEQNPQAIILSGSPA   61 (520)
Q Consensus         8 ~~IlIlDfGSQy--tqLIaR----riRelgVyseI~P~-~~~~e~i~~~~p~GIILSGGP~   61 (520)
                      .||+|+ |+|+|  |+.+|+    -+++.|+-.+++.. +.+.+++.  +.++|+| |+|.
T Consensus         2 ~Kv~Iv-Y~S~~GnTe~mA~~IaeG~~~~G~ev~v~~~~~~~~~di~--~~d~i~~-GspT   58 (141)
T PRK05569          2 KKVSII-YWSCGGNVEVLANTIADGAKEAGAEVTIKHVADAKVEDVL--EADAVAF-GSPS   58 (141)
T ss_pred             CEEEEE-EECCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHH--HCCEEEE-ECCC
T ss_conf             749999-9899608999999999999976981999984239988997--1890599-0545


No 316
>pfam01949 DUF99 Protein of unknown function DUF99. The function of this archaebacterial protein family is unknown.
Probab=39.93  E-value=26  Score=15.25  Aligned_cols=74  Identities=22%  Similarity=0.257  Sum_probs=41.7

Q ss_pred             CCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH----HHHHHHHCC-CCCHHHHHH
Q ss_conf             64047799999986223-656999973895515627899998862369857997588----999999668-988899998
Q gi|254780414|r  231 GGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS----ERFIRKLKN-IVDPETKRK  304 (520)
Q Consensus       231 GGVDStV~A~Ll~kAig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~----~~Fl~~L~g-v~DPE~KRk  304 (520)
                      +|-|+|=+.+=+-+... +++.+||.|-=-.----.-.+..++++ +++++++|-.+    +..-++|+- ..|+|++.+
T Consensus        44 dG~DaT~~i~~mv~~~~~~~i~~V~L~Git~aGFNvvD~~~l~~~-tg~PVI~V~~~~p~~~~ie~AL~khf~d~~~R~~  122 (185)
T pfam01949        44 DGDDATDAIIDLVKGKFRPDIRVILLDGITFGGFNIIDIEELYEE-TGLPVIVVMRKEPDLEGIESALRKHFPDDEERLK  122 (185)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCEEEEECCEEEEEEEEECHHHHHHH-HCCCEEEEEEECCCHHHHHHHHHHHCCCHHHHHH
T ss_conf             795279999999984355662299987762531488459999998-7998899997379868999999987899899999


Q ss_pred             H
Q ss_conf             8
Q gi|254780414|r  305 V  305 (520)
Q Consensus       305 i  305 (520)
                      +
T Consensus       123 ~  123 (185)
T pfam01949       123 I  123 (185)
T ss_pred             H
T ss_conf             9


No 317
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This model describes dihydroorotate dehydrogenase subfamily 2 and includes members from bacteria and eukaryotes. The subfamilies 1 and 2 share extensive homology, particularly toward the C-terminus, however subfamily 2 has a longer N-terminal region.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0016020 membrane.
Probab=39.71  E-value=27  Score=15.23  Aligned_cols=66  Identities=27%  Similarity=0.417  Sum_probs=40.4

Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC------HHHHHHHHHH
Q ss_conf             067899999999765044403664056404779999998622365699997389551562------7899998862
Q gi|254780414|r  205 MSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE------VENIISLFKG  274 (520)
Q Consensus       205 ~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE------~~~v~~~~~~  274 (520)
                      +..--.++|+++-..++++-+|.+ +|||||.-.|.===+| |--|.=+|  +||-=+++      .+++...+++
T Consensus       284 L~~kS~eiirrL~~~~~gr~piIg-VGGI~~~~~A~EkI~A-GASLlQ~Y--sgfIy~GP~l~k~i~~~i~~lL~~  355 (370)
T TIGR01036       284 LQKKSTEIIRRLYKELKGRLPIIG-VGGISSAQNALEKIKA-GASLLQIY--SGFIYKGPPLVKEIVKEIEKLLKE  355 (370)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEE-ECCCCCHHHHHHHHHH-CCHHHHHH--HCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             447789999999999649578996-2785747889999984-71244564--234667716799999999999751


No 318
>pfam04031 Las1 Las1-like. Las1 is an essential nuclear protein involved in cell morphogenesis and cell surface growth.
Probab=39.63  E-value=18  Score=16.44  Aligned_cols=58  Identities=28%  Similarity=0.461  Sum_probs=41.3

Q ss_pred             CHHHHHH-HHHHHHHHHHHHHHCCCHHHHC-CCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             0223789-8738999999998199988942-688898311122100036789999999999999999864
Q gi|254780414|r  366 KLVEPLK-ELFKDEVRLLGKELRLPDSFVE-RHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKA  433 (520)
Q Consensus       366 ~liEPl~-~l~KdEVR~lg~~Lglp~~~~~-RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l~~~  433 (520)
                      .+++|.. --|+.-+..+++++|||+.+|+ ||---        =|+  --.+++||.|-....+-|++.
T Consensus        85 gl~d~~Q~~~~a~s~~~~A~~iglP~~lVdlRH~~t--------H~~--LPsl~~LR~aa~~aL~WL~~~  144 (149)
T pfam04031        85 GLLDPTQQGQYAIPMRKLAKEIGLPEWFVELRHEAT--------HEE--LPSLEVLRQAAKLALDWLWDN  144 (149)
T ss_pred             HCCCHHHCCCHHCCHHHHHHHCCCCHHHHHHHHHHH--------HCC--CCCHHHHHHHHHHHHHHHHHH
T ss_conf             414187554111359999988399699999997875--------245--998899999999999999986


No 319
>pfam01633 Choline_kinase Choline/ethanolamine kinase. Choline kinase catalyses the committed step in the synthesis of phosphatidylcholine by the CDP-choline pathway. This alignment covers the protein kinase portion of the protein. The divergence of this family makes it very difficult to create a model that specifically predicts choline/ethanolamine kinases only. However if Choline_kinase_C is also present then it is definitely a member of this family.
Probab=39.52  E-value=27  Score=15.21  Aligned_cols=15  Identities=33%  Similarity=0.476  Sum_probs=5.0

Q ss_pred             EEEEEECCCCHHHHH
Q ss_conf             699998897057889
Q gi|254780414|r    9 KVLIIDFGSQFTQLI   23 (520)
Q Consensus         9 ~IlIlDfGSQytqLI   23 (520)
                      ++++==||-..-++|
T Consensus         4 ~vl~Ri~G~~te~~I   18 (208)
T pfam01633         4 KVLVRIYGAGTELFI   18 (208)
T ss_pred             EEEEECCCCCCCCEE
T ss_conf             899985889857507


No 320
>COG4468 GalT Galactose-1-phosphate uridyltransferase [Carbohydrate transport and metabolism]
Probab=39.47  E-value=27  Score=15.20  Aligned_cols=132  Identities=22%  Similarity=0.428  Sum_probs=77.7

Q ss_pred             EEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH-----------HHHHHCCCC---EEEEE----CCCCCHHHHHHCC
Q ss_conf             99758899999966898889999887565899999-----------999743997---09986----4622024542024
Q gi|254780414|r  281 RVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFE-----------EEAKKIGGA---QFLGQ----GTLYPDVIESISF  342 (520)
Q Consensus       281 ~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~-----------~~a~~~~~~---~~L~Q----GTlypDvIES~~~  342 (520)
                      ..+++.+.-|++-..-+|++.          .++-           -.|++.++-   +..+.    --.|||=|=--  
T Consensus       321 ~L~~lAd~il~~Wr~YSDe~~----------~I~a~T~dtpHnTITPIARkR~~~yELDlVLRnNrT~e~yPdGIFHP--  388 (503)
T COG4468         321 ELIKLADKILKKWREYSDEEV----------QILAYTGDTPHNTITPIARKRGGLYELDLVLRNNRTSEEYPDGIFHP--  388 (503)
T ss_pred             HHHHHHHHHHHHHHHHCCHHC----------CEEECCCCCCCCCCCHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCC--
T ss_conf             899999999999987254200----------30001589887655625440488057888973587643378766687--


Q ss_pred             CCCCCCEEEEEECCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCC-----------------HHHHCCCCCCCCCCEE
Q ss_conf             67776303443023201132032022378987389999999981999-----------------8894268889831112
Q gi|254780414|r  343 FGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLP-----------------DSFVERHPCPGPGLAI  405 (520)
Q Consensus       343 ~~~~~~~IKsHHNvgglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp-----------------~~~~~RhPFPGPGLai  405 (520)
                       -.--+.||- -|. ||.+.|++.++-| |  .|.|++++++.|-=.                 ..+..+||+       
T Consensus       389 -H~evhhIKK-ENI-GLIEVMGLAiLP~-R--LK~El~~va~yL~~~~~~~~~~~~~~kH~~Wa~~~ke~~~~-------  455 (503)
T COG4468         389 -HQEVHHIKK-ENI-GLIEVMGLAILPG-R--LKEELEEVAEYLLGEKKKINEDSDTAKHLEWAKALKEKYPN-------  455 (503)
T ss_pred             -CHHHHHHHH-HCC-CHHEEECHHHCCH-H--HHHHHHHHHHHHHCCHHHHHCCHHHHHHHHHHHHHHHHCCC-------
T ss_conf             -677633544-135-4311110320773-5--47999999999850222220020377789999999974677-------


Q ss_pred             EECCCCCHHHHH-HHH-HHHHHHHHHHHHCCCHHHHHHH
Q ss_conf             210003678999-999-9999999999864653332201
Q gi|254780414|r  406 RCIGEITEERIN-ILR-ESDAIYREEIHKAGIYRKIWQA  442 (520)
Q Consensus       406 Ri~g~vt~e~~~-i~r-~ad~i~~~~l~~~~ly~~~~q~  442 (520)
                           +++|.++ |++ ++-.+|...|+.+|.|....+-
T Consensus       456 -----i~~E~v~~ivk~evG~vFarVLedAGVfK~t~~G  489 (503)
T COG4468         456 -----IKKENVDEIVKEEVGEVFARVLEDAGVFKRTESG  489 (503)
T ss_pred             -----CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHH
T ss_conf             -----4188899999999989999999754710258146


No 321
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.
Probab=39.44  E-value=27  Score=15.20  Aligned_cols=56  Identities=25%  Similarity=0.450  Sum_probs=38.0

Q ss_pred             CEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCC-CC-----CCHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             011246521222152025779987550106441-11-----406789999999976504440366405
Q gi|254780414|r  169 KYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQD-NW-----VMSSYHKEIVSRIKEQVGNERVICAVS  230 (520)
Q Consensus       169 ~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~-~W-----~~~~~~~~~i~~Ir~~vg~~kVi~~lS  230 (520)
                      -+=|||-|-     -+|- +|..||....+-.. .|     +=-.|..+.++.||+.||.+.|-+=+|
T Consensus       165 GfDgVEiHa-----aHGy-Ll~qFLSp~~N~RtDeYGGS~eNR~Rf~~Eii~aIR~~vg~d~i~vRlS  226 (338)
T cd02933         165 GFDGVEIHG-----ANGY-LIDQFLRDGSNKRTDEYGGSIENRARFLLEVVDAVAEAIGADRVGIRLS  226 (338)
T ss_pred             CCCEEEEEC-----CCHH-HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             999999822-----4406-8998538532689897899989998999999999999729870899965


No 322
>COG1513 CynS Cyanate lyase [Inorganic ion transport and metabolism]
Probab=39.43  E-value=24  Score=15.51  Aligned_cols=28  Identities=32%  Similarity=0.446  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHC---CCCCCC
Q ss_conf             8738999999998199988942---688898
Q gi|254780414|r  373 ELFKDEVRLLGKELRLPDSFVE---RHPCPG  400 (520)
Q Consensus       373 ~l~KdEVR~lg~~Lglp~~~~~---RhPFPG  400 (520)
                      .+--||+|++|..|||+++.+-   --|.-|
T Consensus        47 ~~~~~ear~v~e~L~L~~~~v~~L~~~p~rg   77 (151)
T COG1513          47 ALPADEARAVGEALDLDEDAILLLQMIPLRG   77 (151)
T ss_pred             CCCHHHHHHHHHHHCCCHHHHHHHHCCCCCC
T ss_conf             2899999999998199878899842167567


No 323
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=39.27  E-value=27  Score=15.18  Aligned_cols=67  Identities=18%  Similarity=0.236  Sum_probs=44.2

Q ss_pred             EECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             9889705788998888659406985289898899723997999985388999999975376898089988997
Q gi|254780414|r   13 IDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        13 lDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      ++|=++...-+...-++.|..-.+.+.+...+.+.....+|+||..-.     .+.|.+ ..+.+.++|+.=|
T Consensus        19 ~~FF~e~~~~ve~~A~~~gy~liL~~~~~~~~~l~~~~VDGvIl~~~~-----~~d~~i-~~L~~~~iP~V~i   85 (269)
T cd06287          19 LGFMMEVAAAAAESALERGLALCLVPPHEADSPLDALDIDGAILVEPM-----ADDPQV-ARLRQRGIPVVSI   85 (269)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEEECCC-----CCCHHH-HHHHHCCCCEEEE
T ss_conf             642999999999999986998999479986556875879989990378-----897799-9999769999998


No 324
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=38.91  E-value=27  Score=15.14  Aligned_cols=67  Identities=22%  Similarity=0.233  Sum_probs=38.4

Q ss_pred             ECCCCHHHH----HHHHHHHCCCEEEEEC--CCCCHH-------HHHHCCCCEEEECCCCCCCCCCCC-CCCCHHHHHCC
Q ss_conf             889705788----9988886594069852--898988-------997239979999853889999999-75376898089
Q gi|254780414|r   14 DFGSQFTQL----IARRVRESKVYCEVIA--FKNALD-------YFKEQNPQAIILSGSPASSLDIDS-PQIPKEILESN   79 (520)
Q Consensus        14 DfGSQytqL----IaRriRelgVyseI~P--~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~a-p~~~~~I~~~~   79 (520)
                      +..+.|-..    +.+.-+++|+...++.  .+.+.+       .+...+++|||++..     +.++ ...-++..+.+
T Consensus         8 ~~~npf~~~v~~G~e~aA~~~G~~v~~~~~~~~~d~~~q~~~i~~~i~~~vDgIii~p~-----~~~~~~~~l~~a~~~g   82 (273)
T cd06310           8 GTTSDFWQAVKAGAEAAAKELGVKVTFQGPASETDVAGQVNLLENAIARGPDAILLAPT-----DAKALVPPLKEAKDAG   82 (273)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECC-----CCHHHHHHHHHHHHCC
T ss_conf             99985999999999999998099899972899789999999999999749999999168-----7144799999999849


Q ss_pred             CCEEEE
Q ss_conf             988997
Q gi|254780414|r   80 IPLLGI   85 (520)
Q Consensus        80 iPILGI   85 (520)
                      ||+.-+
T Consensus        83 IPvV~~   88 (273)
T cd06310          83 IPVVLI   88 (273)
T ss_pred             CCEEEE
T ss_conf             985898


No 325
>pfam04362 Iron_traffic Bacterial Fe(2+) trafficking. This is a family of bacterial Fe(2+) trafficking proteins.
Probab=38.84  E-value=16  Score=16.78  Aligned_cols=43  Identities=16%  Similarity=0.200  Sum_probs=27.2

Q ss_pred             CCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99988942688898311122100036789999999999999999
Q gi|254780414|r  387 RLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEI  430 (520)
Q Consensus       387 glp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i~~~~l  430 (520)
                      +-.-+=+.+.||||| ||-||..+|.++-=+.=..-...+++|-
T Consensus        10 ~~e~egL~~pP~PG~-lG~~I~~~vSk~AW~~W~~~QTmLINE~   52 (87)
T pfam04362        10 GKEAEGLDFPPYPGE-LGKRIYDNVSKEAWQEWLKHQTMLINEK   52 (87)
T ss_pred             CCCCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             684778999999968-8899999988999999999758774112


No 326
>pfam00365 PFK Phosphofructokinase.
Probab=38.74  E-value=8.1  Score=18.93  Aligned_cols=42  Identities=14%  Similarity=0.297  Sum_probs=27.1

Q ss_pred             CEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHH
Q ss_conf             799998538899999997537689808998899778999989
Q gi|254780414|r   52 QAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMC   93 (520)
Q Consensus        52 ~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa   93 (520)
                      -||+.||||.++...-.-.+-....+.+.-++|+..|.+=|.
T Consensus         3 I~IltsGG~~pG~Na~i~~vv~~a~~~g~~v~G~~~G~~GL~   44 (279)
T pfam00365         3 IGVLTSGGDAPGMNAAIRAVVRSAIAEGLEVYGIYEGYAGLV   44 (279)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             999907888667899999999999877999999905677882


No 327
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=38.40  E-value=28  Score=15.09  Aligned_cols=75  Identities=13%  Similarity=0.162  Sum_probs=45.4

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHH----------------CCCCEEEECCCCCCCCCCC
Q ss_conf             344886999988970578899888865940698528989889972----------------3997999985388999999
Q gi|254780414|r    4 RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKE----------------QNPQAIILSGSPASSLDID   67 (520)
Q Consensus         4 ~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~----------------~~p~GIILSGGP~SV~d~~   67 (520)
                      +-+..+|+|+=+| .-..-.||-+++.|....+..  ...+....                .+.+.||+|.|=.    .+
T Consensus         6 ~~~gk~v~v~GlG-~sG~s~a~~L~~~G~~V~~~D--~~~~~~~~~~~~g~~~~~~~~~~~~~~~~iV~SPGIp----~~   78 (457)
T PRK01390          6 SFKGKTVALFGLG-GSGLATARALKAGGAEVIAWD--DNPDSVAKAAAAGIATADLRTADWSQFAALVLSPGVP----LT   78 (457)
T ss_pred             CCCCCEEEEEEEC-HHHHHHHHHHHHCCCEEEEEE--CCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCC----CC
T ss_conf             0289989999436-999999999997899799993--9920668998759831455412320387899999888----65


Q ss_pred             CCC---CCHHHHHCCCCEEEE
Q ss_conf             975---376898089988997
Q gi|254780414|r   68 SPQ---IPKEILESNIPLLGI   85 (520)
Q Consensus        68 ap~---~~~~I~~~~iPILGI   85 (520)
                      .|.   +-....+.++||++=
T Consensus        79 ~p~~~~~v~~a~~~gi~v~se   99 (457)
T PRK01390         79 HPKPHWTVDLARAAGVEVIGD   99 (457)
T ss_pred             CCCCHHHHHHHHHCCCEEEEH
T ss_conf             667319999999859918600


No 328
>PRK05568 flavodoxin; Provisional
Probab=38.21  E-value=28  Score=15.07  Aligned_cols=50  Identities=28%  Similarity=0.425  Sum_probs=32.2

Q ss_pred             CEEEEEECCCC--HHHHH----HHHHHHCCCEEEEECCC-CCHHHHHHCCCCEEEECCCCC
Q ss_conf             86999988970--57889----98888659406985289-898899723997999985388
Q gi|254780414|r    8 SKVLIIDFGSQ--FTQLI----ARRVRESKVYCEVIAFK-NALDYFKEQNPQAIILSGSPA   61 (520)
Q Consensus         8 ~~IlIlDfGSQ--ytqLI----aRriRelgVyseI~P~~-~~~e~i~~~~p~GIILSGGP~   61 (520)
                      .||+|+ |.|.  .|..+    +.-+++.|+-.+++... .+.+++.  +.++|+| |+|.
T Consensus         2 ~kv~Iv-Y~S~~GnTe~mA~~Iaegl~~~Gv~V~~~~~~~~~~~di~--~~d~i~~-GspT   58 (142)
T PRK05568          2 KKLNII-YWSGTGNTEAMANLIAEGAKENGLEVKLLNVSEASVDDVE--NADVVAL-GSPA   58 (142)
T ss_pred             CEEEEE-EECCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHH--HCCEEEE-ECCC
T ss_conf             729999-9899854999999999999866983999980049988997--3996899-4776


No 329
>cd01021 GEWL Goose Egg White Lysozyme domain. Eukaryotic "goose-type" lysozymes (GEWL). These enzymes catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc).  Members include tunicate, Japanese flounder, ostrich, and mouse.
Probab=38.17  E-value=27  Score=15.22  Aligned_cols=46  Identities=13%  Similarity=0.228  Sum_probs=37.2

Q ss_pred             EEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             52122215202577998755010644111406789999999976504
Q gi|254780414|r  175 FHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVG  221 (520)
Q Consensus       175 FHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg  221 (520)
                      |-+| .|-.+|.+||-.|+..|-.--|+|+.+-.+.--|..-..-+|
T Consensus        90 w~Se-eHi~Q~t~IL~~~I~~i~~kfP~Wt~eQ~LkGGiaAYn~G~~  135 (166)
T cd01021          90 WDSE-EHLSQATEILIDRIKAIQRKFPTWTKEQQLKGGISAYNAGAG  135 (166)
T ss_pred             CCHH-HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             7789-999999999999999999708999978887788999842766


No 330
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain. A subgroup of AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain.  This group contains proteins similar to the Pseudomonas aeruginosa ArgR regulator.  ArgR functions in the control of expression of certain genes of arginine biosynthesis and catabolism. AraC regulators are defined by a AraC-type helix-turn-helix DNA binding domain at their C-terminal.  AraC family transcriptional regulators are widespread among bacteria and are involved in regulating diverse and important biological functions, including carbon metabolism, stress responses and virulence in different microorganisms. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with typical GATase1domains a reactive cys residue is found in some sequences in the sharp turn betwee
Probab=38.13  E-value=28  Score=15.06  Aligned_cols=53  Identities=15%  Similarity=0.208  Sum_probs=34.7

Q ss_pred             CCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHH---HHCCCCEEEECHHHHHHHHH
Q ss_conf             989889972399799998538899999997537689---80899889977899998997
Q gi|254780414|r   40 KNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEI---LESNIPLLGICYGQQIMCQS   95 (520)
Q Consensus        40 ~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I---~~~~iPILGICyG~QlLa~~   95 (520)
                      +..++..  ..++-+|+-||+..... ..|.+...+   .+.+..+.++|-|..++|.+
T Consensus        56 ~~~~~~~--~~~D~liV~Gg~~~~~~-~~~~~~~~L~~~~~~g~~v~svctGa~~LA~a  111 (185)
T cd03136          56 DAALEDA--PPLDYLFVVGGLGARRA-VTPALLAWLRRAARRGVALGGIDTGAFLLARA  111 (185)
T ss_pred             CCCHHHC--CCCCEEEECCCCCCCCC-CCHHHHHHHHHHHHCCCEEEEECHHHHHHHHC
T ss_conf             7670016--76789998788880214-79999999999987099899864799999981


No 331
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase; InterPro: IPR003733   Thiamine monophosphate synthase (TMP) (2.5.1.3 from EC) catalyzes the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl)thiazole phosphate to yield thiamine phosphate in the thiamine biosynthesis pathway .   TENI, a protein from Bacillus subtilis that regulates the production of several extracellular enzymes by reducing alkaline protease production belongs to this group .; GO: 0004789 thiamin-phosphate diphosphorylase activity, 0009228 thiamin biosynthetic process.
Probab=37.93  E-value=28  Score=15.04  Aligned_cols=73  Identities=25%  Similarity=0.352  Sum_probs=48.1

Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH-CCC----C--CHHHHHHHHHHHHH--------HHHHHHHH--HCCC
Q ss_conf             156278999988623698579975889999996-689----8--88999988756589--------99999997--4399
Q gi|254780414|r  261 RKNEVENIISLFKGYPNFPLRVVDASERFIRKL-KNI----V--DPETKRKVIGQLFI--------EVFEEEAK--KIGG  323 (520)
Q Consensus       261 RknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L-~gv----~--DPE~KRkiIG~~Fi--------~vf~~~a~--~~~~  323 (520)
                      |.-+++++.++-++ .++++.+=|-=+.=+.-= .||    +  .++.=|+|+|..-|        +-..+.+.  --..
T Consensus        51 ~~~~A~~l~~lc~~-y~~~f~vND~vdlA~~~~ADGvHlGQ~D~p~~~aR~l~G~~~iiG~S~~~~~e~~~a~~C~~~~g  129 (210)
T TIGR00693        51 RLELAEKLRELCRK-YGVPFIVNDRVDLALALGADGVHLGQDDLPVSEARKLLGPDKIIGVSTHNLEELAEAAACELKEG  129 (210)
T ss_pred             HHHHHHHHHHHHHH-CCCCEEECCHHHHHHHHCCCEEEECCCCCCHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             99999999999987-08976882839999983798776678889989999853899579853379899999998764078


Q ss_pred             CEEEEECCCCC
Q ss_conf             70998646220
Q gi|254780414|r  324 AQFLGQGTLYP  334 (520)
Q Consensus       324 ~~~L~QGTlyp  334 (520)
                      ++|++=|++||
T Consensus       130 aDY~G~Gp~fp  140 (210)
T TIGR00693       130 ADYIGVGPIFP  140 (210)
T ss_pred             CCEEEECCCCC
T ss_conf             98888637115


No 332
>pfam04937 DUF659 Protein of unknown function (DUF 659). Transposase-like protein with no known function.
Probab=37.71  E-value=29  Score=15.02  Aligned_cols=55  Identities=24%  Similarity=0.328  Sum_probs=41.1

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             215202577998755010644111406789999999976504440366405640477999
Q gi|254780414|r  180 VHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAA  239 (520)
Q Consensus       180 ~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A  239 (520)
                      .|++.|..    |+ +-..++......+++-+.+.++-+.||.++|+--++-.-.+.+.|
T Consensus        54 V~~~~g~~----FL-kSvD~S~~~~~~~~l~~ll~~vIeEVG~~nVVqVvTdn~~~~~~a  108 (153)
T pfam04937        54 VYCPAGTV----FL-KSVDASDIKKDADYLFELLDSVVEEVGSENVVQVITDNASNYKAA  108 (153)
T ss_pred             EECCCCCE----EE-EEEECCCCCCCHHHHHHHHHHHHHHHCCHHEEEEEECCCHHHHHH
T ss_conf             98799868----99-987625664749999999999999947112689994397017999


No 333
>KOG4380 consensus
Probab=37.43  E-value=24  Score=15.55  Aligned_cols=21  Identities=29%  Similarity=0.240  Sum_probs=8.4

Q ss_pred             HCCCCEEEECHHHHHHHHHCCC
Q ss_conf             0899889977899998997096
Q gi|254780414|r   77 ESNIPLLGICYGQQIMCQSLGG   98 (520)
Q Consensus        77 ~~~iPILGICyG~QlLa~~~GG   98 (520)
                      +.+.|. -||--.-.|-..+|.
T Consensus        66 ~~~~P~-~~~~R~~AID~~L~~   86 (244)
T KOG4380          66 DVNCPF-KIQDRQEAIDWLLGL   86 (244)
T ss_pred             HCCCCC-CCCCHHHHHHHHHHH
T ss_conf             719996-542489999999999


No 334
>pfam04409 DUF530 Protein of unknown function (DUF530). Family of hypothetical archaeal proteins.
Probab=37.34  E-value=20  Score=16.09  Aligned_cols=10  Identities=20%  Similarity=0.368  Sum_probs=3.8

Q ss_pred             EEEEEECCCC
Q ss_conf             6999973895
Q gi|254780414|r  250 LTCVLVDHGF  259 (520)
Q Consensus       250 l~~vfVD~Gl  259 (520)
                      +.-++.+||=
T Consensus       198 i~i~~~EnGr  207 (512)
T pfam04409       198 LEVEYLENGK  207 (512)
T ss_pred             EEEEEEECCC
T ss_conf             9999950770


No 335
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily. Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily.  In most cases, ligands are monosaccharide including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor. In this case, the domain sugar binding changes the DNA binding activity of the repressor domain.
Probab=37.13  E-value=29  Score=14.95  Aligned_cols=62  Identities=19%  Similarity=0.261  Sum_probs=39.2

Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCCC-------HHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             0578899888865940698528989-------8899723997999985388999999975376898089988997
Q gi|254780414|r   18 QFTQLIARRVRESKVYCEVIAFKNA-------LDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        18 QytqLIaRriRelgVyseI~P~~~~-------~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      +.-.-|.+..++.|....+.+.+.+       ++.+...+++|+|+.+...     +.+ ....+.+.++|+.-+
T Consensus        16 ~~~~gi~~~a~~~gy~~~i~~~~~~~~~~~~~i~~l~~~~vDgiIi~~~~~-----~~~-~~~~~~~~~iPvV~~   84 (264)
T cd06267          16 ELLRGIEEAAREAGYSVLLCNSDEDPEKEREALELLLSRRVDGIILAPSRL-----DDE-LLEELAALGIPVVLV   84 (264)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCC-----CHH-HHHHHHHCCCCEEEE
T ss_conf             999999999998699899997899989999999999957999999678889-----989-999999869988999


No 336
>PRK06110 hypothetical protein; Provisional
Probab=37.02  E-value=29  Score=14.95  Aligned_cols=48  Identities=19%  Similarity=0.162  Sum_probs=18.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEE
Q ss_conf             366405640477999999862236569999738955156278999988623698579
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLR  281 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~  281 (520)
                      |+++=||--=-+|++  ..+..|-+.+-+      |-.+=+.+-.+..+. +|-++.
T Consensus        73 vv~aSsGNhg~avA~--aA~~~G~~~~I~------mP~~a~~~K~~~i~~-~GAeVv  120 (321)
T PRK06110         73 VISATRGNHGQSLAF--AARRHGLAATIV------VPHGNSVEKNAAMRA-LGAELI  120 (321)
T ss_pred             EEEECCCHHHHHHHH--HHHHHCCCEEEE------CCCCCCHHHHHHHHH-HCCCEE
T ss_conf             899568649999999--999939817997------778885999999998-289628


No 337
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266   This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic. ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=36.99  E-value=18  Score=16.39  Aligned_cols=43  Identities=19%  Similarity=0.424  Sum_probs=32.2

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHH----CC--CCEEEECCCCC
Q ss_conf             8970578899888865940698528989889972----39--97999985388
Q gi|254780414|r   15 FGSQFTQLIARRVRESKVYCEVIAFKNALDYFKE----QN--PQAIILSGSPA   61 (520)
Q Consensus        15 fGSQytqLIaRriRelgVyseI~P~~~~~e~i~~----~~--p~GIILSGGP~   61 (520)
                      =||++.+||.-.||| |   +|+|-..|.+.|.+    ..  -+..++=|=|-
T Consensus        41 ~GSe~g~lI~~~Ike-G---~IVPs~VTv~LL~kai~~~~W~~~~FLIDGFPR   89 (189)
T TIGR01359        41 EGSENGELIESYIKE-G---KIVPSEVTVELLKKAIKEDGWSSKKFLIDGFPR   89 (189)
T ss_pred             CCCCCCCHHHHHHHC-C---CEEHHEEEHHHHHHHHHHCCCCCCCEEECCCCC
T ss_conf             478885037744115-8---311122324588877763156788236625788


No 338
>TIGR02025 BchH magnesium chelatase, H subunit; InterPro: IPR011771    This entry represents the H subunit of the magnesium chelatase complex responsible for magnesium insertion into the protoporphyrin IX ring in the biosynthesis of both chlorophyll and bacteriochlorophyll. In chlorophyll-utilizing species, this gene is known as ChlH, while in bacteriochlorophyll-utilizing spoecies it is called BchH. Subunit H is the largest (~140kDa) of the three subunits (the others being BchD/ChlD and BchI/ChlI), and is known to bind protoporphyrin IX. Subunit H is homologous to the CobN subunit of cobaltochelatase and by anology with that enzyme, subunit H is believed to also bind the magnesium ion which is inserted into the ring. In conjunction with the hydrolysis of ATP by subunits I and D, a conformation change is believed to happen in subunit H causing the magnesium ion insertion into the distorted protoporphyrin ring .; GO: 0016851 magnesium chelatase activity, 0015995 chlorophyll biosynthetic process.
Probab=36.62  E-value=25  Score=15.37  Aligned_cols=22  Identities=9%  Similarity=0.179  Sum_probs=12.4

Q ss_pred             CCCHHHHHHHHHHHCCCEEEEECC
Q ss_conf             970578899888865940698528
Q gi|254780414|r   16 GSQFTQLIARRVRESKVYCEVIAF   39 (520)
Q Consensus        16 GSQytqLIaRriRelgVyseI~P~   39 (520)
                      .|=|.  +.+|+..-|+-.+=+|-
T Consensus       508 ~SL~~--~L~~LK~~GY~V~~lPe  529 (1384)
T TIGR02025       508 ESLYE--LLKRLKDEGYDVGDLPE  529 (1384)
T ss_pred             HHHHH--HHHHHHHCCCCCCCCCC
T ss_conf             89999--99998626887245778


No 339
>pfam11116 DUF2624 Protein of unknown function (DUF2624). This family is conserved in the Bacillaceae family. Several members are named as YqfT. The function is not known.
Probab=36.52  E-value=25  Score=15.44  Aligned_cols=49  Identities=20%  Similarity=0.491  Sum_probs=35.3

Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             156278999988623698579975889999996689888999988756589
Q gi|254780414|r  261 RKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFI  311 (520)
Q Consensus       261 RknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi  311 (520)
                      -.+.+++|...++.. .+|+---++.++.++.|.-+|||+.-+. +-++|-
T Consensus        32 T~~QA~~I~~~lrgk-~inifn~~eR~k~lk~la~iTsp~tA~~-vn~Lf~   80 (84)
T pfam11116        32 TRAQAKQIAKLLRGK-NINIFNESERSKLLKELAKITSPQTAQE-VNELFA   80 (84)
T ss_pred             CHHHHHHHHHHHHCC-CCCCCCHHHHHHHHHHHHHHCCHHHHHH-HHHHHH
T ss_conf             889999999998526-7898998999999999998648989999-999999


No 340
>PRK05723 flavodoxin; Provisional
Probab=36.17  E-value=30  Score=14.85  Aligned_cols=46  Identities=17%  Similarity=0.195  Sum_probs=27.2

Q ss_pred             EEEEEECCCCHH--HHH----HHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEE
Q ss_conf             699998897057--889----988886594069852898988997239979999
Q gi|254780414|r    9 KVLIIDFGSQFT--QLI----ARRVRESKVYCEVIAFKNALDYFKEQNPQAIIL   56 (520)
Q Consensus         9 ~IlIlDfGSQyt--qLI----aRriRelgVyseI~P~~~~~e~i~~~~p~GIIL   56 (520)
                      ||.|| ||||+.  +-+    ++++++.|..+.+.+. .+++.+....++-+++
T Consensus         2 ki~Il-ygS~tGnAe~vA~~~~~~l~~~g~~~~~~~~-~~~~~~~~~~~~~~li   53 (151)
T PRK05723          2 KVAIL-SGSVYGTAEEVARHAESLLKAAGFEAWHNPR-ASLQDLLAFAPEALLA   53 (151)
T ss_pred             EEEEE-EECCCHHHHHHHHHHHHHHHHCCCCEEECCC-CCHHHHHCCCCCCEEE
T ss_conf             79999-9768348999999999999975995264155-5443564368882899


No 341
>COG3580 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.04  E-value=30  Score=14.84  Aligned_cols=45  Identities=31%  Similarity=0.567  Sum_probs=24.3

Q ss_pred             HHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCC---CCEEEECHH
Q ss_conf             8659406985289898899723997999985388999999975376898089---988997789
Q gi|254780414|r   28 RESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESN---IPLLGICYG   88 (520)
Q Consensus        28 RelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~---iPILGICyG   88 (520)
                      |-|++| +-+|+-  ...+.+++.+ |+||.           .-++++++.|   +|.= .||-
T Consensus        28 RvLn~y-e~yPff--~tffteLGf~-VVlS~-----------~S~kely~~G~~ti~se-vCfP   75 (351)
T COG3580          28 RVLNMY-EYYPFF--HTFFTELGFR-VVLSP-----------KSSKELYEKGIETIPSE-VCFP   75 (351)
T ss_pred             HHHHHH-HCCHHH--HHHHHHCCCE-EEECC-----------CCCHHHHHHHHHHCCCC-CEEC
T ss_conf             787776-325899--9999974945-99588-----------77589997355527764-2001


No 342
>PRK02155 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=35.96  E-value=30  Score=14.83  Aligned_cols=76  Identities=13%  Similarity=0.211  Sum_probs=40.5

Q ss_pred             CEEEEEE-CCCC----HHHHHHHHHHHCCCEEEEEC----------C-CCCHHHHHHCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             8699998-8970----57889988886594069852----------8-98988997239979999853889999999753
Q gi|254780414|r    8 SKVLIID-FGSQ----FTQLIARRVRESKVYCEVIA----------F-KNALDYFKEQNPQAIILSGSPASSLDIDSPQI   71 (520)
Q Consensus         8 ~~IlIlD-fGSQ----ytqLIaRriRelgVyseI~P----------~-~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~   71 (520)
                      .+|+|+- .++.    ..+.+++.+.+.|+..-+-+          + ..+.+++. .+.+-+|--||-.++     .+.
T Consensus         6 k~Vgiv~k~~~~~~~~~~~~l~~~L~~~g~~v~~e~~~a~~~~~~~~~~~~~~~~~-~~~Dlvi~lGGDGTl-----L~~   79 (291)
T PRK02155          6 RTVALVGRYQTPGIAEPLEALAACIAKRGFEVVFEADTARNTGLTGYPALTPAEIG-ARADVAVVLGGDGTM-----LGI   79 (291)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHCCCCCCCCCCHHHHC-CCCCEEEEECCCHHH-----HHH
T ss_conf             89999914898689999999999999788999995557776399887747979946-376789997678899-----999


Q ss_pred             CHHHHHCCCCEEEECHHH
Q ss_conf             768980899889977899
Q gi|254780414|r   72 PKEILESNIPLLGICYGQ   89 (520)
Q Consensus        72 ~~~I~~~~iPILGICyG~   89 (520)
                      .......++|||||-+|.
T Consensus        80 a~~~~~~~~PilGiN~G~   97 (291)
T PRK02155         80 GRQLAPYGTPLIGINHGR   97 (291)
T ss_pred             HHHHHCCCCCEEEEECCC
T ss_conf             998711599689985475


No 343
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs. Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs, all of which are a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to members of the type I periplasmic binding protein superfamily. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor
Probab=35.68  E-value=31  Score=14.80  Aligned_cols=70  Identities=13%  Similarity=0.223  Sum_probs=40.5

Q ss_pred             EEEEECCC----CHHHHHHHHHHHCCCEEEEECCCCC-------HHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             99998897----0578899888865940698528989-------889972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGS----QFTQLIARRVRESKVYCEVIAFKNA-------LDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGS----QytqLIaRriRelgVyseI~P~~~~-------~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      ++|=|+-.    +..+-|.+..++.|....+...+.+       ++.+...+++|||+.+.-.     + ......+.+.
T Consensus         4 vivpdi~npff~~l~~~ie~~~~~~Gy~~ll~~s~~d~~~e~~~i~~l~~~~vdGiIi~~~~~-----~-~~~~~~~~~~   77 (264)
T cd06274           4 LIIPDLENRSFARIAKRLEALARERGYQLLIACSDDDPETERETVETLIARQVDALIVAGSLP-----P-DDPYYLCQKA   77 (264)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCC-----C-HHHHHHHHHC
T ss_conf             997798787999999999999998699899993899989999999999966998799767889-----8-7999999975


Q ss_pred             CCCEEEE
Q ss_conf             9988997
Q gi|254780414|r   79 NIPLLGI   85 (520)
Q Consensus        79 ~iPILGI   85 (520)
                      ++|+.-+
T Consensus        78 ~iPvV~i   84 (264)
T cd06274          78 GLPVVAL   84 (264)
T ss_pred             CCCEEEE
T ss_conf             9988998


No 344
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1; InterPro: IPR004403 These proteins are translation factors that have been characterised in eukaryotes as the non-GTP-binding subunit of a cytosolic heterodimer that acts as a translation release factor for all three stop codons. Members of this orthologous family are found in Eukarya and Archaea. The name used should be eRF1 for the Archaea and aRF1 for the Eukarya. Alternative names include eRF1, SUP45, omnipotent suppressor protein 1.; GO: 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.
Probab=35.52  E-value=15  Score=17.08  Aligned_cols=17  Identities=24%  Similarity=0.442  Sum_probs=12.2

Q ss_pred             HCCCHHHHHHHHHHHHHC
Q ss_conf             215202577998755010
Q gi|254780414|r  180 VHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       180 ~hT~~G~~iL~NFl~~Ic  197 (520)
                      +.|+.|.++++-|= .|+
T Consensus       398 ~eseEG~~l~~aFG-GIg  414 (425)
T TIGR00108       398 TESEEGAQLLKAFG-GIG  414 (425)
T ss_pred             CCCHHHHHHHHHCC-CEE
T ss_conf             57647999986244-325


No 345
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane]
Probab=35.35  E-value=31  Score=14.76  Aligned_cols=131  Identities=16%  Similarity=0.284  Sum_probs=63.2

Q ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEEEE
Q ss_conf             99888865940698528989889972399799998538899999997537689808998899778999989970969998
Q gi|254780414|r   23 IARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKN  102 (520)
Q Consensus        23 IaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V~~  102 (520)
                      ..++++++|+-. +.|++  .+.+.  +++-||.|.    ...++.|.+.. ..+.++|++   .++|+|+...-.+-.=
T Consensus        44 ~t~~L~~~G~~i-~~gh~--~~ni~--~~~~VV~s~----Ai~~~NpEi~~-A~e~~ipi~---~r~e~L~elm~~~~~i  110 (459)
T COG0773          44 MTQRLEALGIEI-FIGHD--AENIL--DADVVVVSN----AIKEDNPEIVA-ALERGIPVI---SRAEMLAELMRFRTSI  110 (459)
T ss_pred             HHHHHHHCCCEE-ECCCC--HHHCC--CCCEEEEEC----CCCCCCHHHHH-HHHCCCCEE---CHHHHHHHHHHCCEEE
T ss_conf             789999789968-67979--78858--996599965----65799989999-998599816---2899999997077169


Q ss_pred             CCCCCCCEEEEEECCCCCCCCCCCCC---CCCEEEEEECCCHHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHH
Q ss_conf             69866103667523886222787266---553368600220110124442112323983178898635001124652122
Q gi|254780414|r  103 SQSREFGRAFIEIKKNCSLLKGMWEK---GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV  179 (520)
Q Consensus       103 ~~~~EyG~~~I~i~~~~~lf~gl~~~---~~~~~VwmSH~D~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV  179 (520)
                      +-.+-+|+++..     ++..-+...   ..++        -+-.++++|..-|+...+.+-.++-.+..--=+.|||++
T Consensus       111 aVaGTHGKTTTT-----smla~vl~~~gldPtf--------~iGG~~~~~g~na~~g~~~~fV~EADEsD~sFl~~~P~~  177 (459)
T COG0773         111 AVAGTHGKTTTT-----SMLAWVLEAAGLDPTF--------LIGGILKNFGTNARLGSGDYFVAEADESDSSFLHYNPRV  177 (459)
T ss_pred             EEECCCCCHHHH-----HHHHHHHHHCCCCCEE--------EECCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCE
T ss_conf             994788754089-----9999999867999879--------977744557765545888649999515416502488978


No 346
>PRK10419 nikE nickel transporter ATP-binding protein; Provisional
Probab=35.23  E-value=31  Score=14.75  Aligned_cols=33  Identities=30%  Similarity=0.455  Sum_probs=22.1

Q ss_pred             CHHHHHHHHH-------HHHHHHHHHHHCCCHHHHCCCCC
Q ss_conf             0223789873-------89999999981999889426888
Q gi|254780414|r  366 KLVEPLKELF-------KDEVRLLGKELRLPDSFVERHPC  398 (520)
Q Consensus       366 ~liEPl~~l~-------KdEVR~lg~~Lglp~~~~~RhPF  398 (520)
                      .+.|||+.+.       +..++++-+.+|||.++.+|.|+
T Consensus       111 ~i~epl~~~~~~~~~~~~~~~~~~L~~vgL~~~~~~~yP~  150 (266)
T PRK10419        111 ILREPLRHLLSLDKAERLARASEMLKAVDLDDSVLDKRPP  150 (266)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHCCHH
T ss_conf             9999999814999999999999999874998898717843


No 347
>cd06815 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase-like 1. This subfamily is composed of uncharacterized bacterial proteins with similarity to bacterial alanine racemases (AR), which are fold type III PLP-dependent enzymes containing an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. It catalyzes the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. Members of this subfamily may act as PLP-dependent enzymes.
Probab=35.06  E-value=31  Score=14.73  Aligned_cols=66  Identities=15%  Similarity=0.152  Sum_probs=34.3

Q ss_pred             HHHHHHHHHHHHCCCCE-E--EEEECCCCCCCCC----HHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHH
Q ss_conf             47799999986223656-9--9997389551562----78999988623698579975889999996689888999
Q gi|254780414|r  234 DSTVAAFLIYEAIGINL-T--CVLVDHGFMRKNE----VENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK  302 (520)
Q Consensus       234 DStV~A~Ll~kAig~~l-~--~vfVD~GllRknE----~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~K  302 (520)
                      |-.++.+|-.-|...+. +  -+.||+|++|.+=    ..+..+...+..|+++.-+-.   =|.-..|+..-+++
T Consensus        99 e~~~i~aLs~~A~~~gk~~~V~l~VDtGm~R~Gv~ped~~~~~~~I~~lp~i~l~GI~T---hfaC~~gv~pt~~~  171 (353)
T cd06815          99 ELETIKALSEEAKKQGKIHKIILMVDLGDLREGVLPEDLLDFVEEILKLPGIELVGIGT---NLGCYGGVLPTEEN  171 (353)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEE---CHHHCCCCCCCHHH
T ss_conf             79999999999998698478999996899957889899999999986599959999888---76357888999999


No 348
>KOG4129 consensus
Probab=34.90  E-value=31  Score=14.71  Aligned_cols=70  Identities=23%  Similarity=0.317  Sum_probs=44.7

Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCC----HHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             999998622365699997389551562----7899998862369857997588999999668988899998875658999
Q gi|254780414|r  238 AAFLIYEAIGINLTCVLVDHGFMRKNE----VENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEV  313 (520)
Q Consensus       238 ~A~Ll~kAig~~l~~vfVD~GllRknE----~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~v  313 (520)
                      .|.|++-       .|.+|+|.||+.+    .++..+-+.+.++.++   -..+.|++.|+     +.|+-|=|-++=++
T Consensus       175 ~A~LL~g-------~ILiDt~nm~~ek~s~kd~~~v~kLe~~~p~~l---~~r~~~fd~Lk-----~ak~d~sgls~~~i  239 (377)
T KOG4129         175 LARLLLG-------PILIDTGNMRKEKTSPKDVEIVKKLEELFPVKL---PERSEFFDELK-----SAKFDISGLSTDDI  239 (377)
T ss_pred             HHHHHHC-------CEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCC---HHHHHHHHHHH-----HHHCCCCCCCHHHH
T ss_conf             9998625-------668731445634488437999999998707775---66899999999-----86435335859999


Q ss_pred             HHHHHHHCC
Q ss_conf             999997439
Q gi|254780414|r  314 FEEEAKKIG  322 (520)
Q Consensus       314 f~~~a~~~~  322 (520)
                      ..+-.+.+.
T Consensus       240 LrKD~K~~~  248 (377)
T KOG4129         240 LRKDLKQFH  248 (377)
T ss_pred             HHHHHHHHC
T ss_conf             999899736


No 349
>TIGR00673 cynS cyanate hydratase; InterPro: IPR008076   Cyanase, an enzyme found in bacteria and plants, catalyses the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide, allowing the host organisms to overcome the toxicity of environmental cyanate .    The cyanate lyase monomer is composed of two domains: an N-terminal domain that shows structural similarity to the DNA-binding alpha-helix bundle motif, and a C-terminal domain that has an 'open fold' that shows no structural similarity to other proteins .    The enzyme is active as a homodecamer of 17kDa subunits, and displays half-site binding of substrates or substrate analogues. The dimer structure reveals the C-terminal domains to be intertwined; the decamer is formed from a pentamer of these dimers. The active site of the enzyme is located between dimers and comprises residues from four adjacent subunits of the homodecamer.     Synonym(s): cyanase lyase, cyanase hydrolase ; GO: 0016836 hydro-lyase activity, 0008152 metabolic process.
Probab=34.47  E-value=28  Score=15.12  Aligned_cols=28  Identities=18%  Similarity=0.131  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHC
Q ss_conf             2237898738999999998199988942
Q gi|254780414|r  367 LVEPLKELFKDEVRLLGKELRLPDSFVE  394 (520)
Q Consensus       367 liEPl~~l~KdEVR~lg~~Lglp~~~~~  394 (520)
                      ++=--..+=-||||.++..|+|.++.+-
T Consensus        46 ~~ygqa~a~~dea~~v~~~L~L~ed~~~   73 (156)
T TIGR00673        46 VLYGQAAADADEAKKVAELLDLEEDEVA   73 (156)
T ss_pred             HHHHHHCCCHHHHHHHHHHCCCCHHHHH
T ss_conf             9984206888899999987099811346


No 350
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine.
Probab=34.37  E-value=32  Score=14.66  Aligned_cols=30  Identities=33%  Similarity=0.426  Sum_probs=22.4

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             4886999988970578899888865940698
Q gi|254780414|r    6 RSSKVLIIDFGSQFTQLIARRVRESKVYCEV   36 (520)
Q Consensus         6 ~~~~IlIlDfGSQytqLIaRriRelgVyseI   36 (520)
                      ++.+|+||-||||= |-=|..+|+-|+...|
T Consensus         3 k~k~iaViGYGsQG-~AhAlNLrDSG~~V~v   32 (165)
T pfam07991         3 KGKKIAVIGYGSQG-HAHALNLRDSGVNVIV   32 (165)
T ss_pred             CCCEEEEEEECCHH-HHHHHHHHHCCCCEEE
T ss_conf             79989999346164-8887230534997899


No 351
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=34.32  E-value=32  Score=14.65  Aligned_cols=58  Identities=26%  Similarity=0.298  Sum_probs=39.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH
Q ss_conf             366405640477999999862236569999738955156278999988623698579975889999996
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKL  293 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L  293 (520)
                      |++|+||-=-||++++|..+     +-|+|++---.|+-+.  +.++   .-|+++.--| ....+.++
T Consensus         3 iv~GvsGsGKSTia~~La~~-----lg~~~i~~D~~h~~~n--~~km---~~G~pL~d~d-r~~wl~~l   60 (150)
T cd02021           3 VVMGVSGSGKSTVGKALAER-----LGAPFIDGDDLHPPAN--IAKM---AAGIPLNDED-RWPWLQAL   60 (150)
T ss_pred             EEECCCCCCHHHHHHHHHHH-----HCCCEECCCCCCCHHH--HHHH---HCCCCCCCCC-HHHHHHHH
T ss_conf             99918999999999999997-----1995641543354768--9998---6799988523-78999999


No 352
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent.   The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.
Probab=33.97  E-value=33  Score=14.61  Aligned_cols=133  Identities=17%  Similarity=0.343  Sum_probs=67.2

Q ss_pred             CEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCC-CCCC-----CHHHHHHHHHHHHHHHCCCC-EEEEECCCCHHHHHHHH
Q ss_conf             01124652122215202577998755010644-1114-----06789999999976504440-36640564047799999
Q gi|254780414|r  169 KYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQ-DNWV-----MSSYHKEIVSRIKEQVGNER-VICAVSGGVDSTVAAFL  241 (520)
Q Consensus       169 ~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~-~~W~-----~~~~~~~~i~~Ir~~vg~~k-Vi~~lSGGVDStV~A~L  241 (520)
                      -+=||+-|     .-+|- +|..||....+-. ..|-     --.|.-+.++.||+.||++. |.+=+|+ .|       
T Consensus       167 GfDGVEIH-----~ahGY-Ll~qFLsp~~N~RtDeYGGs~enR~Rf~~Eii~aVr~~vg~d~~vgvRis~-~d-------  232 (336)
T cd02932         167 GFDVIEIH-----AAHGY-LLHQFLSPLSNKRTDEYGGSLENRMRFLLEVVDAVRAVWPEDKPLFVRISA-TD-------  232 (336)
T ss_pred             CCCEEEEC-----CCCCH-HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC-CC-------
T ss_conf             99999863-----13747-999836941167778679978999889999999999983998870689645-23-------


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             98622365699997389551562789999886236985799758899999966898889999887565899999999743
Q gi|254780414|r  242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKI  321 (520)
Q Consensus       242 l~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~  321 (520)
                                  ++++|+ ...|..++.+.+.+ .|++...|....         ..|..+- -.+.-|---|-+..++.
T Consensus       233 ------------~~~~g~-~~~e~~~~a~~l~~-~gvd~i~vs~G~---------~~~~~~~-~~~~~~~~~~a~~ik~~  288 (336)
T cd02932         233 ------------WVEGGW-DLEDSVELAKALKE-LGVDLIDVSSGG---------NSPAQKI-PVGPGYQVPFAERIRQE  288 (336)
T ss_pred             ------------CCCCCC-CHHHHHHHHHHHHH-CCCCEEEECCCC---------CCCCCCC-CCCCCCCHHHHHHHHHH
T ss_conf             ------------578998-99999999999997-599789955898---------7766667-77864267999999987


Q ss_pred             CCCEEEEECCCC-CHHHHH
Q ss_conf             997099864622-024542
Q gi|254780414|r  322 GGAQFLGQGTLY-PDVIES  339 (520)
Q Consensus       322 ~~~~~L~QGTly-pDvIES  339 (520)
                      -+....+.|-+| |+..|.
T Consensus       289 ~~ipvi~~G~i~~p~~ae~  307 (336)
T cd02932         289 AGIPVIAVGLITDPEQAEA  307 (336)
T ss_pred             CCCCEEEECCCCCHHHHHH
T ss_conf             8983999799899999999


No 353
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit; InterPro: IPR012748    This entry describes NirD, the small subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirB, the large subunit (IPR012744 from INTERPRO). In a few bacteria such as Klebsiella pneumoniae and in fungi, the two regions are fused..
Probab=33.77  E-value=33  Score=14.59  Aligned_cols=33  Identities=30%  Similarity=0.356  Sum_probs=21.5

Q ss_pred             HHCCCCC----CCEEECCCCCCEEEEEECCC-CEEEEE
Q ss_conf             1012444----21123239831788986350-011246
Q gi|254780414|r  142 VEHIPEG----FEVIASSDSTPFAFIADEKR-KYYAVQ  174 (520)
Q Consensus       142 V~~lP~g----f~viA~S~~~~iaai~~~~~-~iyGVQ  174 (520)
                      +..+|+.    .-+.+..++..+|.|+-.++ .+|++|
T Consensus         8 ~~~~~~~e~g~~g~~~~~~d~q~AiFr~~~~d~~yA~~   45 (117)
T TIGR02378         8 LEEIPEEEAGISGVCVLLGDTQLAIFRVPGDDQVYAIQ   45 (117)
T ss_pred             CCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEE
T ss_conf             01357121771118974799249898949998488840


No 354
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase; InterPro: IPR011183    Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyses the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (2.7.1.90 from EC). The enzyme is also known as pyrophosphate-dependent phosphofructokinase. The usage of PPi-dependent enzymes in glycolysis presumably frees up ATP for other processes . IPR012828 from INTERPRO represents the ATP-dependent 6-phosphofructokinase enzyme contained within Phosphofructokinase. This entry contains primarily bacterial, plant alpha, and plant beta sequences. These may be dimeric nonallosteric enzymes (bacteria) or allosteric heterotetramers (plants) .   For additional information please see , , , .; GO: 0005524 ATP binding, 0047334 diphosphate-fructose-6-phosphate 1-phosphotransferase activity, 0006096 glycolysis, 0005945 6-phosphofructokinase complex.
Probab=33.64  E-value=23  Score=15.74  Aligned_cols=44  Identities=25%  Similarity=0.255  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEE
Q ss_conf             999999997650444036640564047799999986223-65699997
Q gi|254780414|r  209 HKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLV  255 (520)
Q Consensus       209 ~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfV  255 (520)
                      .+.+.+.+++.==|.=||.   ||.||-.-||||.+-.- .++.+..|
T Consensus       157 ~~~al~~~k~l~LdgLVII---GGDdSNTnAA~LAEyF~~~~~~t~vi  201 (566)
T TIGR02477       157 FAKALETAKKLKLDGLVII---GGDDSNTNAALLAEYFAKKGLKTQVI  201 (566)
T ss_pred             HHHHHHHHHHHCCCEEEEE---CCCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             9999999876089648997---47986799999999999738992278


No 355
>PRK08227 aldolase; Validated
Probab=33.43  E-value=33  Score=14.55  Aligned_cols=61  Identities=16%  Similarity=0.195  Sum_probs=34.2

Q ss_pred             CCCCEEEEEECCCCCCCCCHHHHHHHHH-----HCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2365699997389551562789999886-----23698579975889999996689888999988756589999999974
Q gi|254780414|r  246 IGINLTCVLVDHGFMRKNEVENIISLFK-----GYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKK  320 (520)
Q Consensus       246 ig~~l~~vfVD~GllRknE~~~v~~~~~-----~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~  320 (520)
                      +|-.-.++.|+-|-  .+|.+++.++-+     ...|+++..+-+     ..-..+.||+         ++.-.-+.+.+
T Consensus       133 lGAdAVsv~v~iGs--~~E~~~l~~lg~v~~e~~~~GmPlla~~~-----~g~~~~~d~~---------~va~aaRia~E  196 (291)
T PRK08227        133 LNVCAVAAQVFIGS--EYETQSIKNIIQLVDAGLRYGMPTMAVTA-----VGKDMVRDAR---------YFSLATRIAAE  196 (291)
T ss_pred             CCCCEEEEEEECCC--CHHHHHHHHHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCHH---------HHHHHHHHHHH
T ss_conf             79978999863599--32899999999999999982998799834-----6877777789---------99999999999


Q ss_pred             CC
Q ss_conf             39
Q gi|254780414|r  321 IG  322 (520)
Q Consensus       321 ~~  322 (520)
                      +|
T Consensus       197 LG  198 (291)
T PRK08227        197 MG  198 (291)
T ss_pred             HC
T ss_conf             78


No 356
>KOG2707 consensus
Probab=33.38  E-value=33  Score=14.55  Aligned_cols=105  Identities=15%  Similarity=0.206  Sum_probs=46.4

Q ss_pred             CCCEEEECCCCCCCCCC-CCCCCCHH-HHHCCCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCC
Q ss_conf             99799998538899999-99753768-98089988997789999899709699986986610366752388622278726
Q gi|254780414|r   50 NPQAIILSGSPASSLDI-DSPQIPKE-ILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE  127 (520)
Q Consensus        50 ~p~GIILSGGP~SV~d~-~ap~~~~~-I~~~~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~  127 (520)
                      +.++|-.+=||.-+..- .-..+.+. .-.+++|++|+   |.+.|+++--..+.. .-+|-...+-+...         
T Consensus       103 dldaIAVT~gPGl~lsL~vGl~fA~glA~~l~kPlipV---HHMeAHAL~~rl~~~-~v~FPFl~lLvSGG---------  169 (405)
T KOG2707         103 DLDAIAVTRGPGLPLSLKVGLSFAKGLAVKLQKPLIPV---HHMEAHALSIRLVDD-SVRFPFLALLVSGG---------  169 (405)
T ss_pred             CCEEEEEECCCCCEEEHHHHHHHHHHHHHHCCCCCCCH---HHHHHHHHHHHHCCC-CCCCCEEEEEEECC---------
T ss_conf             51169996389964315654899999998635886405---577776788875168-76883456764078---------


Q ss_pred             CCCCEEEEEECCC-HHHCCCCCCCEEECCCC-CCEEEEEECCCCEEEEEEEEH
Q ss_conf             6553368600220-11012444211232398-317889863500112465212
Q gi|254780414|r  128 KGSKQQVWMSHGD-QVEHIPEGFEVIASSDS-TPFAFIADEKRKYYAVQFHPE  178 (520)
Q Consensus       128 ~~~~~~VwmSH~D-~V~~lP~gf~viA~S~~-~~iaai~~~~~~iyGVQFHPE  178 (520)
                                |.. .+..-+.+|+++..|-+ .+=+++- +-.+..|+-+|||
T Consensus       170 ----------H~llvla~~~~~~~llg~TvDiApGe~lD-K~ar~Lgl~~~~e  211 (405)
T KOG2707         170 ----------HTLLVLANGVGDHELLGQTVDIAPGEALD-KCARRLGLLGHPE  211 (405)
T ss_pred             ----------CEEEEEECCCCCEEEEECCCCCCHHHHHH-HHHHHHCCCCCCC
T ss_conf             ----------06999832665303550003666177899-9999846777840


No 357
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908    Synonym: dTDP-D-glucose synthase     This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2.7.7.24 from EC). It is well characterised in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.  dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose     The family of known and putative glucose-1-phosphate thymidyltransferases shows a deep split into a short form (see IPR005907 from INTERPRO) and a long form described by this model. The homotetrameric short form is found in numerous bacterial species that incorporate dTDP-L-rhamnose, which it helps synthesize, into the cell wall. It is subject to feedback inhibition. The long form, in contrast, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced. .
Probab=33.36  E-value=21  Score=15.97  Aligned_cols=77  Identities=16%  Similarity=0.227  Sum_probs=48.6

Q ss_pred             EEEEEECCCCEEEEEEEEH---HHCCCHHHHHHHH--HHHHH-CCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             7889863500112465212---2215202577998--75501-0644111406789999999976504440366405640
Q gi|254780414|r  160 FAFIADEKRKYYAVQFHPE---VVHTVGGSQLIDN--FVHHV-AGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGV  233 (520)
Q Consensus       160 iaai~~~~~~iyGVQFHPE---V~hT~~G~~iL~N--Fl~~I-c~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGV  233 (520)
                      ||-++...+.+..+===|+   +..---|.-||++  -+|++ ...+|+|.=+==|-+.|+.+-++  +.||-       
T Consensus       144 VA~l~d~G~~i~~LvEKPk~PPSNLAvvGlY~F~pPe~if~~~~~~kPSwRGElEITD~IQ~lIe~--Gy~V~-------  214 (361)
T TIGR01208       144 VAELEDDGKRILKLVEKPKEPPSNLAVVGLYMFRPPELIFEAIKNIKPSWRGELEITDAIQYLIEK--GYKVG-------  214 (361)
T ss_pred             EEEEECCCCEEEEEEECCCCCCCCCEEEEEEECCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC--CCEEE-------
T ss_conf             589924897999988338657877012334533877798889852888776621577577565315--83777-------


Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             4779999998622365699997389
Q gi|254780414|r  234 DSTVAAFLIYEAIGINLTCVLVDHG  258 (520)
Q Consensus       234 DStV~A~Ll~kAig~~l~~vfVD~G  258 (520)
                                   +.++++=.-|||
T Consensus       215 -------------~~~v~GWWkDTG  226 (361)
T TIGR01208       215 -------------GSKVKGWWKDTG  226 (361)
T ss_pred             -------------EEEEEEEECCCC
T ss_conf             -------------799978870159


No 358
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=33.20  E-value=19  Score=16.27  Aligned_cols=77  Identities=19%  Similarity=0.188  Sum_probs=47.7

Q ss_pred             EEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             2122215202577998755010644111406789999999976504-440366405640477999999862236569999
Q gi|254780414|r  176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLIYEAIGINLTCVL  254 (520)
Q Consensus       176 HPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg-~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vf  254 (520)
                      .|+|...-.|+.++.||. +||..= +=.++.+..-...++-.+.. |++--+-+.|=.+++....+|.+-|.+=+.|--
T Consensus         8 ~~~v~~eG~~KT~i~Nf~-dIa~~L-~R~~~~v~kfl~~ELgt~~~id~~~~lii~G~~~~~~i~~~l~~yI~~yVlC~~   85 (110)
T smart00653        8 PPQVLREGKGKTVIVNFA-DIAKAL-NRPPDHVLKFLLAELGTQGSIDGKGRLIVNGRFTPKKLQDLLRRYIKEYVLCPE   85 (110)
T ss_pred             CCEEEEECCCCEEEECHH-HHHHHH-CCCHHHHHHHHHHHHCCCEEECCCCEEEEEEEECHHHHHHHHHHHHHHEEECCC
T ss_conf             954999567868988799-999887-959899999998874885588789709997341899999999999854899999


No 359
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. The SalR binds to glucose based compound Salicin which is chemically related to aspirin. The ligand-binding of SalR is structurally homologous to the periplasmic sugar-binding domain of ABC-transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand bind
Probab=33.17  E-value=33  Score=14.52  Aligned_cols=62  Identities=13%  Similarity=0.215  Sum_probs=37.7

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCC-CH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             57889988886594069852898-98-------899723997999985388999999975376898089988997
Q gi|254780414|r   19 FTQLIARRVRESKVYCEVIAFKN-AL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        19 ytqLIaRriRelgVyseI~P~~~-~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      -.+-|.+..++.|....+..++. ..       +.+...+++|||++.+-    . +.+.+...+-+.++|+.-+
T Consensus        17 l~~gi~~~~~~~GY~~~i~~~~~~~~~~~~~~~~~l~~~~vdGiIl~~~~----~-~~~~~~~~l~~~~iPvV~i   86 (270)
T cd01545          17 IQLGALDACRDTGYQLVIEPCDSGSPDLAERVRALLQRSRVDGVILTPPL----S-DNPELLDLLDEAGVPYVRI   86 (270)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCC----C-CCHHHHHHHHHCCCCEEEE
T ss_conf             99999999998499899996999998999999999996699989994788----8-9999999999779979998


No 360
>PHA01622 CRISPR-associated Cas4-like protein
Probab=32.84  E-value=34  Score=14.49  Aligned_cols=40  Identities=25%  Similarity=0.403  Sum_probs=26.6

Q ss_pred             EECCCCHHHHHHHHHHH-CCCEEEEECCCCCHHHHHHCCCCEEEECCCCC
Q ss_conf             98897057889988886-59406985289898899723997999985388
Q gi|254780414|r   13 IDFGSQFTQLIARRVRE-SKVYCEVIAFKNALDYFKEQNPQAIILSGSPA   61 (520)
Q Consensus        13 lDfGSQytqLIaRriRe-lgVyseI~P~~~~~e~i~~~~p~GIILSGGP~   61 (520)
                      +|.|+||--.|-|.+|| |+.++|+- -        ..+..||=+||--.
T Consensus        49 ~d~G~~~H~~veq~~re~lnCetEv~-I--------s~ei~GI~IsGRiD   89 (204)
T PHA01622         49 LDLGEQYHERIEQYFKEKLNCQTEVE-I--------KDEIEGIKISGRID   89 (204)
T ss_pred             HCCCHHHHHHHHHHHHHHHCCEEECC-C--------CCCEEEEEEEEEEE
T ss_conf             20126999999999998737457323-3--------55401599972550


No 361
>PRK03202 6-phosphofructokinase; Provisional
Probab=32.71  E-value=9.6  Score=18.41  Aligned_cols=41  Identities=15%  Similarity=0.296  Sum_probs=23.3

Q ss_pred             CEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHH
Q ss_conf             79999853889999999753768980899889977899998
Q gi|254780414|r   52 QAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIM   92 (520)
Q Consensus        52 ~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlL   92 (520)
                      -||+-||||.+....-.-.+-......+.-++|+.+|.+=|
T Consensus         5 iaIltsGG~~pGmNa~ir~vv~~a~~~g~~v~G~~~G~~GL   45 (323)
T PRK03202          5 IGVLTSGGDAPGMNAAIRGVVRTAISEGLEVYGIYNGYLGL   45 (323)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             99993688867789999999999997899999991677886


No 362
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=32.53  E-value=34  Score=14.45  Aligned_cols=29  Identities=14%  Similarity=0.163  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCHHHHH
Q ss_conf             57889988886594069852898988997
Q gi|254780414|r   19 FTQLIARRVRESKVYCEVIAFKNALDYFK   47 (520)
Q Consensus        19 ytqLIaRriRelgVyseI~P~~~~~e~i~   47 (520)
                      .+.+|+|.+|++|+-++.+-...+.+.+.
T Consensus        43 ~~~~V~ral~~~g~~~~~i~~~DD~D~lR   71 (354)
T cd00674          43 TADAVRRALRDLGFEVRLIYSWDDYDPLR   71 (354)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCHHC
T ss_conf             89999999997599679999840555100


No 363
>KOG0303 consensus
Probab=32.36  E-value=34  Score=14.43  Aligned_cols=33  Identities=27%  Similarity=0.367  Sum_probs=20.3

Q ss_pred             CCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEH
Q ss_conf             12444211232398317889863500112465212
Q gi|254780414|r  144 HIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPE  178 (520)
Q Consensus       144 ~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPE  178 (520)
                      .+|++....-.+  .|+.-+....++.--|||||-
T Consensus       110 ~IPe~~l~~~lt--epvv~L~gH~rrVg~V~wHPt  142 (472)
T KOG0303         110 QIPENGLTRDLT--EPVVELYGHQRRVGLVQWHPT  142 (472)
T ss_pred             ECCCCCCCCCCC--CCEEEEEECCEEEEEEEECCC
T ss_conf             788764446766--636888511236788852344


No 364
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=32.14  E-value=35  Score=14.41  Aligned_cols=31  Identities=32%  Similarity=0.377  Sum_probs=23.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             44886999988970578899888865940698
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEV   36 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI   36 (520)
                      .++.+|+||-||||= |-=|..+|+-|+...|
T Consensus        14 lk~k~iaVIGYGsQG-~AhAlNLrDSG~~V~v   44 (335)
T PRK13403         14 LQGKTVAVIGYGSQG-HAQAQNLRDSGVEVVV   44 (335)
T ss_pred             HCCCEEEEEEECCHH-HHHHHHHHHCCCCEEE
T ss_conf             879979997567076-8988564763997799


No 365
>COG1636 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.12  E-value=35  Score=14.41  Aligned_cols=102  Identities=17%  Similarity=0.173  Sum_probs=66.3

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC---HHHHHHHHHHCCCCCEEEEEH-H-HHHHHHHCC
Q ss_conf             44403664056404779999998622365699997389551562---789999886236985799758-8-999999668
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE---VENIISLFKGYPNFPLRVVDA-S-ERFIRKLKN  295 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE---~~~v~~~~~~~~~~~l~~vda-~-~~Fl~~L~g  295 (520)
                      +..++|+-.-=.+||+-.---+..+ |-..+..|-|--.--+.|   ..+..+.|-+.+|+|++--|. . +.|+.+.||
T Consensus         2 ~~~kiLlH~CCAPcs~y~le~l~~~-~~~i~~yFYNPNIhP~~EY~~R~~e~~~f~~~~~i~~iegdY~~~~~w~~~vKg   80 (204)
T COG1636           2 GRPKLLLHSCCAPCSGYVLEKLRDS-GIKITIYFYNPNIHPLSEYELRKEEVKRFAEKFGINFIEGDYEDLEKWFERVKG   80 (204)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHC-CCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHC
T ss_conf             9870789862577718999999965-866699974899892699999999999999982970553575558999999616


Q ss_pred             CCCHHHHHHHHHHHHHHHHHH---HHHHCCC
Q ss_conf             988899998875658999999---9974399
Q gi|254780414|r  296 IVDPETKRKVIGQLFIEVFEE---EAKKIGG  323 (520)
Q Consensus       296 v~DPE~KRkiIG~~Fi~vf~~---~a~~~~~  323 (520)
                      ..|--++-+---.-|==-|++   .|.++|-
T Consensus        81 ~E~EpE~G~RC~~Cfd~Rle~tA~~A~e~G~  111 (204)
T COG1636          81 MEDEPEGGKRCTMCFDMRLEKTAKKAKELGF  111 (204)
T ss_pred             CHHCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             2007777842377899989999999998296


No 366
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=32.11  E-value=21  Score=15.96  Aligned_cols=66  Identities=12%  Similarity=0.088  Sum_probs=37.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHH
Q ss_conf             69999889705788998888659406985289898899723997999985388999999975376898089988997789
Q gi|254780414|r    9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus         9 ~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG   88 (520)
                      |+.|+-..+.-++-++..+..+--     -+     .+...+++-+|-=||-++.     .+........++|+|||-.|
T Consensus         2 k~~i~~~~~~~s~~~~~~l~~~~~-----~~-----~~~~d~~DlviviGGDGT~-----L~a~~~~~~~~iPilGIN~G   66 (259)
T PRK00561          2 KYKIFASTTPQTEPVLPKLKKVLK-----KK-----LAVEDGADYLFVLGGDGFF-----VSTAANYNCAGCKVVGINTG   66 (259)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHH-----CC-----CCCCCCCCEEEEECCHHHH-----HHHHHHHCCCCCCEEEEECC
T ss_conf             699993888657999999999985-----47-----8678899999998971999-----99999855479968999669


Q ss_pred             H
Q ss_conf             9
Q gi|254780414|r   89 Q   89 (520)
Q Consensus        89 ~   89 (520)
                      +
T Consensus        67 ~   67 (259)
T PRK00561         67 H   67 (259)
T ss_pred             C
T ss_conf             7


No 367
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily. Type 1 periplasmic binding fold superfamily. This model and hierarchy represent the ligand binding domains of the LacI family of transcriptional regulators, periplasmic binding proteins of the ABC-type transport systems, the family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases including the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein  (LIVBP)-like domains of the ionotropic glutamate receptors (iGluRs). In LacI-like transcriptional regulator and the bacterial periplasmic binding proteins the ligands are monosaccharides including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars, with a few exceptions.  Periplasmic sugar binding proteins are one of the components of ABC transporters and are involved in the active transport of water-soluble ligands. The LacI family of proteins con
Probab=32.10  E-value=35  Score=14.41  Aligned_cols=62  Identities=16%  Similarity=0.066  Sum_probs=33.7

Q ss_pred             HHHHHHHHHCCCEEEE--ECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECH
Q ss_conf             8899888865940698--5289898-------89972399799998538899999997537689808998899778
Q gi|254780414|r   21 QLIARRVRESKVYCEV--IAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICY   87 (520)
Q Consensus        21 qLIaRriRelgVyseI--~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICy   87 (520)
                      +-+.+.++++|.-.++  ...+.+.       +.+...+++|||++.+..     .+..+.+.+-+.++|++.+-.
T Consensus        20 ~g~~~~~~~~g~~~~l~~~~~~~~~~~~~~~i~~l~~~~vd~ii~~~~~~-----~~~~~~~~~~~~~iPvv~~~~   90 (269)
T cd01391          20 AGIELAAEEIGRGLEVILADSQSDPERALEALRDLIQQGVDGIIGPPSSS-----SALAVVELAAAAGIPVVSLDA   90 (269)
T ss_pred             HHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCC-----CHHHHHHHHHHCCCEEEEECC
T ss_conf             99999999819976999984999999999999999974999999468874-----448999999976981999678


No 368
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=32.02  E-value=35  Score=14.40  Aligned_cols=67  Identities=9%  Similarity=0.099  Sum_probs=39.6

Q ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCC-CCCCCHHHHHCCCCEEEE
Q ss_conf             7057889988886594069852898988-------99723997999985388999999-975376898089988997
Q gi|254780414|r   17 SQFTQLIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDID-SPQIPKEILESNIPLLGI   85 (520)
Q Consensus        17 SQytqLIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~-ap~~~~~I~~~~iPILGI   85 (520)
                      +|..+-|.+..++.|+..-+...+.+.+       .+...+++|+|+.++-.+  +.. .+..-..+.+.++|++-+
T Consensus        15 ~~l~~gie~~~~~~Gy~~li~~s~~~~~~e~~~i~~l~~~~vdGiIi~~~~~~--~~~~~~~~~~~~~~~~iPvV~~   89 (273)
T cd06292          15 PAFAEAIEAALAQYGYTVLLCNTYRGGVSEADYVEDLLARGVRGVVFISSLHA--DTHADHSHYERLAERGLPVVLV   89 (273)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCCCHHHHHHHHHCCCCEEEE
T ss_conf             99999999999986998999978999799999999999649984999247666--3315789999999669988999


No 369
>cd01400 6PGL 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate. 6PGL is thought to guard against the accumulation of the delta form of the lactone, which may be toxic through its reaction with endogenous cellular nucleophiles.
Probab=31.88  E-value=35  Score=14.38  Aligned_cols=112  Identities=17%  Similarity=0.219  Sum_probs=62.9

Q ss_pred             HHHHHHHHHHHHC-CCCEEEEECCCCHHHHHHHHH-HHH-CC-CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9999999976504-440366405640477999999-862-23-6569999738955156278999988623698579975
Q gi|254780414|r  209 HKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLI-YEA-IG-INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD  284 (520)
Q Consensus       209 ~~~~i~~Ir~~vg-~~kVi~~lSGGVDStV~A~Ll-~kA-ig-~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vd  284 (520)
                      .+...+.|++.+. ++++.++||||=--.-....| ++. +. ++++-.++|-=+.-.+..+--...+++++-   ..++
T Consensus         8 a~~i~~~i~~~i~~~~~~~l~lsGGstp~~~y~~L~~~~~ldw~~v~~~~~DER~V~~~~~~Sn~~~~~~~l~---~~~~   84 (219)
T cd01400           8 ADRIAEALAAAIAKRGRFSLALSGGSTPKPLYELLAAAPALDWSKVHVFLGDERCVPPDDPDSNYRLAREALL---SHVA   84 (219)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCCCHHEEEEEEECCCCCCCCCHHHHHHHHHHHH---CCCC
T ss_conf             9999999999999779889998489779999999855458990363899600344699762549999999853---2479


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCC------CCEEEEECC
Q ss_conf             88999999668988899998875658999999997439------970998646
Q gi|254780414|r  285 ASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIG------GAQFLGQGT  331 (520)
Q Consensus       285 a~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~------~~~~L~QGT  331 (520)
                      ....++-.+.+-.+||+-        .+-+++..++..      +.-+|+-|.
T Consensus        85 ~~~~~i~~~~~~~~~~~~--------~~~y~~~i~~~~~~~~~~Dl~lLGmG~  129 (219)
T cd01400          85 IPAANIHPIPTELGPEDA--------AAAYEKELRALFGGVPPFDLVLLGMGP  129 (219)
T ss_pred             CCHHHCCCCCCCCCHHHH--------HHHHHHHHHHHCCCCCCCCEEEECCCC
T ss_conf             989995389998899999--------999999999853888886489974668


No 370
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=31.76  E-value=35  Score=14.37  Aligned_cols=70  Identities=17%  Similarity=0.313  Sum_probs=42.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHH----------------CCCCEEEECCCCCCCCCCCCCC
Q ss_conf             886999988970578899888865940698528989889972----------------3997999985388999999975
Q gi|254780414|r    7 SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKE----------------QNPQAIILSGSPASSLDIDSPQ   70 (520)
Q Consensus         7 ~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~----------------~~p~GIILSGGP~SV~d~~ap~   70 (520)
                      ..||+|+-+|- -..-.+|.++..|....+.  |...+.+..                .+.+-||.|.|=    ..+.|.
T Consensus         3 ~KkvlV~GlG~-SG~s~a~~L~~~g~~v~~~--D~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vv~SPGi----~~~~p~   75 (418)
T PRK00683          3 LQRVVVLGLGV-TGKSVARFLAQKGVYVIGV--DNSLEALQSCPYIHERYLEGAEEFPEQVDLVVRSPGI----KPYHPW   75 (418)
T ss_pred             CCEEEEEEECH-HHHHHHHHHHHCCCEEEEE--CCCHHHHHHCCHHHHHCCCCHHHCCCCCCEEEECCCC----CCCCHH
T ss_conf             86699980888-7999999999782989998--2981454546145554056233242349899989985----998899


Q ss_pred             CCHHHHHCCCCEEE
Q ss_conf             37689808998899
Q gi|254780414|r   71 IPKEILESNIPLLG   84 (520)
Q Consensus        71 ~~~~I~~~~iPILG   84 (520)
                      +. ...+.++||.+
T Consensus        76 ~~-~a~~~~i~i~s   88 (418)
T PRK00683         76 VE-AAVALKIPVVT   88 (418)
T ss_pred             HH-HHHHCCCCCCC
T ss_conf             99-99986997540


No 371
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of TreR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding wh
Probab=31.76  E-value=35  Score=14.37  Aligned_cols=71  Identities=15%  Similarity=0.186  Sum_probs=40.8

Q ss_pred             EEEEECCCCH----HHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             9999889705----788998888659406985289898-------89972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQF----TQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQy----tqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      ++|=|+...|    .+-|.+..++.|+...+...+.+.       +.+...+++|||+.+...     + +.....+.+.
T Consensus         4 vivp~i~npff~~~~~gie~~~~~~Gy~~ll~~s~~~~~~e~~~l~~l~~~~vDGiIl~~~~~-----~-~~~~~~l~~~   77 (259)
T cd01542           4 VIVPRLDSFSTSRTVKGILAALYENGYQMLLMNTNFSIEKEIEALELLARQKVDGIILLATTI-----T-DEHREAIKKL   77 (259)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----C-HHHHHHHHHC
T ss_conf             997998687999999999999998699899997899989999999999956999899937777-----7-5999999966


Q ss_pred             CCCEEEEC
Q ss_conf             99889977
Q gi|254780414|r   79 NIPLLGIC   86 (520)
Q Consensus        79 ~iPILGIC   86 (520)
                      ++|+.-+.
T Consensus        78 ~iPvV~i~   85 (259)
T cd01542          78 NVPVVVVG   85 (259)
T ss_pred             CCCEEEEC
T ss_conf             99999959


No 372
>PRK10037 cell division protein; Provisional
Probab=31.51  E-value=36  Score=14.34  Aligned_cols=51  Identities=20%  Similarity=0.150  Sum_probs=33.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHC---CCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHH
Q ss_conf             3664056404779999998622---3656999973895515627899998862369857997588
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAI---GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDAS  286 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAi---g~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~  286 (520)
                      +|+++-|||-+|..++-|.-|+   |+++..|  |-         ...+.++-+||+++...|--
T Consensus         5 al~s~kGGVGkTTltAnLA~aL~~~g~~VlaI--D~---------dpqN~Lrlhfg~~~~~~~Gw   58 (250)
T PRK10037          5 GLQGVRGGVGTTSITAALAWSLQMLGENVLVI--DA---------CPDNLLRLSFNVDFTHRQGW   58 (250)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE--EC---------CHHHHHHHHCCCCCCCCCCH
T ss_conf             99607888768999999999999779918999--57---------82566787549985447729


No 373
>PRK00766 hypothetical protein; Provisional
Probab=31.47  E-value=36  Score=14.34  Aligned_cols=76  Identities=25%  Similarity=0.306  Sum_probs=35.5

Q ss_pred             CCCHHHHHHH-HHHHHC-CCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEE--E--HHHHHHHHHCC-CCCHHHHH
Q ss_conf             6404779999-998622-3656999973895515627899998862369857997--5--88999999668-98889999
Q gi|254780414|r  231 GGVDSTVAAF-LIYEAI-GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV--D--ASERFIRKLKN-IVDPETKR  303 (520)
Q Consensus       231 GGVDStV~A~-Ll~kAi-g~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~v--d--a~~~Fl~~L~g-v~DPE~KR  303 (520)
                      +|-|+|=+.+ |+.+.- -+++.+||.|-=-.----.-.+..++++ ++++++.|  .  ..+..-++|+. ..|+|++.
T Consensus        51 DG~DaT~~i~~mv~~~~~r~~i~~VlL~Git~aGFNvvD~~~l~~~-tg~PVI~V~~~~P~~~~i~~AL~khf~d~e~R~  129 (194)
T PRK00766         51 DGLDATEAIIDMINSSRHRGQLRVIMLDGITYAGFNVVDIEELHRE-TGLPVIVVVRKKPDFEAIESALRKHFSDGEERW  129 (194)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCEEEEEECCEEEEEEEEECHHHHHHH-HCCCEEEEEEECCCHHHHHHHHHHHCCCHHHHH
T ss_conf             8952799999999706556654799987753521478369999998-799989999637976899999998689889999


Q ss_pred             HHHH
Q ss_conf             8875
Q gi|254780414|r  304 KVIG  307 (520)
Q Consensus       304 kiIG  307 (520)
                      ++|-
T Consensus       130 ~~~~  133 (194)
T PRK00766        130 KLIK  133 (194)
T ss_pred             HHHH
T ss_conf             9998


No 374
>COG3828 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.28  E-value=36  Score=14.31  Aligned_cols=62  Identities=18%  Similarity=0.291  Sum_probs=30.7

Q ss_pred             HHCCCCEEEECHHHHHHHHHCCCEEEE---------CCCCCCC-EEEEEEC-CCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             808998899778999989970969998---------6986610-3667523-886222787266553368600220
Q gi|254780414|r   76 LESNIPLLGICYGQQIMCQSLGGKTKN---------SQSREFG-RAFIEIK-KNCSLLKGMWEKGSKQQVWMSHGD  140 (520)
Q Consensus        76 ~~~~iPILGICyG~QlLa~~~GG~V~~---------~~~~EyG-~~~I~i~-~~~~lf~gl~~~~~~~~VwmSH~D  140 (520)
                      .+.++-+-|.--|   ++.+|+-++.=         +.-+.-| .-.++++ .++++.+++.+..-....+.+|-|
T Consensus        77 iesG~G~aG~Hg~---~~D~fr~~~~yqf~igGqwvaHPgn~~idytVqi~~~~spl~egisdF~y~sEqYYmhvD  149 (239)
T COG3828          77 IESGVGFAGFHGG---MGDAFRNSVDYQFIIGGQWVAHPGNQGIDYTVQITGPDSPLNEGISDFAYASEQYYMHVD  149 (239)
T ss_pred             HHCCCCEEEECCC---CCCCCCCCCCEEEEECCEEECCCCCCCCCEEEEECCCCCHHHCCCCCCCCCHHHEEECCC
T ss_conf             9739753441464---200137875569996888763788676655888337997033073213420021044048


No 375
>pfam12023 DUF3511 Domain of unknown function (DUF3511). This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 50 amino acids in length. This domain has two completely conserved residues (Y and K) that may be functionally important.
Probab=31.09  E-value=25  Score=15.44  Aligned_cols=10  Identities=60%  Similarity=0.893  Sum_probs=7.7

Q ss_pred             CCCCHHHHHH
Q ss_conf             8988899998
Q gi|254780414|r  295 NIVDPETKRK  304 (520)
Q Consensus       295 gv~DPE~KRk  304 (520)
                      +-+|||.|||
T Consensus         2 ~~~DpE~kRk   11 (47)
T pfam12023         2 GFSDPEMKRK   11 (47)
T ss_pred             CCCCHHHHHH
T ss_conf             8677889889


No 376
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=31.04  E-value=36  Score=14.29  Aligned_cols=14  Identities=29%  Similarity=0.354  Sum_probs=7.6

Q ss_pred             HHHCCCCEEEECHH
Q ss_conf             98089988997789
Q gi|254780414|r   75 ILESNIPLLGICYG   88 (520)
Q Consensus        75 I~~~~iPILGICyG   88 (520)
                      +-+.++|+++.+-+
T Consensus        94 ~~~~~ip~i~~~~~  107 (362)
T cd06343          94 LNEKKVPQLFPASG  107 (362)
T ss_pred             HHHHCCEEEEECCC
T ss_conf             88627269974046


No 377
>PRK03846 adenylylsulfate kinase; Provisional
Probab=30.97  E-value=35  Score=14.37  Aligned_cols=61  Identities=21%  Similarity=0.204  Sum_probs=43.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             1140678999999997650444036640564047799999986223656999973895515
Q gi|254780414|r  202 NWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRK  262 (520)
Q Consensus       202 ~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRk  262 (520)
                      .|...+.-...-+....+-|-=--+.||||-=-||+|.+|-.+--.....++++|---||+
T Consensus         5 ~~~~~~v~~~~r~~~~~~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LDGD~lR~   65 (198)
T PRK03846          5 VWHQHPVTKAQREQLHGHKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLDGDNVRH   65 (198)
T ss_pred             CEECCCCCHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECHHHHHH
T ss_conf             2447887999999986899869998799999889999999999997599759977799987


No 378
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunit; InterPro: IPR014006   Succinate:quinone oxidoreductase (1.3.5.1 from EC) refers collectively to succinate:quinone reductase (SQR, or Complex II) and quinol:fumarate reductase (QFR) . SQR is found in aerobic organisms, and catalyses the oxidation of succinate to fumarate in the citric acid cycle and donates the electrons to quinone in the membrane. QFR can be found in anaerobic cells respiring with fumarate as terminal electron acceptor. SQR and QFR are very similar in composition and structure, despite catalysing opposite reactions in vivo. They are thought to have evolved from a common ancestor, and in Escherichia coli they are capable of functionally replacing each other .   Succinate:quinone oxidoreductases consist of a peripheral domain, exposed to the cytoplasm in bacteria and to the matrix in mitochondria, and a membrane-integral anchor domain that spans the membrane (Fig. 1). The peripheral part, which contains the dicarboxylate binding site, is composed of a flavoprotein subunit, with one covalently bound FAD, and an iron-sulphur protein subunit containing three iron-sulphur clusters. The membrane-integral domain functions to anchor the peripheral domain to the membrane and is required for quinone reduction and oxidation. The anchor domain shows the largest variability in composition and primary sequence, being composed either of one large subunit, or two smaller subunits, which may, or may not, contain protoheme groups.   This entry represents the flavoprotein subunit found in both the SQR and QFR enzymes. This subunit contains an N-terminal domain which binds the FAD cofactor, a central catalytic domain with an unsual fold, and a C-terminal domain whose role is unclear , , . The dicarboxylate binding site is located between the FAD and catalytic domains..
Probab=30.94  E-value=15  Score=16.93  Aligned_cols=49  Identities=22%  Similarity=0.295  Sum_probs=28.6

Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH
Q ss_conf             9862236569999738955156278999988623698579975889999996
Q gi|254780414|r  242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKL  293 (520)
Q Consensus       242 l~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L  293 (520)
                      |..+..++ ..||=|-=+|-+. ..++.++.+.. .-|+.+.|-|..|=..|
T Consensus       498 l~~~M~~~-~gvFR~~~~l~~a-~~~i~eL~eR~-~~~v~i~DKs~~fNTdL  546 (636)
T TIGR01812       498 LQETMEAN-VGVFRTEELLKKA-VDEIEELRERR-YKNVKINDKSKVFNTDL  546 (636)
T ss_pred             HHHHHHCC-CEEEECCHHHHHH-HHHHHHHHHCC-CCCEEEEECCCEECHHH
T ss_conf             98886658-5798773227889-99999986100-16456740542123668


No 379
>PTZ00340 O-sialoglycoprotein endopeptidase; Provisional
Probab=30.83  E-value=21  Score=15.95  Aligned_cols=35  Identities=20%  Similarity=0.282  Sum_probs=21.9

Q ss_pred             CCCCEEEECCCCCCCCCCCCCC----CCHH-HHHCCCCEEEEC
Q ss_conf             3997999985388999999975----3768-980899889977
Q gi|254780414|r   49 QNPQAIILSGSPASSLDIDSPQ----IPKE-ILESNIPLLGIC   86 (520)
Q Consensus        49 ~~p~GIILSGGP~SV~d~~ap~----~~~~-I~~~~iPILGIC   86 (520)
                      .++++|=.+-||.-+   .+..    +.+. .+.+++|++||-
T Consensus        76 ~did~IAvT~gPGL~---g~L~VG~~~AK~La~~~~~Pli~Vn  115 (348)
T PTZ00340         76 SDISLICYTKGPGMG---APLAVGATVAKTLSLLWGKPLVGVN  115 (348)
T ss_pred             HCCCEEEECCCCCCH---HHHHHHHHHHHHHHHHCCCCEEECC
T ss_conf             118579972799851---6589999999999998099835213


No 380
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=30.76  E-value=37  Score=14.25  Aligned_cols=93  Identities=16%  Similarity=0.299  Sum_probs=53.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCC-CEEEEECCCCHH--H-HHHHHHHHHCCCC-EEEEEECCCCC
Q ss_conf             57799875501064411140678999999997650444-036640564047--7-9999998622365-69999738955
Q gi|254780414|r  186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDS--T-VAAFLIYEAIGIN-LTCVLVDHGFM  260 (520)
Q Consensus       186 ~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~-kVi~~lSGGVDS--t-V~A~Ll~kAig~~-l~~vfVD~Gll  260 (520)
                      ..++++|+-.   .  -|++.+=-...+++|.+..... ..--.|-|-|-|  | ||+.-+-.|+... -.++++-|-.|
T Consensus       244 ~~~~~~~~~~---L--PF~LT~~Q~~~~~ei~~dl~~~~~m~rllqGDVGsGKT~va~~a~~~~~~~g~q~a~maPTeiL  318 (677)
T PRK10917        244 GELLKKFLAS---L--PFELTGAQKRVVAEILADLASPKPMNRLLQGDVGSGKTVVAALAALAAIEAGYQAALMAPTEIL  318 (677)
T ss_pred             HHHHHHHHHH---C--CCCCCHHHHHHHHHHHHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHCCEEEEECCCHHH
T ss_conf             6999999980---9--9988988999999999876599542777328767888999999999999819948998767999


Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEE
Q ss_conf             156278999988623698579975
Q gi|254780414|r  261 RKNEVENIISLFKGYPNFPLRVVD  284 (520)
Q Consensus       261 RknE~~~v~~~~~~~~~~~l~~vd  284 (520)
                      -..-.+...+.|.. +++++...-
T Consensus       319 a~Qh~~~~~~~~~~-~~i~v~llt  341 (677)
T PRK10917        319 AEQHYRNLKKWLEP-LGIRVALLT  341 (677)
T ss_pred             HHHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             99999999987763-498899840


No 381
>TIGR00174 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2.5.1.8 from EC also known as tRNA delta(2)-isopentenylpyrophosphate transferases or IPP transferases. These enzymes modify both cytoplasmic and mitochondrial tRNAs at A(37) to give isopentenyl A(37) .; GO: 0004811 tRNA isopentenyltransferase activity, 0005524 ATP binding, 0008033 tRNA processing.
Probab=30.47  E-value=33  Score=14.53  Aligned_cols=111  Identities=14%  Similarity=0.168  Sum_probs=65.8

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             21520257799875501064411140678999999997650444036640564047799999986223656999973895
Q gi|254780414|r  180 VHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGF  259 (520)
Q Consensus       180 ~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~Gl  259 (520)
                      .+|.+-.+-+...|.++|.-+.+++..+|-+++.+.|++--..+|.++.+ ||      ..|=-|||-+.+.    ++-.
T Consensus        45 Kp~~~e~~~ipH~l~Dildp~e~y~~~~F~~~~~~~~~~i~~~Gkipl~V-GG------T~lY~k~l~~gl~----~~~~  113 (307)
T TIGR00174        45 KPSLQERKGIPHHLIDILDPSESYSAADFQTQALNAIADITARGKIPLLV-GG------TGLYLKALLEGLS----PTPS  113 (307)
T ss_pred             CCCHHHHCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE-CC------HHHHHHHHHHCCC----CCCC
T ss_conf             88968753498158513471200370889999999999998569834886-85------7889999971477----7755


Q ss_pred             C-CCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             5-156278999988623698579975889999996689888999988756589
Q gi|254780414|r  260 M-RKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFI  311 (520)
Q Consensus       260 l-RknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi  311 (520)
                      . ++.=.++ ++...+..|.        +..+..|+.| ||+.--||==+-..
T Consensus       114 ~~~~~~r~~-~~~~~~~~g~--------~~ly~~L~~~-DP~~a~~ihPND~~  156 (307)
T TIGR00174       114 AEDKLIRES-LEILAERQGK--------SFLYKELKKV-DPVAAAKIHPNDTR  156 (307)
T ss_pred             CCCHHHHHH-HHHHHHHCCH--------HHHHHHHHHC-CHHHHHHHCCCCHH
T ss_conf             565057999-9999985491--------5788877750-76989721776147


No 382
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases; InterPro: IPR013370    This family consists of muconate cycloisomerase (5.5.1.1 from EC) and chloromuconate cycloisomerase (5.5.1.7 from EC), enzymes that often overlap in specificity. It does not include more distantly related proteins such as mandelate racemase (5.1.2.2 from EC).; GO: 0018849 muconate cycloisomerase activity, 0018850 chloromuconate cycloisomerase activity, 0030145 manganese ion binding.
Probab=30.23  E-value=19  Score=16.36  Aligned_cols=63  Identities=32%  Similarity=0.577  Sum_probs=32.1

Q ss_pred             EEEEEECCCCHHH-HHCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             0344302320113-203202237898738999999998199988942688898311122100036789999999
Q gi|254780414|r  349 IIKSHHNVGGLPE-HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRE  421 (520)
Q Consensus       349 ~IKsHHNvgglp~-~~~~~liEPl~~l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~  421 (520)
                      +|=|=|----+|. .+.=+|+=||  |+|||.=.  ..|.-.  =..=|==-||||+|-    +..+|++.+|+
T Consensus       305 tiASah~f~~~~~l~~GTELFGPL--LL~~~il~--~~l~Y~--~f~LhlP~GPGLG~~----~D~DK~~~~rR  368 (369)
T TIGR02534       305 TIASAHFFAAFPELEFGTELFGPL--LLKDEILT--EPLQYE--DFQLHLPAGPGLGVE----VDEDKVEFYRR  368 (369)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCC--CCCHHHHC--CCCCCC--CCEEECCCCCCCCEE----ECHHHHHHCCC
T ss_conf             999999984135666464124631--11336535--787545--764652478789503----34557743038


No 383
>pfam01606 Arteri_env Arterivirus envelope protein. This family consists of viral envelope proteins from the arterivirus genus; this includes porcine reproductive and respiratory virus (PRRSV) envelope protein GP3 and lactate dehydrogenase elevating virus (LDV) structural glycoprotein. Arteriviruses consists of positive ssRNA and do not have a DNA stage.
Probab=30.03  E-value=9.5  Score=18.44  Aligned_cols=70  Identities=30%  Similarity=0.495  Sum_probs=40.0

Q ss_pred             CCCHHHCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             22011012444211232398317889863500112465212221520257799875501064411140678999999997
Q gi|254780414|r  138 HGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIK  217 (520)
Q Consensus       138 H~D~V~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir  217 (520)
                      |..---.+|+|...+..  .+.+|-++.-. --|+.|||||.              |.|-+.++-+--            
T Consensus        87 hdeL~~~iP~g~~~l~l--e~~YawlAfls-fsyaaqfhPE~--------------FgiGNVS~V~vd------------  137 (211)
T pfam01606        87 HDELDFDFPDGVQLLTS--ESIYAWLAFLS-FSYAAQFHPEM--------------FGIGNVSAVHVD------------  137 (211)
T ss_pred             CCCCCCCCCCCHHHCCH--HHHHHHHHHHH-HHHHHHHCHHH--------------HCCCCEEEEEEE------------
T ss_conf             20007538974001001--44899999998-88888609566--------------145765699991------------


Q ss_pred             HHHCCCCEEEEECCCCHHHHHH
Q ss_conf             6504440366405640477999
Q gi|254780414|r  218 EQVGNERVICAVSGGVDSTVAA  239 (520)
Q Consensus       218 ~~vg~~kVi~~lSGGVDStV~A  239 (520)
                         ...+-||+.--|-.||+..
T Consensus       138 ---~~hq~iCa~hdg~NsT~~~  156 (211)
T pfam01606       138 ---IKHQFICAVHDGDNSTLIE  156 (211)
T ss_pred             ---CCCCEEEEEECCCCCCCCC
T ss_conf             ---3640898860677776655


No 384
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional
Probab=29.97  E-value=38  Score=14.16  Aligned_cols=72  Identities=17%  Similarity=0.166  Sum_probs=45.4

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             64411140678999999997650444036640564047799999986223656999973895515627899998862
Q gi|254780414|r  198 GIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG  274 (520)
Q Consensus       198 ~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~  274 (520)
                      |+..+|+-.. +.+.++++.+.+....+.+|.-.+... -+..+  ...|-++.++=.|.+|||.. .++..+.||+
T Consensus       185 G~~g~~~~pe-v~~ai~~v~~~~~~~gk~~G~~~~~~~-~a~~~--~~~G~~~i~~g~D~~~L~~a-~~~~~~~~kk  256 (256)
T PRK10558        185 GHLGNASHPD-VQKAIQHIFARAKAHGKPSGILAPVEA-DARRY--LEWGATFVAVGSDLGVFRSA-TQKLADTFKK  256 (256)
T ss_pred             CCCCCCCCHH-HHHHHHHHHHHHHHCCCCEEEECCCHH-HHHHH--HHCCCCEEEEHHHHHHHHHH-HHHHHHHHCC
T ss_conf             9999999979-999999999999985998799369999-99999--97699899972799999999-9999998509


No 385
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=29.89  E-value=38  Score=14.15  Aligned_cols=43  Identities=19%  Similarity=0.263  Sum_probs=23.5

Q ss_pred             HHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH-HHHHHHHCCC
Q ss_conf             89426888983111221000367899999999999-9999986465
Q gi|254780414|r  391 SFVERHPCPGPGLAIRCIGEITEERINILRESDAI-YREEIHKAGI  435 (520)
Q Consensus       391 ~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad~i-~~~~l~~~~l  435 (520)
                      .+..+-|  =+|--|-++|-.-+-..|=+|++-++ +++.|++.|.
T Consensus       301 ~i~~~~~--l~Gk~iavlgLafKpnTDD~ReSpa~~vi~~L~~~Ga  344 (414)
T COG1004         301 KILNHLG--LKGKTIAVLGLAFKPNTDDMRESPALDIIKRLQEKGA  344 (414)
T ss_pred             HHHHHCC--CCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             9998468--7786799998741699842000317999999997799


No 386
>pfam09075 STb_secrete Heat-stable enterotoxin B, secretory. Members of this family assume a helical secondary structure, with two alpha helices forming a disulphide crosslinked alpha-helical hairpin. The disulphide bonds are crucial for the toxic activity of the protein, and are required for maintenance of the tertiary structure, and subsequent interaction with the particulate form of guanylate cyclase, increasing cyclic GMP levels within the host intestinal epithelial cells.
Probab=29.88  E-value=13  Score=17.40  Aligned_cols=16  Identities=44%  Similarity=0.889  Sum_probs=11.3

Q ss_pred             EEEECHHHHHHHHHCC
Q ss_conf             8997789999899709
Q gi|254780414|r   82 LLGICYGQQIMCQSLG   97 (520)
Q Consensus        82 ILGICyG~QlLa~~~G   97 (520)
                      .-|-|+|.|+|..+-|
T Consensus        32 tagacfgaqimvaakg   47 (48)
T pfam09075        32 TAGACFGAQIMVAAKG   47 (48)
T ss_pred             CCCCCCCHHHHEECCC
T ss_conf             7412204344120046


No 387
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=29.75  E-value=38  Score=14.14  Aligned_cols=25  Identities=32%  Similarity=0.306  Sum_probs=10.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCC
Q ss_conf             3664056404779999998622365
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGIN  249 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~  249 (520)
                      .|.|.||.|-|+++..|+.+-+-+.
T Consensus         4 ~IiGAaG~VG~~~a~~l~~~~~~~e   28 (309)
T cd05294           4 SIIGASGRVGSATALLLAKEDVVKE   28 (309)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCCCE
T ss_conf             9999997699999999983799875


No 388
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli. This dimeric PurR belongs to the LacI-GalR family of transcription regulators and is activated to bind to DNA operator sites by initially binding either of high affinity corepressors, hypoxanthine or guanine. PurR is composed of two functional domains: aan N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the purine transcription repressor undergoes a 
Probab=29.66  E-value=38  Score=14.13  Aligned_cols=64  Identities=8%  Similarity=0.092  Sum_probs=38.6

Q ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             705788998888659406985289898-------899723997999985388999999975376898089988997
Q gi|254780414|r   17 SQFTQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        17 SQytqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      +|..+-|....++.|....+...+.+.       +.+...+++|+|+++...     +.+.........++|+.-+
T Consensus        15 ~~l~~gi~~~~~~~gy~l~i~~s~~~~~~e~~~i~~l~~~~vDGiIi~~~~~-----~~~~~~~~~~~~~iPvV~i   85 (269)
T cd06275          15 AEVVRGVEQYCYRQGYNLILCNTEGDPERQRSYLRMLAQKRVDGLLVMCSEY-----DQPLLAMLERYRHIPMVVM   85 (269)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----CHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999998699899996899989999999999956999999936889-----8378999998289988998


No 389
>PRK08639 threonine dehydratase; Validated
Probab=29.64  E-value=38  Score=14.12  Aligned_cols=27  Identities=22%  Similarity=0.453  Sum_probs=11.8

Q ss_pred             HCCCCEEEEECCC-CHHHHHHHHHHHHC
Q ss_conf             0444036640564-04779999998622
Q gi|254780414|r  220 VGNERVICAVSGG-VDSTVAAFLIYEAI  246 (520)
Q Consensus       220 vg~~kVi~~lSGG-VDStV~A~Ll~kAi  246 (520)
                      ..+++|+|-+||| +|.+...-.+-|++
T Consensus       301 ~~gk~Vv~ilsGgNiD~~~l~~i~er~l  328 (418)
T PRK08639        301 IKGKTVVCVISGGNNDIERMPEIKERSL  328 (418)
T ss_pred             HCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             2698099998158889889999999987


No 390
>PRK06756 flavodoxin; Provisional
Probab=29.46  E-value=38  Score=14.10  Aligned_cols=46  Identities=30%  Similarity=0.329  Sum_probs=28.3

Q ss_pred             HHHHHHHHHHCCCEEEEECC-CCC-HHHHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             78899888865940698528-989-889972399799998538899999997
Q gi|254780414|r   20 TQLIARRVRESKVYCEVIAF-KNA-LDYFKEQNPQAIILSGSPASSLDIDSP   69 (520)
Q Consensus        20 tqLIaRriRelgVyseI~P~-~~~-~e~i~~~~p~GIILSGGP~SV~d~~ap   69 (520)
                      ...|++-+++.|+-.+++.. +.. .+.+.  +++++|| |.|. -.+...|
T Consensus         9 A~~Ia~g~~~~G~~V~~~~~~~~~~~~~l~--~~d~~il-GspT-~g~g~lp   56 (138)
T PRK06756          9 ADHIAGVIRETENEIEVIDIMDSPEASILE--QYDGIIL-GAYT-WGDGDLP   56 (138)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHH--HCCEEEE-ECCC-CCCCCCC
T ss_conf             999999999769907999702677376897--5897999-8887-6878377


No 391
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=29.39  E-value=25  Score=15.42  Aligned_cols=13  Identities=23%  Similarity=0.383  Sum_probs=6.3

Q ss_pred             CCCCEEEEEEEEH
Q ss_conf             3500112465212
Q gi|254780414|r  166 EKRKYYAVQFHPE  178 (520)
Q Consensus       166 ~~~~iyGVQFHPE  178 (520)
                      .++++.++--||-
T Consensus        70 ~g~~~tC~V~H~s   82 (95)
T cd05719          70 NGKELTCVVSHPT   82 (95)
T ss_pred             CCCEEEEEEECCC
T ss_conf             8967189986887


No 392
>PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=29.38  E-value=38  Score=14.10  Aligned_cols=41  Identities=24%  Similarity=0.398  Sum_probs=24.5

Q ss_pred             CHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHH
Q ss_conf             98899723997999985388999999975376898089988997789
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYG   88 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG   88 (520)
                      +++++.+ +++-+|-=||-..     -.+........++|||||-.|
T Consensus        35 ~~~e~~~-~~Dlii~iGGDGT-----~L~a~r~~~~~~iPilGiN~G   75 (272)
T PRK02231         35 SLEEIGQ-RAQLAIVIGGDGN-----MLGRARVLAKYDIPLIGINRG   75 (272)
T ss_pred             CHHHHCC-CCCEEEEECCCHH-----HHHHHHHHHCCCCCEEEECCC
T ss_conf             9889701-7789999787589-----999999860059978965378


No 393
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. coli this enzyme (GarL, ) 2-dehydro-3-deoxyglucarate aldolase acts in the catabolism of several sugars including D-galactarate, D-glucarate and L-idarate. In fact, 5-dehydro-4-deoxy-D-glucarate aldolase is a synonym for this enzyme as it is unclear in the literature whether the enzyme acts on only one of these or, as seems likely, has no preference. (Despite the apparent large difference in substrate stucture indicated by their names, 2-DH-3DO- and 5-DH-4DO-glucarate differ only by the chirality of most central hydroxyl-bearing carbon and is alternately named 2-DH-3DO-galactarate.) The reported product of D-galactarate dehydratase (4.2.1.42) is the 5DH-4DO-glucarate isomer and this enzyme is found proximal to the aldolase in many genomes (GenProp0714) where no epimerase is known. Similarly, the product of D-glucarate dehydratase (4.2.1.40) is again the 5-DH-4DO isomer, so the provenance of the 2-DH-3DO-glucarate isomer for which
Probab=29.22  E-value=39  Score=14.08  Aligned_cols=73  Identities=19%  Similarity=0.253  Sum_probs=45.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             064411140678999999997650444036640564047799999986223656999973895515627899998862
Q gi|254780414|r  197 AGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG  274 (520)
Q Consensus       197 c~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~  274 (520)
                      .|...+|+-.. +.+.++++.+.+....+.+|.-.+-... +.  -....|-++.++=.|.+|||.. .+...+.||+
T Consensus       177 lG~~g~~~~p~-v~~ai~~v~~~~~~~gk~~Gi~~~~~~~-~~--~~~~~G~~~i~~g~D~~~l~~a-a~~~~~~fkk  249 (249)
T TIGR03239       177 LGHLGNPNHPD-VQKAIRHIFDRAAAHGKPCGILAPVEAD-AR--RYLEWGATFVAVGSDLGVFRSA-TQALRDKFKK  249 (249)
T ss_pred             CCCCCCCCCHH-HHHHHHHHHHHHHHCCCCEEEECCCHHH-HH--HHHHCCCCEEEEHHHHHHHHHH-HHHHHHHHCC
T ss_conf             69999999979-9999999999999859966982799999-99--9998699899966899999999-9999998449


No 394
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=29.16  E-value=39  Score=14.07  Aligned_cols=70  Identities=16%  Similarity=0.225  Sum_probs=42.7

Q ss_pred             EEEEECCCCH----HHHHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             9999889705----7889988886594069852898988-------9972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQF----TQLIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQy----tqLIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      ++|=|+...|    .+-|-+..++.|+...|...+.+.+       .+...+++|||+++...     +. .....+.+.
T Consensus         4 vivp~l~n~f~~~l~~~i~~~~~~~gy~~~i~~s~~~~~~e~~~i~~l~~~~vdGiIi~~~~~-----~~-~~~~~l~~~   77 (265)
T cd06285           4 VLVPRLTDTVMATMYEGIEEAAAERGYSTFVANTGDNPDAQRRAIEMLLDRRVDGLILGDARS-----DD-HFLDELTRR   77 (265)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCC-----CH-HHHHHHHHC
T ss_conf             997798778999999999999998699899997999989999999999956999999768879-----98-999999967


Q ss_pred             CCCEEEE
Q ss_conf             9988997
Q gi|254780414|r   79 NIPLLGI   85 (520)
Q Consensus        79 ~iPILGI   85 (520)
                      ++|+.-+
T Consensus        78 ~iPvV~~   84 (265)
T cd06285          78 GVPFVLV   84 (265)
T ss_pred             CCCEEEE
T ss_conf             9978998


No 395
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); however its ligand specificity has not been determined experimentally.
Probab=29.04  E-value=39  Score=14.06  Aligned_cols=33  Identities=15%  Similarity=0.221  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEC----CCCCHHHHHHC
Q ss_conf             65899999999743997099864----62202454202
Q gi|254780414|r  308 QLFIEVFEEEAKKIGGAQFLGQG----TLYPDVIESIS  341 (520)
Q Consensus       308 ~~Fi~vf~~~a~~~~~~~~L~QG----TlypDvIES~~  341 (520)
                      +.|.+-|.+.-.+.+ ..|-+++    .++-+=||.++
T Consensus       257 ~~F~~~y~~~~g~~P-~~~aa~aYDA~~lla~Aie~Ag  293 (312)
T cd06346         257 EAFTSAYKAAYGESP-SAFADQSYDAAALLALAYQGAS  293 (312)
T ss_pred             HHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999878799-6207999999999999998768


No 396
>pfam06611 DUF1145 Protein of unknown function (DUF1145). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=29.01  E-value=20  Score=16.12  Aligned_cols=14  Identities=36%  Similarity=0.885  Sum_probs=8.2

Q ss_pred             CCCCCC-CCEEEECC
Q ss_conf             888983-11122100
Q gi|254780414|r  396 HPCPGP-GLAIRCIG  409 (520)
Q Consensus       396 hPFPGP-GLaiRi~g  409 (520)
                      |||||| ++.+.+.+
T Consensus        23 ~Pfp~pl~~~l~i~~   37 (61)
T pfam06611        23 MPFPGPLAILLNIAG   37 (61)
T ss_pred             CCCCCCHHHHHHHHH
T ss_conf             689842678999999


No 397
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses. In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if
Probab=28.83  E-value=39  Score=14.03  Aligned_cols=72  Identities=14%  Similarity=0.207  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHCCC--CCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHH-----HHHHHHHHHCCCCEEEEEECC
Q ss_conf             57799875501064--4111406789999999976504440366405640477-----999999862236569999738
Q gi|254780414|r  186 SQLIDNFVHHVAGI--QDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST-----VAAFLIYEAIGINLTCVLVDH  257 (520)
Q Consensus       186 ~~iL~NFl~~Ic~~--~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDSt-----V~A~Ll~kAig~~l~~vfVD~  257 (520)
                      ..-+++++-.|-..  ...=.+..=+...++.+++.-...++|+.||=|.|.+     ..++=+.+.-|-++++|-|-.
T Consensus        64 ~~~~~~~l~~i~~~~~~ggT~i~~al~~a~~~l~~~~~~~~~ivLlTDG~~n~g~~~~~~~~~~a~~~gi~v~tIGvG~  142 (180)
T cd01467          64 RESLKELLEDIKIGLAGQGTAIGDAIGLAIKRLKNSEAKERVIVLLTDGENNAGEIDPATAAELAKNKGVRIYTIGVGK  142 (180)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEEEEECC
T ss_conf             8999999862244532368608999999999764247666379998058866787699999999997699899999778


No 398
>pfam06414 Zeta_toxin Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.
Probab=28.69  E-value=31  Score=14.72  Aligned_cols=14  Identities=36%  Similarity=0.876  Sum_probs=8.8

Q ss_pred             CCCCEEEECCCCCC
Q ss_conf             39979999853889
Q gi|254780414|r   49 QNPQAIILSGSPAS   62 (520)
Q Consensus        49 ~~p~GIILSGGP~S   62 (520)
                      .+|++||+.|+|+|
T Consensus        10 ~~Pkai~laG~pGA   23 (191)
T pfam06414        10 ERPVAVLLGGQPGA   23 (191)
T ss_pred             CCCEEEEEECCCCC
T ss_conf             69879999579988


No 399
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=28.47  E-value=40  Score=13.99  Aligned_cols=88  Identities=19%  Similarity=0.242  Sum_probs=49.0

Q ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCC---HHHHHHCC-----------------CCEEEECCCC
Q ss_conf             986344886999988970578899888865940698528989---88997239-----------------9799998538
Q gi|254780414|r    1 MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNA---LDYFKEQN-----------------PQAIILSGSP   60 (520)
Q Consensus         1 m~~~~~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~---~e~i~~~~-----------------p~GIILSGGP   60 (520)
                      |-...+..+|+|+=+|- -..-.||-+.+.|....+......   .+.+....                 .+-||.|.|=
T Consensus         1 ~~~~~~~k~vlV~GlG~-sG~a~a~~L~~~G~~V~~~D~~~~~~~~~~l~~~~~~~~~~~g~~~~~~~~~~d~vV~SPGI   79 (501)
T PRK02006          1 MFGDRQRPMVLVLGLGE-SGLAMARWCARHGCRLRVADTREAPPNLAALQAEGIDAEFVGGAFDPALLDGVELVALSPGL   79 (501)
T ss_pred             CCCCCCCCEEEEEEECH-HHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCCEEECCCCCHHHHCCCCEEEECCEE
T ss_conf             97666898399983368-89999999997898499998999986199998608981897788986784689999989900


Q ss_pred             CCCCCCCCCCCCH---HHHHCCCCEEE-ECHHHHHHH
Q ss_conf             8999999975376---89808998899-778999989
Q gi|254780414|r   61 ASSLDIDSPQIPK---EILESNIPLLG-ICYGQQIMC   93 (520)
Q Consensus        61 ~SV~d~~ap~~~~---~I~~~~iPILG-ICyG~QlLa   93 (520)
                          .++.|...+   ..-+.++||++ |=+..|.+.
T Consensus        80 ----~p~~p~~~~~l~~A~~~gi~i~~eiel~~~~~~  112 (501)
T PRK02006         80 ----SPLEPALAALLAAARERGIPVWGELELFAQALA  112 (501)
T ss_pred             ----CCCCCCHHHHHHHHHHCCCCEEEHHHHHHHHHH
T ss_conf             ----888854319999999879958768999998876


No 400
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems. Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems, all of which contain the type I periplasmic binding protein-like fold. Their specific ligands include lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor; in general the sugar binding domain in this family binds a sugar, which in turn changes the DNA binding activity of the repressor domain.  The core structure of the periplasmic binding proteins is classified into two types and they differ in number and order of beta strands in each domain: type I, which has six beta strands, and type II, which has five beta strands. These two distinct structural arrangem
Probab=28.47  E-value=40  Score=13.99  Aligned_cols=67  Identities=18%  Similarity=0.257  Sum_probs=40.4

Q ss_pred             ECCCCHHHH----HHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCE
Q ss_conf             889705788----998888659406985289898-------899723997999985388999999975376898089988
Q gi|254780414|r   14 DFGSQFTQL----IARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPL   82 (520)
Q Consensus        14 DfGSQytqL----IaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPI   82 (520)
                      |.-+-|...    |.+..++.|+...+.+.+.+.       +.+...+++|||+.+...     ..+.....+.+.++|+
T Consensus         8 ~~~~~f~~~~~~gi~~~a~~~gy~~~~~~~~~~~~~~~~~i~~~~~~~vDgiIi~~~~~-----~~~~~~~~~~~~~ipv   82 (264)
T cd01537           8 DLDNPFFAQVLKGIEEAAKAAGYQVLLANSQNDAEKQLSALENLIARGVDGIIIAPSDL-----TAPTIVKLARKAGIPV   82 (264)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----CCHHHHHHHHHCCCCE
T ss_conf             89779999999999999998699899997999989999999999976999999967988-----8689999999759979


Q ss_pred             EEE
Q ss_conf             997
Q gi|254780414|r   83 LGI   85 (520)
Q Consensus        83 LGI   85 (520)
                      .-+
T Consensus        83 V~~   85 (264)
T cd01537          83 VLV   85 (264)
T ss_pred             EEE
T ss_conf             998


No 401
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=28.22  E-value=40  Score=13.96  Aligned_cols=70  Identities=14%  Similarity=0.224  Sum_probs=40.5

Q ss_pred             EEEEECCCCH----HHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             9999889705----788998888659406985289898-------89972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQF----TQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQy----tqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      |+|=|....|    .+-|.+..++.|....+...+.+.       +.+...+++|||++.+.     +..+.....+-+.
T Consensus         4 vivp~i~npff~~~~~gi~~~~~~~Gy~~ll~~s~~~~~~e~~~l~~l~~~~vdGiIi~~~~-----~~~~~~~~~~~~~   78 (269)
T cd06281           4 CLVSDITNPLLAQLFSGAEDRLRAAGYSLLIANSLNDPERELEILRSFEQRRMDGIIIAPGD-----ERDPELVDALASL   78 (269)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCC-----CCCHHHHHHHHHC
T ss_conf             99889878999999999999999869989999689998999999999985799899976777-----7999999999847


Q ss_pred             CCCEEE
Q ss_conf             998899
Q gi|254780414|r   79 NIPLLG   84 (520)
Q Consensus        79 ~iPILG   84 (520)
                      ++|+.-
T Consensus        79 ~iPvV~   84 (269)
T cd06281          79 DLPIVL   84 (269)
T ss_pred             CCCEEE
T ss_conf             998899


No 402
>pfam03530 SK_channel Calcium-activated SK potassium channel.
Probab=28.10  E-value=22  Score=15.87  Aligned_cols=12  Identities=33%  Similarity=0.647  Sum_probs=7.7

Q ss_pred             HHCCCCCCCCCC
Q ss_conf             942688898311
Q gi|254780414|r  392 FVERHPCPGPGL  403 (520)
Q Consensus       392 ~~~RhPFPGPGL  403 (520)
                      +-.=|||||++.
T Consensus       105 vC~IhP~Pg~~~  116 (120)
T pfam03530       105 VCAIHPIPGTYI  116 (120)
T ss_pred             HHCCCCCCCCEE
T ss_conf             841068996278


No 403
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=28.00  E-value=40  Score=13.93  Aligned_cols=70  Identities=16%  Similarity=0.278  Sum_probs=40.5

Q ss_pred             EEEEECCCCHH----HHHHHHHHHCCCEEEEECCCCCH------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCC
Q ss_conf             99998897057----88998888659406985289898------899723997999985388999999975376898089
Q gi|254780414|r   10 VLIIDFGSQFT----QLIARRVRESKVYCEVIAFKNAL------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESN   79 (520)
Q Consensus        10 IlIlDfGSQyt----qLIaRriRelgVyseI~P~~~~~------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~   79 (520)
                      ++|=|+...|-    +-|.+..++.|....+...+.+.      +.+...+++|||+.++..      .......+.+.+
T Consensus         4 vivp~i~npff~~i~~gie~~~~~~gy~~ll~~~~~~~~~e~~l~~l~~~~vDGiIi~~~~~------~~~~~~~~~~~~   77 (266)
T cd06278           4 VVVADLDNPFYSELLEALSRALQARGYQPLLINTDDDEDLDAALRQLLQYRVDGVIVTSGTL------SSELAEECRRNG   77 (266)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC------CHHHHHHHHHCC
T ss_conf             99799876999999999999999869999999799988999999999955999999948989------999999999769


Q ss_pred             CCEEEE
Q ss_conf             988997
Q gi|254780414|r   80 IPLLGI   85 (520)
Q Consensus        80 iPILGI   85 (520)
                      +|+.-+
T Consensus        78 iPvV~i   83 (266)
T cd06278          78 IPVVLI   83 (266)
T ss_pred             CCEEEE
T ss_conf             989997


No 404
>KOG3395 consensus
Probab=27.92  E-value=30  Score=14.83  Aligned_cols=22  Identities=27%  Similarity=0.377  Sum_probs=15.6

Q ss_pred             HHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             999996689888999988756589
Q gi|254780414|r  288 RFIRKLKNIVDPETKRKVIGQLFI  311 (520)
Q Consensus       288 ~Fl~~L~gv~DPE~KRkiIG~~Fi  311 (520)
                      +.--.|.|+  ||+|||.|-++|-
T Consensus        29 ~~~v~~~~~--PdqKRK~i~E~~T   50 (246)
T KOG3395          29 EVDVLLHGT--PDQKRKLIRECLT   50 (246)
T ss_pred             HHHHHHHCC--CHHHHHHHHHHHC
T ss_conf             888986079--2777889999861


No 405
>PRK04759 consensus
Probab=27.82  E-value=41  Score=13.91  Aligned_cols=91  Identities=14%  Similarity=0.150  Sum_probs=47.2

Q ss_pred             CCCCCCCCEEEEEE-CCC----CHHHHHHHHHHHCCCEEEEEC----------CC--CCHHHHHHCCCCEEEECCCCCCC
Q ss_conf             98634488699998-897----057889988886594069852----------89--89889972399799998538899
Q gi|254780414|r    1 MHKRERSSKVLIID-FGS----QFTQLIARRVRESKVYCEVIA----------FK--NALDYFKEQNPQAIILSGSPASS   63 (520)
Q Consensus         1 m~~~~~~~~IlIlD-fGS----QytqLIaRriRelgVyseI~P----------~~--~~~e~i~~~~p~GIILSGGP~SV   63 (520)
                      |++.  -.+|+|+- ..+    +..+-|++.+.+.|+.+-+-+          .+  .+.+++ ..+.+-+|--||-.+.
T Consensus         1 M~~~--f~~I~Iv~k~~~~~~~~~~~~l~~~L~~~g~~v~vd~~~~~~l~~~~~~~~~~~~~l-~~~~Dlvi~lGGDGTl   77 (294)
T PRK04759          1 MKKP--FNVIAIIGKPRDQQAIQTHKELYHWLTSLGYTVFIDDRLAAILTDVPQEHFASLVEL-GKKADLAIVVGGDGNM   77 (294)
T ss_pred             CCCC--CCEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCCHHHC-CCCCCEEEEECCCHHH
T ss_conf             9999--979999941799799999999999998689999991688655334772223775563-7665689998478589


Q ss_pred             CCCCCCCCCHHHHHCCCCEEEECHHH-------------HHHHHHCCCE
Q ss_conf             99999753768980899889977899-------------9989970969
Q gi|254780414|r   64 LDIDSPQIPKEILESNIPLLGICYGQ-------------QIMCQSLGGK   99 (520)
Q Consensus        64 ~d~~ap~~~~~I~~~~iPILGICyG~-------------QlLa~~~GG~   99 (520)
                           .+....+...++|||||-+|.             |.|...+-|+
T Consensus        78 -----L~aar~~~~~~~PilgiN~G~lGFLt~~~~~~~~~~l~~il~g~  121 (294)
T PRK04759         78 -----LGAARVLSRFDISVIGVNRGNLGFLTDLNPEDFQERLQAVLDGE  121 (294)
T ss_pred             -----HHHHHHHCCCCCCEEEEECCCEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             -----99999860169968988458646741468889999999997599


No 406
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]
Probab=27.66  E-value=17  Score=16.69  Aligned_cols=34  Identities=26%  Similarity=0.199  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCH-HHHCCCCCCCCC
Q ss_conf             3789873899999999819998-894268889831
Q gi|254780414|r  369 EPLKELFKDEVRLLGKELRLPD-SFVERHPCPGPG  402 (520)
Q Consensus       369 EPl~~l~KdEVR~lg~~Lglp~-~~~~RhPFPGPG  402 (520)
                      |-+.+..+++..+++..-+-|. --++|++.--|=
T Consensus       359 ee~~~~~l~~L~~~~~~~~~~~~~~v~r~~~~~Pq  393 (444)
T COG1232         359 EELVAAVLDDLKKLGGINGDPVFVEVTRWKYAMPQ  393 (444)
T ss_pred             HHHHHHHHHHHHHHCCCCCCHHHEEEEECCCCCCC
T ss_conf             99999999999997386766153244322466775


No 407
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases; InterPro: IPR005958   This entry describes tyrosine aminotransferase (2.6.1.5 from EC) as found in animals and Trypanosoma cruzi (Euglenozoa). It is the first enzyme of a pathway of tyrosine degradation via homogentisate.  L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate. Several plant enzyme designated as probable tyrosine aminotransferases are very closely related to an experimentally demonstrated nicotianamine aminotransferase, an enzyme in a siderophore (iron uptake chelator) biosynthesis pathway are included in this family. ; GO: 0008483 transaminase activity, 0030170 pyridoxal phosphate binding, 0006519 amino acid and derivative metabolic process.
Probab=27.54  E-value=41  Score=13.88  Aligned_cols=28  Identities=21%  Similarity=0.444  Sum_probs=11.7

Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEE
Q ss_conf             979999853889999999753768980899889
Q gi|254780414|r   51 PQAIILSGSPASSLDIDSPQIPKEILESNIPLL   83 (520)
Q Consensus        51 p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPIL   83 (520)
                      |+.++++|     .|+++|.+.-.-|...+|||
T Consensus       226 Y~~~Vf~d-----kDPn~~F~p~a~f~~~VPvl  253 (424)
T TIGR01265       226 YGHLVFGD-----KDPNAPFVPMASFASIVPVL  253 (424)
T ss_pred             CCCCCCCC-----CCCCCCCCCCCCCCCCCCEE
T ss_conf             16414488-----97888622300357868868


No 408
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1.  Fab1p is important for vacuole size regulation, presumably by modulating PtdIns(3,5)P2 effector activity. In the human homolog p235/PIKfyve deletion of this domain leads to loss of catalytic activity. However no exact function this domain has been defined. In general, chaperonins are involved in productive folding of proteins.
Probab=27.49  E-value=41  Score=13.87  Aligned_cols=31  Identities=23%  Similarity=0.371  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH
Q ss_conf             6789999999976504440366405640477999
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAA  239 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A  239 (520)
                      +.|+.+.++.|.+ .|-+=|+|  .+|||--..-
T Consensus       116 ~~~l~~~v~~I~~-~g~nVVl~--~k~I~d~A~~  146 (261)
T cd03334         116 KEYLKNLVSRIVA-LRPDVILV--EKSVSRIAQD  146 (261)
T ss_pred             HHHHHHHHHHHHH-HCCCEEEE--CCCCCHHHHH
T ss_conf             9999999999996-09999998--8977989999


No 409
>PRK11761 cysM cysteine synthase B; Provisional
Probab=27.45  E-value=41  Score=13.87  Aligned_cols=83  Identities=12%  Similarity=0.139  Sum_probs=39.3

Q ss_pred             HHCCCCCCCCCHHHHHHH-HHHHHH--HHCCC-CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHH
Q ss_conf             010644111406789999-999976--50444-03664056404779999998622365699997389551562789999
Q gi|254780414|r  195 HVAGIQDNWVMSSYHKEI-VSRIKE--QVGNE-RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIIS  270 (520)
Q Consensus       195 ~Ic~~~~~W~~~~~~~~~-i~~Ir~--~vg~~-kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~  270 (520)
                      +.=.+.++++.++..-.. +....+  ++..+ .|+++=||---.++|  +.-+..|-+++++.      -.+-+.+-.+
T Consensus        32 K~E~~nptGS~KdR~A~~~i~~a~~~G~l~~g~~vveaSSGN~g~alA--~~a~~~G~~~~iv~------p~~~s~~k~~  103 (296)
T PRK11761         32 KLEGNNPAGSVKDRPALSMIVQAEKRGEIKPGDTLIEATSGNTGIALA--MAAAIKGYRMKLIM------PENMSQERRA  103 (296)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHH--HHHHHCCCEEEEEC------CCCCCHHHHH
T ss_conf             862579745829999999999999749989998799937886799999--99998197479967------8657889999


Q ss_pred             HHHHCCCCCEEEEEHH
Q ss_conf             8862369857997588
Q gi|254780414|r  271 LFKGYPNFPLRVVDAS  286 (520)
Q Consensus       271 ~~~~~~~~~l~~vda~  286 (520)
                      .++. +|-+++.++..
T Consensus       104 ~l~~-~GAeVi~~~~~  118 (296)
T PRK11761        104 AMRA-YGAELILVPKE  118 (296)
T ss_pred             HHHH-CCCCEEEECCC
T ss_conf             9997-49955741777


No 410
>KOG0628 consensus
Probab=27.43  E-value=41  Score=13.86  Aligned_cols=111  Identities=18%  Similarity=0.153  Sum_probs=57.4

Q ss_pred             EEEEEECCCCEE-EEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHH
Q ss_conf             788986350011-2465212221520257799875501064411140678999999997650444036640564047799
Q gi|254780414|r  160 FAFIADEKRKYY-AVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVA  238 (520)
Q Consensus       160 iaai~~~~~~iy-GVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~  238 (520)
                      |+-++.+.+.+- -=|=|||...    ..++.+|+-   =|+..      ....+++- -.++.=| +=.+-+.-++..-
T Consensus       154 vallaaR~~~i~~~k~~~p~~~e----~~~~~~lV~---Y~SDq------ahssveka-~~i~~Vk-lR~l~td~n~~mr  218 (511)
T KOG0628         154 VALLAARTEKIEEIKSRPPELHE----SSVLARLVA---YCSDQ------AHSSVEKA-CLIAGVK-LRALPTDENFGMR  218 (511)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCC----HHHHHHHEE---EECCC------CCCHHHHH-HHHCCEE-EEEEECCCCCCCC
T ss_conf             99999999999986328976440----556534248---82476------41268876-7440026-8885136676778


Q ss_pred             HHHHHHHCCC----CEEEEEE-----CCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHH
Q ss_conf             9999862236----5699997-----38955156278999988623698579975889
Q gi|254780414|r  239 AFLIYEAIGI----NLTCVLV-----DHGFMRKNEVENIISLFKGYPNFPLRVVDASE  287 (520)
Q Consensus       239 A~Ll~kAig~----~l~~vfV-----D~GllRknE~~~v~~~~~~~~~~~l~~vda~~  287 (520)
                      ...|++||-+    -|+.+||     -+|----++-+++-..-+++ |+=| +|||+=
T Consensus       219 ~~~L~~AIe~D~arGlIPf~v~at~GTT~~ca~D~l~elg~Vc~~~-glWL-HVDAAY  274 (511)
T KOG0628         219 GDTLRKAIEEDIARGLIPFFVCATLGTTSSCAFDELEELGPVCREE-GLWL-HVDAAY  274 (511)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCHHHHCCHHHHC-CEEE-EEEHHH
T ss_conf             7999999999986798657999840576555554187741035226-8789-963453


No 411
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=27.31  E-value=42  Score=13.85  Aligned_cols=32  Identities=31%  Similarity=0.432  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHCC----CCEEEEECCCCHHHHH
Q ss_conf             7899999999765044----4036640564047799
Q gi|254780414|r  207 SYHKEIVSRIKEQVGN----ERVICAVSGGVDSTVA  238 (520)
Q Consensus       207 ~~~~~~i~~Ir~~vg~----~kVi~~lSGGVDStV~  238 (520)
                      .-.++.+.++-+.+|=    ++-.-.||||----|+
T Consensus       103 ~~~~~~~~~~L~~vgL~~~~~~~p~~LSGGqkQRVa  138 (255)
T PRK11248        103 MQRLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVG  138 (255)
T ss_pred             HHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHH
T ss_conf             899999999999769902441893349999999999


No 412
>pfam11186 DUF2972 Protein of unknown function (DUF2972). Some members in this family of proteins with unknown function are annotated as sugar transferase proteins, however this cannot be confirmed.
Probab=27.27  E-value=42  Score=13.84  Aligned_cols=50  Identities=24%  Similarity=0.384  Sum_probs=33.7

Q ss_pred             EHHHHHHHHHCCCCCHHHHH--------------HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHC
Q ss_conf             58899999966898889999--------------88756589999999974399709986462202454202
Q gi|254780414|r  284 DASERFIRKLKNIVDPETKR--------------KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESIS  341 (520)
Q Consensus       284 da~~~Fl~~L~gv~DPE~KR--------------kiIG~~Fi~vf~~~a~~~~~~~~L~QGTlypDvIES~~  341 (520)
                      +.=..|+.+|+...+-|+++              |-+...|=.+++++..-++        .-+||+|+|=.
T Consensus       121 ~YL~~fi~~L~~~~~~e~~k~~~E~DvL~ylk~nk~l~~kfK~ilD~eL~~IK--------q~RPDIVaSWK  184 (197)
T pfam11186       121 KYLKKFIEALEKQVKIEESKKLKEKDVLEYLKENKQLRLKFKNILDKELQYIK--------QHRPDIVASWK  184 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHH--------HHCCCHHHHHH
T ss_conf             99999999999999899983299999999998698999999999999999998--------72986877868


No 413
>PRK04804 minC septum formation inhibitor; Reviewed
Probab=27.22  E-value=42  Score=13.84  Aligned_cols=110  Identities=18%  Similarity=0.268  Sum_probs=60.0

Q ss_pred             CCHHHHHCCCCEEEECHH----HHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH--C
Q ss_conf             376898089988997789----9998997096999869866103667523886222787266553368600220110--1
Q gi|254780414|r   71 IPKEILESNIPLLGICYG----QQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE--H  144 (520)
Q Consensus        71 ~~~~I~~~~iPILGICyG----~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~--~  144 (520)
                      +...+.+.+....||+-+    ++..+...|-.+.......- ..+.. .....+.++-  ..+.++|+-.++|-|.  .
T Consensus        63 L~~~l~~~gl~~vgi~g~~~~~~~~~a~~~gl~~~~~~~~~~-~~~~~-~~pt~ii~~p--VRSGQqVya~~gDLvVlg~  138 (220)
T PRK04804         63 LKQGISQAGMIPVGITGCKDKRKQNLASEAGFAIMTATKSPV-QAPAK-MAPTKVVRTP--IRSGQQIYAKDGDLVILNH  138 (220)
T ss_pred             HHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCCCCCCCCC-CCCCC-CCCCEEEECC--CCCCCEEEECCCCEEEECC
T ss_conf             999999879979999668807768888747875456776767-89887-8884698067--4588789956999899824


Q ss_pred             CCCCCCEEECCCCCCEEEEE---------ECCCCEEEEEEEEHHHCCCHH
Q ss_conf             24442112323983178898---------635001124652122215202
Q gi|254780414|r  145 IPEGFEVIASSDSTPFAFIA---------DEKRKYYAVQFHPEVVHTVGG  185 (520)
Q Consensus       145 lP~gf~viA~S~~~~iaai~---------~~~~~iyGVQFHPEV~hT~~G  185 (520)
                      +.+|.+++|.-+-..+..++         +.+-.||+-+|.||.. |-.|
T Consensus       139 Vs~GAEViAdGnIhVyG~LRGrA~AGa~Gd~~ArIFc~~l~aELv-sIaG  187 (220)
T PRK04804        139 VSAGAEVIADGSIHIHGTLRGRAIAGASGQKEARIICHDLQAELI-SIAG  187 (220)
T ss_pred             CCCCCEEEECCCEEEEEEECCEEEECCCCCCCCEEEECCCCCEEE-EEEE
T ss_conf             699978993898999987044497257899740899501880348-8960


No 414
>cd00363 PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to PFK family that includes ATP- and pyrophosphate (PPi)- dependent phosphofructokinases. Some members evolved by gene duplication and thus have a large C-terminal/N-terminal extension comprising a second PFK domain. Generally, ATP-PFKs are allosteric homotetramers, and  PPi-PFKs are dimeric and nonallosteric except for plant PPi-PFKs which are allosteric heterotetramers.
Probab=26.88  E-value=14  Score=17.14  Aligned_cols=41  Identities=15%  Similarity=0.313  Sum_probs=23.3

Q ss_pred             EEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHH
Q ss_conf             99998538899999997537689808998899778999989
Q gi|254780414|r   53 AIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMC   93 (520)
Q Consensus        53 GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa   93 (520)
                      ||+-||||......-.-.+-......+.-++||-+|.+=|.
T Consensus         4 aIltsGG~~pGmNa~ir~vv~~a~~~g~~v~Gi~~G~~GL~   44 (338)
T cd00363           4 GVLTSGGDAPGMNAAIRGVVRSAIAEGLEVYGIYEGYAGLV   44 (338)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHC
T ss_conf             99868888668889999999999977999999825777770


No 415
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs. Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs from other bacteria. The members of this group are highly homologous to a family of periplasmic pentose/hexose sugar-binding proteins that function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea, and that are members of the type I periplasmic binding protein superfamily. The Vibrio harveyi AI-2 receptor consists of two polypeptides, LuxP and LuxQ:  LuxP is a periplasmic binding protein that binds AI-2 by clamping it between two domains, LuxQ is an integral membrane protein belonging to the two-component sensor kinase family. Unlike AI-2 bound to the LsrB receptor in Salmonella typhimurium, the Vibrio harveyi AI-2 signaling molecule has an unusual furanosyl borate 
Probab=26.83  E-value=42  Score=13.79  Aligned_cols=52  Identities=21%  Similarity=0.273  Sum_probs=31.5

Q ss_pred             EEEEEECCCC-------HHHHHHHHHHHCCCEEEEECCC----CC-------HHHHHHCCCCEEEECCCC
Q ss_conf             6999988970-------5788998888659406985289----89-------889972399799998538
Q gi|254780414|r    9 KVLIIDFGSQ-------FTQLIARRVRESKVYCEVIAFK----NA-------LDYFKEQNPQAIILSGSP   60 (520)
Q Consensus         9 ~IlIlDfGSQ-------ytqLIaRriRelgVyseI~P~~----~~-------~e~i~~~~p~GIILSGGP   60 (520)
                      ||.++==|.|       +..-+..|..||||--+|..+.    .+       ++.....+|++|||+.-+
T Consensus         1 ~ia~~~Pg~~~sdfW~~~~~g~e~~a~eLGI~~ei~~~~~~~~~D~~~Q~~~le~~i~~~~D~Ii~tp~~   70 (280)
T cd06303           1 KIAVIYPGQQISDYWVRNIASFTARLEELNIPYELTQFSSRPGIDHRLQSQQLNEALQSKPDYLIFTLDS   70 (280)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9579847987445899999999999998499869988147887479999999999985379989991680


No 416
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of AraR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which i
Probab=26.79  E-value=42  Score=13.79  Aligned_cols=76  Identities=12%  Similarity=0.094  Sum_probs=42.8

Q ss_pred             EEEEECCC----CHHHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             99998897----05788998888659406985289898-------89972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGS----QFTQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGS----QytqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      ++|=|+..    +..+-|.+..++.|+...|...+.+.       +.+...+++|||+.+.-++..+++ ...-..+-+.
T Consensus         4 vivp~l~n~ff~~~~~gi~~~~~~~gy~~li~~s~~~~~~e~~~l~~l~~~~vdGiIl~~~~~~~~~~~-~~~~~~l~~~   82 (273)
T cd01541           4 VITTYISDYIFPSIIRGIESVLSEKGYSLLLASTNNDPERERKCLENMLSQGIDGLIIEPTKSALPNPN-IDLYLKLEKL   82 (273)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-HHHHHHHHHC
T ss_conf             995887657999999999999998699899997899989999999999965999899925310357877-7999999976


Q ss_pred             CCCEEEEC
Q ss_conf             99889977
Q gi|254780414|r   79 NIPLLGIC   86 (520)
Q Consensus        79 ~iPILGIC   86 (520)
                      ++|+.-|.
T Consensus        83 ~iPvV~i~   90 (273)
T cd01541          83 GIPYVFIN   90 (273)
T ss_pred             CCCEEEEE
T ss_conf             99899995


No 417
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=26.69  E-value=43  Score=13.77  Aligned_cols=62  Identities=19%  Similarity=0.270  Sum_probs=39.4

Q ss_pred             CCHHHHHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             7057889988886594069852898988-------99723997999985388999999975376898089988997
Q gi|254780414|r   17 SQFTQLIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus        17 SQytqLIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      ++..+-|.+..++.|....+...+.+.+       .+...+++|||+.|...       +.....+.+.++|+.-+
T Consensus        18 ~~l~~gie~~~~~~Gy~lll~~~~~~~~~e~~~~~~l~~~~vdGiI~~~~~~-------~~~~~~l~~~~~P~V~i   86 (268)
T cd06277          18 SEIYRAIEEEAKKYGYNLILKFVSDEDEEEFELPSFLEDGKVDGIILLGGIS-------TEYIKEIKELGIPFVLV   86 (268)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-------HHHHHHHHHCCCCEEEE
T ss_conf             9999999999998499899993899989999999999948987899978999-------79999999759989996


No 418
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2. Subgroup 2 includes uncharacterized putative rhodanese-related domains.
Probab=26.53  E-value=43  Score=13.75  Aligned_cols=46  Identities=13%  Similarity=0.156  Sum_probs=31.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCC
Q ss_conf             999997650444036640564047799999986223-6569999738955
Q gi|254780414|r  212 IVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFM  260 (520)
Q Consensus       212 ~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~Gll  260 (520)
                      ...++...-.+++|++--.+|..|..+|.+|.++ | +++..  +.-|+.
T Consensus        48 ~~~~~~~~~~d~~iv~~C~~G~rS~~aa~~L~~~-G~~~V~~--L~GGi~   94 (101)
T cd01528          48 RSKELDSDNPDKDIVVLCHHGGRSMQVAQWLLRQ-GFENVYN--LQGGID   94 (101)
T ss_pred             HHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHC-CCCCEEE--ECCHHH
T ss_conf             9997341168980899838981599999999985-9977798--476199


No 419
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=26.43  E-value=43  Score=13.74  Aligned_cols=135  Identities=20%  Similarity=0.283  Sum_probs=72.4

Q ss_pred             CEEEEEEEEHHHCCCHHHHHHHHHHHHHCCC-CCCCC--C---HHHHHHHHHHHHHHHCCCC-EEEEECCCCHHHHHHHH
Q ss_conf             0112465212221520257799875501064-41114--0---6789999999976504440-36640564047799999
Q gi|254780414|r  169 KYYAVQFHPEVVHTVGGSQLIDNFVHHVAGI-QDNWV--M---SSYHKEIVSRIKEQVGNER-VICAVSGGVDSTVAAFL  241 (520)
Q Consensus       169 ~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic~~-~~~W~--~---~~~~~~~i~~Ir~~vg~~k-Vi~~lSGGVDStV~A~L  241 (520)
                      -+=||+-|     .-+|. +|..||....+- +..|-  .   -.|+.+.++.||+.||++. |.+-+|+- |       
T Consensus       150 GfDgVEIH-----~ahGy-Ll~qFLSp~~N~RtDeYGGs~eNR~Rf~~Eiv~aVr~~vg~d~~v~~Ris~~-d-------  215 (353)
T cd02930         150 GYDGVEIM-----GSEGY-LINQFLAPRTNKRTDEWGGSFENRMRFPVEIVRAVRAAVGEDFIIIYRLSML-D-------  215 (353)
T ss_pred             CCCEEEEC-----CCCCH-HHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC-C-------
T ss_conf             99989962-----56761-4877338754788574579878887999999999999709987499973601-2-------


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHH-C--CCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9862236569999738955156278999988623698579975889999996-6--898889999887565899999999
Q gi|254780414|r  242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKL-K--NIVDPETKRKVIGQLFIEVFEEEA  318 (520)
Q Consensus       242 l~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L-~--gv~DPE~KRkiIG~~Fi~vf~~~a  318 (520)
                                  +++.|+ ...|..++.+.+.+ .|+++..|...  +.... .  ...-|+       ..|.+ +-+..
T Consensus       216 ------------~~~~G~-~~~e~~~~~~~l~~-~GvD~i~vs~G--~~~~~~~~~~~~~p~-------g~~~~-~a~~i  271 (353)
T cd02930         216 ------------LVEGGS-TWEEVVALAKALEA-AGADILNTGIG--WHEARVPTIATSVPR-------GAFAW-ATAKL  271 (353)
T ss_pred             ------------CCCCCC-CHHHHHHHHHHHHH-CCCCEEEECCC--CCCCCCCCCCCCCCC-------HHHHH-HHHHH
T ss_conf             ------------689998-99999999999998-19999996377--444668753345772-------36699-99998


Q ss_pred             HHCCCCEEEEECCC-CCHHHHHHC
Q ss_conf             74399709986462-202454202
Q gi|254780414|r  319 KKIGGAQFLGQGTL-YPDVIESIS  341 (520)
Q Consensus       319 ~~~~~~~~L~QGTl-ypDvIES~~  341 (520)
                      ++.-+....+.|-+ .||.+|..-
T Consensus       272 r~~~~~Pvi~~G~i~~p~~ae~~l  295 (353)
T cd02930         272 KRAVDIPVIASNRINTPEVAERLL  295 (353)
T ss_pred             HHHCCCCEEECCCCCCHHHHHHHH
T ss_conf             875483489659979899999999


No 420
>PRK05479 ketol-acid reductoisomerase; Provisional
Probab=26.42  E-value=43  Score=13.74  Aligned_cols=31  Identities=39%  Similarity=0.389  Sum_probs=22.9

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             44886999988970578899888865940698
Q gi|254780414|r    5 ERSSKVLIIDFGSQFTQLIARRVRESKVYCEV   36 (520)
Q Consensus         5 ~~~~~IlIlDfGSQytqLIaRriRelgVyseI   36 (520)
                      .++.+|+|+-||||= |-=|..+|+-|+...|
T Consensus        15 lk~k~iaViGYGsQG-~AhAlNLrDSG~~V~v   45 (336)
T PRK05479         15 IKGKKVAIIGYGSQG-HAHALNLRDSGVDVVV   45 (336)
T ss_pred             HCCCEEEEECCCCHH-HHHHHHHHHCCCCEEE
T ss_conf             779979997527076-8988553744997799


No 421
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion]
Probab=26.08  E-value=44  Score=13.70  Aligned_cols=44  Identities=16%  Similarity=0.126  Sum_probs=27.0

Q ss_pred             CCEEEECCCCCCCCCCCCCCCCHHHHH--CCCCEEEECHHHHHHHHHCCCE
Q ss_conf             979999853889999999753768980--8998899778999989970969
Q gi|254780414|r   51 PQAIILSGSPASSLDIDSPQIPKEILE--SNIPLLGICYGQQIMCQSLGGK   99 (520)
Q Consensus        51 p~GIILSGGP~SV~d~~ap~~~~~I~~--~~iPILGICyG~QlLa~~~GG~   99 (520)
                      .+-||.+=     .++|.-..-+++++  -+..|++-=.+.|.|-..+.-.
T Consensus        73 iDYIi~~H-----~ePDhsg~l~~ll~~~p~a~ii~s~~~~~~L~~~~~~~  118 (388)
T COG0426          73 IDYIIVNH-----TEPDHSGSLPELLELAPNAKIICSKLAARFLKGFYHDP  118 (388)
T ss_pred             CEEEEECC-----CCCCHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHCCCC
T ss_conf             71999788-----89633546999998688978996389999999744885


No 422
>pfam03575 Peptidase_S51 Peptidase family S51.
Probab=25.92  E-value=44  Score=13.68  Aligned_cols=75  Identities=9%  Similarity=0.220  Sum_probs=44.5

Q ss_pred             HHHHHHHHHHHCCCEEEEECCC-CCHHHHHH--CCCCEEEECCCCCCC-----CCCCCCCCCHHHHHCCCCEEEECHHHH
Q ss_conf             5788998888659406985289-89889972--399799998538899-----999997537689808998899778999
Q gi|254780414|r   19 FTQLIARRVRESKVYCEVIAFK-NALDYFKE--QNPQAIILSGSPASS-----LDIDSPQIPKEILESNIPLLGICYGQQ   90 (520)
Q Consensus        19 ytqLIaRriRelgVyseI~P~~-~~~e~i~~--~~p~GIILSGGP~SV-----~d~~ap~~~~~I~~~~iPILGICyG~Q   90 (520)
                      |+.....+.+.+|.....++.. .+.+++.+  .+-++|.++||..-.     .+.+....-++.++.++|+.|.-=|.-
T Consensus         1 Yv~~~~~~f~~lg~~v~~l~~~~~~~~~~~~~i~~ad~I~v~GGnt~~ll~~l~~~g~~~~l~~~~~~G~~~~G~SAGa~   80 (154)
T pfam03575         1 YVEKFREALEKLGLEVSGLHLFTPSVEDIEAKILKADVIYVGGGNTFHLLKLLRETGLDDIIREAVQAGLPYIGWSAGAN   80 (154)
T ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCEEEECCCHHHHHHHHHHHCCCHHHHHHHHHCCCEEEEECHHHH
T ss_conf             96899999997699778986667974729999985999998987599999999986829999999985977885060466


Q ss_pred             HHH
Q ss_conf             989
Q gi|254780414|r   91 IMC   93 (520)
Q Consensus        91 lLa   93 (520)
                      +.+
T Consensus        81 i~~   83 (154)
T pfam03575        81 VAG   83 (154)
T ss_pred             HCC
T ss_conf             434


No 423
>PRK10116 universal stress protein UspC; Provisional
Probab=25.79  E-value=44  Score=13.66  Aligned_cols=34  Identities=15%  Similarity=0.179  Sum_probs=27.1

Q ss_pred             CCEEEEECCCCHHHHH---HHHHHHHCCCCEEEEEEC
Q ss_conf             4036640564047799---999986223656999973
Q gi|254780414|r  223 ERVICAVSGGVDSTVA---AFLIYEAIGINLTCVLVD  256 (520)
Q Consensus       223 ~kVi~~lSGGVDStV~---A~Ll~kAig~~l~~vfVD  256 (520)
                      ++++.|+-|-=+|..+   |+-+.|+.|-+++.++|+
T Consensus         4 khILVAvDlS~~S~~~i~kA~~lA~~~~AklslihV~   40 (142)
T PRK10116          4 SNILVAVAVTPESQQLLAKAVSIARPVNGKISLITLA   40 (142)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             6899994188506999999999999819989999993


No 424
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function.  Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity.  Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination.  This family also includes the VfNOD32 nodulin from Vicia faba.
Probab=25.64  E-value=44  Score=13.64  Aligned_cols=34  Identities=26%  Similarity=0.424  Sum_probs=25.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             4411140678999999997650444036640564
Q gi|254780414|r  199 IQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGG  232 (520)
Q Consensus       199 ~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGG  232 (520)
                      ...-|..+++--+.++.||++-.+-||++.+.|-
T Consensus        47 F~~~Wd~~~ltP~~V~~~K~~~pnvKV~iSiGG~   80 (253)
T cd06544          47 FNPYWDTENLTPEAVKSIKAQHPNVKVVISIGGR   80 (253)
T ss_pred             EEEECCCCCCCHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             1233046774999999988529980599995687


No 425
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=25.53  E-value=45  Score=13.63  Aligned_cols=124  Identities=18%  Similarity=0.242  Sum_probs=56.5

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHH-------------HHHHHHCCCE--EEE-------CCCC-
Q ss_conf             9979999853889999999753768980899889977899-------------9989970969--998-------6986-
Q gi|254780414|r   50 NPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQ-------------QIMCQSLGGK--TKN-------SQSR-  106 (520)
Q Consensus        50 ~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~-------------QlLa~~~GG~--V~~-------~~~~-  106 (520)
                      +.+-+|--||-.+     -.+....+.+.++|||||-.|.             +.|...+-|+  +++       ...+ 
T Consensus        62 ~~Dlvi~iGGDGT-----~L~a~~~~~~~~iPilGiN~G~lGFL~~~~~~~~~~~l~~i~~g~y~~~~r~~l~~~~~~~~  136 (290)
T PRK01911         62 DFDMVISIGGDGT-----FLRAAARVGNSGIPILGINTGRLGFLADVSPEEIEETIDELLQGKYTIEERSLLQLTCDPKS  136 (290)
T ss_pred             CCCEEEEECCCHH-----HHHHHHHHHHCCCCEEEEECCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEEEEEEEEECCC
T ss_conf             7779999787689-----99999986125996899944881375036888999999999869978987725999993896


Q ss_pred             ----CCCEEEEEECC--CCCCCCCCCCCCCCEEEEEECCCHH-HCCCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHH
Q ss_conf             ----61036675238--8622278726655336860022011-0124442112323983178898635001124652122
Q gi|254780414|r  107 ----EFGRAFIEIKK--NCSLLKGMWEKGSKQQVWMSHGDQV-EHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV  179 (520)
Q Consensus       107 ----EyG~~~I~i~~--~~~lf~gl~~~~~~~~VwmSH~D~V-~~lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV  179 (520)
                          .|.-.++.+.+  ...+.. +.-..+...+....+|.+ ..-|.|-+.-+-|.++||-   +++  .-+++.-|=.
T Consensus       137 ~~~~~~ALNevvi~~~~~~~~i~-~~~~id~~~~~~~~~DGlIvsTPTGSTAYslSaGGPIv---~P~--~~~~~ltPI~  210 (290)
T PRK01911        137 FKDLNYALNEIAVLKRDTSSMIT-IHTYLNGEYLTSYWADGLIIATPTGSTAYSLSCGGPII---VPH--SNNFVITPIA  210 (290)
T ss_pred             CEECCCEEEEEEEEECCCCCCEE-EEEEECCEEEEEEECCEEEEECCCCHHHHHHHCCCCEE---CCC--CCCEEEEECC
T ss_conf             10354654578985068845033-68998789989995367999678855786864699555---698--7608997557


Q ss_pred             HCCCH
Q ss_conf             21520
Q gi|254780414|r  180 VHTVG  184 (520)
Q Consensus       180 ~hT~~  184 (520)
                      -||..
T Consensus       211 PhsL~  215 (290)
T PRK01911        211 PHSLN  215 (290)
T ss_pred             CCCCC
T ss_conf             66467


No 426
>PRK04011 peptide chain release factor 1; Provisional
Probab=25.46  E-value=25  Score=15.41  Aligned_cols=34  Identities=6%  Similarity=0.137  Sum_probs=16.1

Q ss_pred             EEEEECCCC-HHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             366405640-47799999986223656999973895
Q gi|254780414|r  225 VICAVSGGV-DSTVAAFLIYEAIGINLTCVLVDHGF  259 (520)
Q Consensus       225 Vi~~lSGGV-DStV~A~Ll~kAig~~l~~vfVD~Gl  259 (520)
                      +|+|-||.- |-..-.-.+|.-|.++...+ ||.+-
T Consensus       219 iilgGp~~~K~~f~~~d~ld~rL~~kIi~~-~Dv~Y  253 (409)
T PRK04011        219 ILIGGPGPTKEEFLEGDYLHYELKKKILGL-FDVSY  253 (409)
T ss_pred             EEECCCCHHHHHHHHCCCCCHHHHHHEEEE-EECCC
T ss_conf             995168358788632354457788336456-51688


No 427
>TIGR01919 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR010188   This entry represents a bifunctional protein possessing both hisA (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase) and trpF (N-(5'phosphoribosyl)anthranilate isomerase) activities . Thus, it is involved in both the histidine and tryptophan biosynthetic pathways. Enzymes with this property have been described only in the Actinobacteria (High-GC Gram-positive). The enzyme is closely related to the monofunctional HisA proteins and in Actinobacteria, the classical monofunctional TrpF is generally absent.; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0004640 phosphoribosylanthranilate isomerase activity, 0000105 histidine biosynthetic process, 0000162 tryptophan biosynthetic process, 0005737 cytoplasm.
Probab=25.40  E-value=45  Score=13.61  Aligned_cols=104  Identities=19%  Similarity=0.387  Sum_probs=43.3

Q ss_pred             EEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCC--HHHHHHHHHHHHCCC
Q ss_conf             124652122215202577998755010644111406789999999976504440366405640--477999999862236
Q gi|254780414|r  171 YAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGV--DSTVAAFLIYEAIGI  248 (520)
Q Consensus       171 yGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGV--DStV~A~Ll~kAig~  248 (520)
                      ||.-|.-=.+=.+.|.+    |+ .+-....-|+..+=.+. +.+|-.+. +++|=.=|||||  |.|..|+|-.=|-  
T Consensus        31 YGs~~eaA~~W~~~GA~----Wi-HlVDLDAAFg~G~N~e~-l~EiVg~L-ddrV~vELsGGiRDD~SL~~AL~tGa~--  101 (246)
T TIGR01919        31 YGSPLEAALKWQEDGAE----WI-HLVDLDAAFGRGSNHEL-LAEIVGKL-DDRVDVELSGGIRDDESLEAALATGAA--  101 (246)
T ss_pred             CCCHHHHHHHHHHCCCC----EE-EEEEEHHHCCCCCHHHH-HHHHHHHH-CCEEEEEEECCCCCHHHHHHHHHHCCC--
T ss_conf             77667898998863650----75-33530001378970889-99998630-787889850685567899999980773--


Q ss_pred             CEEEEEECCCCCCCCC-HHHHHHHHHHC--CCCCEEEEEHH
Q ss_conf             5699997389551562-78999988623--69857997588
Q gi|254780414|r  249 NLTCVLVDHGFMRKNE-VENIISLFKGY--PNFPLRVVDAS  286 (520)
Q Consensus       249 ~l~~vfVD~GllRknE-~~~v~~~~~~~--~~~~l~~vda~  286 (520)
                         =|-|=|-=|-+-| ...|.+.|-++  -++.+...|-.
T Consensus       102 ---RVNiGTAALE~P~W~A~vI~~yGd~vAVgl~V~~~DGe  139 (246)
T TIGR01919       102 ---RVNIGTAALENPEWIASVIKKYGDKVAVGLDVRLIDGE  139 (246)
T ss_pred             ---EEECCHHCCCCCHHHHHHHHHCCCEEEEEEEEEEECCC
T ss_conf             ---44001010468237889987607768754578987385


No 428
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=25.34  E-value=45  Score=13.61  Aligned_cols=46  Identities=17%  Similarity=0.222  Sum_probs=28.1

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHH
Q ss_conf             36640564047799999986223656999973895515627899998
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISL  271 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~  271 (520)
                      +|.|.+|.|-|+++..|+.+-+.+.+..+=++... -++|+....+.
T Consensus         4 ~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~~~-a~g~alDl~~~   49 (142)
T pfam00056         4 AVVGAGGGVGSSLAFALALQGLADELVLVDINKDK-AEGVAMDLSHG   49 (142)
T ss_pred             EEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCC-CHHHHHHHHCC
T ss_conf             99898778999999999747966347885057764-11799998614


No 429
>COG4126 Hydantoin racemase [Amino acid transport and metabolism]
Probab=25.31  E-value=45  Score=13.60  Aligned_cols=44  Identities=23%  Similarity=0.431  Sum_probs=31.4

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEECHHHHHHHHHCCCEE
Q ss_conf             997999985388999999975376898089988997789999899709699
Q gi|254780414|r   50 NPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKT  100 (520)
Q Consensus        50 ~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGICyG~QlLa~~~GG~V  100 (520)
                      ..+|+|+|=     |++  |-++..---..+|+.|||=-.-+.|...|-++
T Consensus        69 GvdaiiIaC-----f~D--Pgl~~~Re~~~~PviGi~eAsv~~A~~vgrrf  112 (230)
T COG4126          69 GVDAIIIAC-----FSD--PGLAAARERAAIPVIGICEASVLAALFVGRRF  112 (230)
T ss_pred             CCCEEEEEE-----CCC--HHHHHHHHHHCCCCEEHHHHHHHHHHHHCCEE
T ss_conf             776899870-----587--68999999827982542499999998745667


No 430
>TIGR01428 HAD_type_II haloacid dehalogenase, type II; InterPro: IPR006328   These proteins catalyze the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids . They belong to the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases, class (subfamily) I. Note that the Type I HAD enzymes have not yet been fully characterised, but clearly utilise a substantially different catalytic mechanism and are thus unlikely to be related.; GO: 0019120 hydrolase activity acting on acid halide bonds in C-halide compounds, 0008152 metabolic process.
Probab=25.31  E-value=45  Score=13.60  Aligned_cols=41  Identities=20%  Similarity=0.115  Sum_probs=27.9

Q ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCC
Q ss_conf             05788998888659406985289898899723997999985388
Q gi|254780414|r   18 QFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA   61 (520)
Q Consensus        18 QytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~   61 (520)
                      +-..-+..+.+.|..|.++.   ..+..+++..++=+|||+|+.
T Consensus        86 ~~~~~L~~~~~~L~p~pD~~---~gL~~L~~~G~~l~iLSNg~~  126 (207)
T TIGR01428        86 AAADRLAEAYLRLPPHPDVP---AGLRALKERGLRLAILSNGSP  126 (207)
T ss_pred             HHHHHHHHHHHCCCCCCCCH---HHHHHHHHCCCEEEEECCCCH
T ss_conf             88999987763589986618---899999764323652148986


No 431
>pfam08665 PglZ PglZ domain. This family is a member of the Alkaline phosphatase clan.
Probab=25.20  E-value=45  Score=13.59  Aligned_cols=48  Identities=13%  Similarity=0.204  Sum_probs=32.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHH
Q ss_conf             520257799875501064411140678999999997650444036640564047
Q gi|254780414|r  182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS  235 (520)
Q Consensus       182 T~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDS  235 (520)
                      +.+..++|+|-.    +  .-...+++.+..-.+.|+.+++.+|+.-.+.-+|.
T Consensus        77 ~~~R~~iL~~~~----~--~ai~~~~l~~~~~~~~~e~~~~~~vvyIyhn~IDa  124 (176)
T pfam08665        77 LENREKILEKKG----G--DAFQADDLMELKKDERRELVRGKKVVYIYHNKIDA  124 (176)
T ss_pred             HHHHHHHHHHCC----C--CEEEHHHHHCCCHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             878899997400----5--35767676536888999750578679999546631


No 432
>KOG2316 consensus
Probab=25.16  E-value=45  Score=13.58  Aligned_cols=165  Identities=21%  Similarity=0.318  Sum_probs=72.1

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC-----CC---------HHHHHHHHHHCCCCCEEEEEHHHHH
Q ss_conf             036640564047799999986223656999973895515-----62---------7899998862369857997588999
Q gi|254780414|r  224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRK-----NE---------VENIISLFKGYPNFPLRVVDASERF  289 (520)
Q Consensus       224 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRk-----nE---------~~~v~~~~~~~~~~~l~~vda~~~F  289 (520)
                      ||+..+|||-||--.-.-+ -+.|.++.+.-    =||-     +|         ..++.+.|.+-+++++....-..+=
T Consensus         2 rvvaLiSGGKDScynmm~c-v~~gHeiVaLa----nl~p~~d~~delDSyMyQtVGh~~i~lyaecm~lPlyrr~i~g~s   76 (277)
T KOG2316           2 RVVALISGGKDSCYNMMCC-VRLGHEIVALA----NLHPKEDESDELDSYMYQTVGHDVIDLYAECMGLPLYRRRIRGRS   76 (277)
T ss_pred             CEEEEEECCHHHHHHHHHH-HHCCCEEEEEE----CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             1899971780789999999-98487435643----246875552057788988602778999999846834664214864


Q ss_pred             HH-HHCCCCCHHHHHHHHHHHHHHHHH---HHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCC
Q ss_conf             99-966898889999887565899999---99974399709986462202454202467776303443023201132032
Q gi|254780414|r  290 IR-KLKNIVDPETKRKVIGQLFIEVFE---EEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM  365 (520)
Q Consensus       290 l~-~L~gv~DPE~KRkiIG~~Fi~vf~---~~a~~~~~~~~L~QGTlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~  365 (520)
                      .+ +|.  -++++     |++-=+.|+   ..-.+++..+=..-|.|..|---.               -|-..-.++. 
T Consensus        77 ~nq~l~--Y~~t~-----~DEvEDLy~ll~~VK~~~p~~eaVS~GAIlS~YQr~---------------RVEnVC~RL~-  133 (277)
T KOG2316          77 INQKLQ--YTKTE-----GDEVEDLYELLKTVKEKIPDVEAVSVGAILSDYQRT---------------RVENVCSRLG-  133 (277)
T ss_pred             CCCCCC--CCCCC-----CCHHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHH---------------HHHHHHHHHC-
T ss_conf             541354--45688-----831899999999998628870044334667688899---------------9998986608-


Q ss_pred             CHHHHHHHHHHHHHHHHHHHH---CCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             022378987389999999981---99988942688898311122100036789999999
Q gi|254780414|r  366 KLVEPLKELFKDEVRLLGKEL---RLPDSFVERHPCPGPGLAIRCIGEITEERINILRE  421 (520)
Q Consensus       366 ~liEPl~~l~KdEVR~lg~~L---glp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~  421 (520)
                        ++||..|.+-+--+|=.+.   |+..-++.-   --+||.-+.+|.--.|--..|.+
T Consensus       134 --L~~Ls~LW~rdQ~~LL~eMi~~g~~AiiiKV---AAigL~~khLgksL~em~p~L~~  187 (277)
T KOG2316         134 --LVSLSYLWQRDQEELLQEMILSGLDAIIIKV---AAIGLGRKHLGKSLDEMQPYLLK  187 (277)
T ss_pred             --CEEEHHHHHCCHHHHHHHHHHCCCCEEEEEE---EECCCCHHHHCCCHHHHHHHHHH
T ss_conf             --6332677740699999999974877499997---40466766647678888799997


No 433
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa. The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly.  The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules.  The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications.  The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino-
Probab=25.08  E-value=45  Score=13.57  Aligned_cols=63  Identities=21%  Similarity=0.499  Sum_probs=43.0

Q ss_pred             EEEEEEEHHHCCCHHHHHHHHHHHHHCCCCCCCCCH------HHHHHHHHHHHHHHCC------CCEEEEECCCCHHHHH
Q ss_conf             124652122215202577998755010644111406------7899999999765044------4036640564047799
Q gi|254780414|r  171 YAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMS------SYHKEIVSRIKEQVGN------ERVICAVSGGVDSTVA  238 (520)
Q Consensus       171 yGVQFHPEV~hT~~G~~iL~NFl~~Ic~~~~~W~~~------~~~~~~i~~Ir~~vg~------~kVi~~lSGGVDStV~  238 (520)
                      ++-.|+|+            |++..-+|+-.||-..      .+.++..+.||+++-.      =-++..++||--|-..
T Consensus        80 ~~~lf~~~------------n~i~~~~gagNNwa~Gy~~~G~~~~d~i~d~Irk~~E~cD~l~gf~i~~Sl~GGTGSGlG  147 (425)
T cd02187          80 FGQLFRPD------------NFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMG  147 (425)
T ss_pred             CCCCCCCC------------CEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCHH
T ss_conf             64664876------------466668872022135000346888999999999999848986756899865887765188


Q ss_pred             HHHHHHH
Q ss_conf             9999862
Q gi|254780414|r  239 AFLIYEA  245 (520)
Q Consensus       239 A~Ll~kA  245 (520)
                      +.|+.+-
T Consensus       148 s~lle~L  154 (425)
T cd02187         148 TLLISKI  154 (425)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 434
>PRK11914 diacylglycerol kinase; Reviewed
Probab=24.95  E-value=46  Score=13.56  Aligned_cols=77  Identities=19%  Similarity=0.261  Sum_probs=44.1

Q ss_pred             CCCCCCEEEEEEC---CC----CHHHHHHHHHHHCCCEEEEECCCCC--HH----HHHHCCCCEEEECCCCCCCCCCCCC
Q ss_conf             6344886999988---97----0578899888865940698528989--88----9972399799998538899999997
Q gi|254780414|r    3 KRERSSKVLIIDF---GS----QFTQLIARRVRESKVYCEVIAFKNA--LD----YFKEQNPQAIILSGSPASSLDIDSP   69 (520)
Q Consensus         3 ~~~~~~~IlIlDf---GS----QytqLIaRriRelgVyseI~P~~~~--~e----~i~~~~p~GIILSGGP~SV~d~~ap   69 (520)
                      ++.+..||+|+=.   |+    +.-+-+.+++++.++..++.+-+..  ..    +.....++.||..||-.++++    
T Consensus         2 ~~~~m~kv~vIvNP~aG~g~~~~~~~~i~~~l~~~g~~~~~~~t~~~~~a~~la~~a~~~g~d~vv~~GGDGTv~e----   77 (304)
T PRK11914          2 RRHEIGKVTVLTNPLSGHGAAPHAAERAIARLHHRGVDVVEIVGTDAHHARHLVAAALAKGTDALVVVGGDGVISN----   77 (304)
T ss_pred             CCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHH----
T ss_conf             7045866999999777998568899999999998799099993278789999999888649969999956259889----


Q ss_pred             CCCHHHHHCCCCEEEE
Q ss_conf             5376898089988997
Q gi|254780414|r   70 QIPKEILESNIPLLGI   85 (520)
Q Consensus        70 ~~~~~I~~~~iPILGI   85 (520)
                       +...+.+.++| |||
T Consensus        78 -v~~~l~~~~~p-lgi   91 (304)
T PRK11914         78 -ALQVLAGTDIP-LGI   91 (304)
T ss_pred             -HHHHHCCCCCE-EEE
T ss_conf             -87641357860-899


No 435
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=24.81  E-value=46  Score=13.54  Aligned_cols=35  Identities=26%  Similarity=0.229  Sum_probs=26.9

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             3664056404779999998622365699997389551562
Q gi|254780414|r  225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE  264 (520)
Q Consensus       225 Vi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE  264 (520)
                      +|+|-||.=-||-|+.|..+     +-..++|+|.|=-.+
T Consensus         4 iilG~pGaGK~T~A~~La~~-----~~i~hlstgd~~r~~   38 (178)
T COG0563           4 LILGPPGAGKSTLAKKLAKK-----LGLPHLDTGDILRAA   38 (178)
T ss_pred             EEECCCCCCHHHHHHHHHHH-----CCCCEECCCCCCCHH
T ss_conf             99899999889999999997-----699785522011110


No 436
>pfam00091 Tubulin Tubulin/FtsZ family, GTPase domain. This family includes the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. Members of this family are involved in polymer formation. FtsZ is the polymer-forming protein of bacterial cell division. It is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases. FtsZ can polymerize into tubes, sheets, and rings in vitro and is ubiquitous in eubacteria and archaea. Tubulin is the major component of microtubules.
Probab=24.77  E-value=46  Score=13.53  Aligned_cols=52  Identities=15%  Similarity=0.211  Sum_probs=35.2

Q ss_pred             HHHCCCCCCCCCHH-----HHHHHHHHHHHHH---CC---CCEEEEECCCCHHHHHHHHHHHH
Q ss_conf             50106441114067-----8999999997650---44---40366405640477999999862
Q gi|254780414|r  194 HHVAGIQDNWVMSS-----YHKEIVSRIKEQV---GN---ERVICAVSGGVDSTVAAFLIYEA  245 (520)
Q Consensus       194 ~~Ic~~~~~W~~~~-----~~~~~i~~Ir~~v---g~---~kVi~~lSGGVDStV~A~Ll~kA  245 (520)
                      ..-+++-.+|...-     +.++..+.||+++   ..   =-++..++||--|-..+.|+..+
T Consensus        82 ~~~~gagnn~a~G~~~~~~~~~~~~~~irk~~E~cd~~~gf~i~~SlgGGTGSG~gs~l~~~l  144 (210)
T pfam00091        82 KGLEGAGNNPAVGYYTHKEAAEESLEEIRKELEKCDGLDGFFITAGLGGGTGSGAAPVIAEIL  144 (210)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCHHHHHHHHH
T ss_conf             457687878002354799999999999999998258845188772226877655899999999


No 437
>pfam07085 DRTGG DRTGG domain. This presumed domain is about 120 amino acids in length. It is found associated with CBS domains pfam00571, as well as the CbiA domain pfam01656. The function of this domain is unknown. It is named the DRTGG domain after some of the most conserved residues. This domain may be very distantly related to a pair of CBS domains. There are no significant sequence similarities, but its length and association with CBS domains supports this idea (Bateman A, pers. obs.).
Probab=24.76  E-value=46  Score=13.53  Aligned_cols=74  Identities=18%  Similarity=0.150  Sum_probs=39.7

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCH--HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCEEEE
Q ss_conf             869999889705788998888659406985289898--899723997999985388999999975376898089988997
Q gi|254780414|r    8 SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNAL--DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI   85 (520)
Q Consensus         8 ~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~--e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~iPILGI   85 (520)
                      .++.|-...   .+....++++-..  -|.|-|-.-  ......+.+|+||+||-.     =.+.+.+.+-+.++|||-.
T Consensus        22 ~~~~igAm~---~~~~l~~~~~g~l--vI~~gdR~di~~~a~~~~~~~iIlTgg~~-----p~~~v~~la~~~~ipii~t   91 (105)
T pfam07085        22 GKVVIGAMS---VENMLEYLRPGDL--VITPGDREDIQLAALLAGIAGLILTGGFE-----PSEEVLKLAEEAGLPVLST   91 (105)
T ss_pred             CCEEEEECC---HHHHHHHHCCCCE--EEEECCCHHHHHHHHHHCCCEEEEECCCC-----CCHHHHHHHHHCCCEEEEE
T ss_conf             869999878---9999986068979--99927968999999982487899948989-----8999999998779839996


Q ss_pred             CHHHHH
Q ss_conf             789999
Q gi|254780414|r   86 CYGQQI   91 (520)
Q Consensus        86 CyG~Ql   91 (520)
                      =|..--
T Consensus        92 ~~dT~~   97 (105)
T pfam07085        92 PYDTFT   97 (105)
T ss_pred             CCCHHH
T ss_conf             688999


No 438
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=24.76  E-value=46  Score=13.53  Aligned_cols=81  Identities=16%  Similarity=0.044  Sum_probs=44.5

Q ss_pred             HHHHHHHHHHHHC--CCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCC-------CCCHHHHHH
Q ss_conf             4779999998622--3656999973895515627899998862369857997588999999668-------988899998
Q gi|254780414|r  234 DSTVAAFLIYEAI--GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN-------IVDPETKRK  304 (520)
Q Consensus       234 DStV~A~Ll~kAi--g~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~g-------v~DPE~KRk  304 (520)
                      |.+-+...+..++  .+++.+||.-|.-|-.+=.+-+.+.=+ ...+.+.-.|.+..-++.++.       ..+|.    
T Consensus       166 d~~~a~~~~~~~L~~~pdi~~I~~~nd~~a~ga~~Al~~ag~-~~~i~vvg~D~~~~~~~~i~~G~i~~tv~Q~p~----  240 (271)
T cd06312         166 DPTEVASRIAAYLRANPDVDAVLTLGAPSAAPAAKALKQAGL-KGKVKLGGFDLSPATLQAIKAGYIQFAIDQQPY----  240 (271)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCC-CCCEEEEEECCCHHHHHHHHCCCCEEEEECCHH----
T ss_conf             999999999999984989888998896789999999996699-998599998899999999986995599958999----


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             875658999999997
Q gi|254780414|r  305 VIGQLFIEVFEEEAK  319 (520)
Q Consensus       305 iIG~~Fi~vf~~~a~  319 (520)
                      -.|..-++..-+..+
T Consensus       241 ~~Gy~aV~~l~~~l~  255 (271)
T cd06312         241 LQGYLPVSLLWLYKR  255 (271)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999998


No 439
>smart00732 YqgFc Likely ribonuclease with RNase H fold. YqgF proteins are likely to function as an alternative to RuvC in most bacteria, and could be the principal holliday junction resolvases in low-GC Gram-positive bacteria. In Spt6p orthologues, the catalytic residues are substituted indicating that they lack enzymatic functions.
Probab=24.71  E-value=17  Score=16.69  Aligned_cols=25  Identities=24%  Similarity=0.409  Sum_probs=14.4

Q ss_pred             HHHCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             97239979999853889999999753
Q gi|254780414|r   46 FKEQNPQAIILSGSPASSLDIDSPQI   71 (520)
Q Consensus        46 i~~~~p~GIILSGGP~SV~d~~ap~~   71 (520)
                      +.+.+|++|++ |.|.+......+..
T Consensus        47 i~~~~~~~ivi-G~P~~~~g~~~~~~   71 (99)
T smart00732       47 IKKYQPDLIVI-GLPLNMNGTASRET   71 (99)
T ss_pred             HHHHCCCEEEE-CCCCCCCCCCCHHH
T ss_conf             99849988997-47524899819999


No 440
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=24.70  E-value=46  Score=13.53  Aligned_cols=52  Identities=21%  Similarity=0.224  Sum_probs=40.9

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECC
Q ss_conf             48869999889705788998888659406985289898899723997999985
Q gi|254780414|r    6 RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSG   58 (520)
Q Consensus         6 ~~~~IlIlDfGSQytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSG   58 (520)
                      ...+|.|+-.| ....+++|.+|+.|.+..|+..+...+..+...--|++-+-
T Consensus         2 ~~~~v~IvG~G-liG~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~lgv~d~~   53 (279)
T COG0287           2 ASMKVGIVGLG-LMGGSLARALKEAGLVVRIIGRDRSAATLKAALELGVIDEL   53 (279)
T ss_pred             CCCEEEEECCC-HHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCHHH
T ss_conf             86489998774-67799999999769847997247746778776635853010


No 441
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I; InterPro: IPR011913    RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis. RfaE is a bifunctional protein in Escherichia coli, and separate proteins in some other genome. The longer, N-terminal domain I (this family) is suggested to act in D-glycero-D-manno-heptose 1-phosphate biosynthesis, while domain II (IPR011914 from INTERPRO) adds ADP to yield ADP-D-glycero-D-manno-heptose .; GO: 0016773 phosphotransferase activity alcohol group as acceptor, 0016779 nucleotidyltransferase activity, 0005975 carbohydrate metabolic process.
Probab=24.68  E-value=16  Score=16.88  Aligned_cols=153  Identities=17%  Similarity=0.223  Sum_probs=63.4

Q ss_pred             CCEEEEEECCCC--HHHHHHHHHHHCCCEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCC--CCHHHH----HC
Q ss_conf             886999988970--5788998888659406985289898899723997999985388999999975--376898----08
Q gi|254780414|r    7 SSKVLIIDFGSQ--FTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQ--IPKEIL----ES   78 (520)
Q Consensus         7 ~~~IlIlDfGSQ--ytqLIaRriRelgVyseI~P~~~~~e~i~~~~p~GIILSGGP~SV~d~~ap~--~~~~I~----~~   78 (520)
                      ++.++=+||-+.  +++---.+|-+           ...+.+  ...++||||=     |.++...  +-.+++    +.
T Consensus       113 ~QQllR~D~E~~~~~~~~~~~~L~~-----------~~~~~l--~~~d~VvLSD-----YaKGvLt~~v~~~~I~~Ar~~  174 (321)
T TIGR02198       113 NQQLLRVDFEERKPINAEEEARLLA-----------AIKEQL--ASADAVVLSD-----YAKGVLTPSVVQEVIAAAREA  174 (321)
T ss_pred             CEEEEEEEEECCCCCCHHHHHHHHH-----------HHHHHH--CCCCEEEEEE-----CCCCCCCHHHHHHHHHHHHHC
T ss_conf             5058997410277689778999999-----------999972--3287899986-----687635857899999999966


Q ss_pred             CCCEEEECHHHHHHHHHCCCEEEECCCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHH-------CCCCCCCE
Q ss_conf             99889977899998997096999869866103667523886222787266553368600220110-------12444211
Q gi|254780414|r   79 NIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVE-------HIPEGFEV  151 (520)
Q Consensus        79 ~iPILGICyG~QlLa~~~GG~V~~~~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~-------~lP~gf~v  151 (520)
                      ++|||====|- =.+.+-|+++-..+..|+..+-                +..+..|-++.+-+.       ++.=.+-+
T Consensus       175 ~~pVlVDPKg~-df~~Y~GAtl~TPN~~E~~~av----------------G~~~~~~~~~~~~~~aa~~L~~~~~l~alL  237 (321)
T TIGR02198       175 GKPVLVDPKGK-DFSRYRGATLITPNRKEAEAAV----------------GIKFIACENEAELVKAAEKLLEELDLEALL  237 (321)
T ss_pred             CCCEEEECCCC-CHHHHCCCCCCCCCHHHHHHHH----------------CCCCHHCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             89199807876-2345146642366879999985----------------887011058178999999999970996799


Q ss_pred             EECCCCCCEEEEEECCCCE-EEEEEEEHHHC-CCHHHHHHHHHHHHH
Q ss_conf             2323983178898635001-12465212221-520257799875501
Q gi|254780414|r  152 IASSDSTPFAFIADEKRKY-YAVQFHPEVVH-TVGGSQLIDNFVHHV  196 (520)
Q Consensus       152 iA~S~~~~iaai~~~~~~i-yGVQFHPEV~h-T~~G~~iL~NFl~~I  196 (520)
                      +-+|+.+ +.-+.-.+.++ +-.|=+ ||.. |-.|.+.+--+-.-+
T Consensus       238 vTRsE~G-MtL~~~~~~~~H~Pa~A~-EVyDVTGAGDTVIA~La~~l  282 (321)
T TIGR02198       238 VTRSEKG-MTLFTREGEPIHIPAQAR-EVYDVTGAGDTVIATLALAL  282 (321)
T ss_pred             EEECCCC-CEEECCCCCEEEECCCCE-EEEEECCCCHHHHHHHHHHH
T ss_conf             9507762-066768996266035410-23333387458999999998


No 442
>PRK10411 DNA-binding transcriptional activator FucR; Provisional
Probab=24.64  E-value=46  Score=13.52  Aligned_cols=27  Identities=0%  Similarity=-0.172  Sum_probs=14.4

Q ss_pred             EEEEEEEHHHC--CCHHHHHHHHHHHHHC
Q ss_conf             12465212221--5202577998755010
Q gi|254780414|r  171 YAVQFHPEVVH--TVGGSQLIDNFVHHVA  197 (520)
Q Consensus       171 yGVQFHPEV~h--T~~G~~iL~NFl~~Ic  197 (520)
                      .|=+++|+...  .+.-.+.|++|-+++|
T Consensus       141 ~GG~~~~~~~s~~G~~a~~~l~~~~~d~a  169 (240)
T PRK10411        141 SGGTLERKYGCYVNPSLISQLKSLEIDLF  169 (240)
T ss_pred             ECCEEECCCCEEECHHHHHHHHCCCCCEE
T ss_conf             89999788882789999999865389999


No 443
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit; InterPro: IPR011280   This entry represents the succinate dehydrogenase flavoprotein subunit as found in the low-GC Gram-positive bacteria and a few other lineages. This enzyme may act in a complete or partial TCA cycle, or act in the opposite direction as fumarate reductase. In some but not all species, succinate dehydrogenase and fumarate reductase may be encoded as separate isozymes..
Probab=24.55  E-value=46  Score=13.51  Aligned_cols=49  Identities=20%  Similarity=0.280  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             73899999999819998894268889831112210003678999999999
Q gi|254780414|r  374 LFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD  423 (520)
Q Consensus       374 l~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~i~r~ad  423 (520)
                      -.+++--+|-+.|+...+++-. -.-+|---=|-|||+--+.|-+.|..+
T Consensus       456 ~~~~~~~r~d~L~~~~pewvG~-~v~~~~~~Hr~LG~~m~~~~gv~R~~~  504 (620)
T TIGR01811       456 ALAEEQDRLDRLLKMDPEWVGD-NVENADKFHRELGEIMWENCGVSRNNE  504 (620)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCC-CCCCHHHHHHHHHHHHHHHCCEEECCH
T ss_conf             9998998888886158320565-446667899998788766121366113


No 444
>pfam08929 DUF1911 Domain of unknown function (DUF1911). This domain is found in a set of hypothetical bacterial proteins.
Probab=24.44  E-value=47  Score=13.49  Aligned_cols=26  Identities=35%  Similarity=0.415  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHCCCHHHHCCCC-CCC
Q ss_conf             38999999998199988942688-898
Q gi|254780414|r  375 FKDEVRLLGKELRLPDSFVERHP-CPG  400 (520)
Q Consensus       375 ~KdEVR~lg~~Lglp~~~~~RhP-FPG  400 (520)
                      .-=||-++...|||+++.+.-|| ||+
T Consensus        83 WafEaaa~~~l~~lDDs~lrd~~~YP~  109 (111)
T pfam08929        83 WAFEAAAVAKLLGLDDSSLRDHPHYPY  109 (111)
T ss_pred             EHHHHHHHHHHHCCCHHHHCCCCCCCC
T ss_conf             047999999995688788648999999


No 445
>cd07186 CofD_like LPPG:FO 2-phospho-L-lactate transferase; important in F420 biosynthesis. CofD is a 2-phospho-L-lactate transferase that catalyzes the last step in the biosynthesis of coenzyme F(420)-0 (F(420) without polyglutamate) by transferring the lactyl phosphate moiety of lactyl(2)diphospho-(5')guanosine (LPPG) to 7,8-didemethyl-8-hydroxy-5-deazariboflavin ribitol (F0). F420 is a hydride carrier, important for energy metabolism of methanogenic archaea, as well as for the biosynthesis of other natural products, like tetracycline in Streptomyces. F420 and some of its precursors are also utilized as cofactors for enzymes, like DNA photolyase in Mycobacterium tuberculosis.
Probab=24.44  E-value=47  Score=13.49  Aligned_cols=55  Identities=18%  Similarity=0.033  Sum_probs=25.9

Q ss_pred             CEEEEEEEE--HHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             011246521--22215202577998755010644111406789999999976504440
Q gi|254780414|r  169 KYYAVQFHP--EVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNER  224 (520)
Q Consensus       169 ~iyGVQFHP--EV~hT~~G~~iL~NFl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~k  224 (520)
                      ++..+.|.|  +..-++.-.+-|++-= -|-=|..||=.+=.=.-.+..||+.+.+.+
T Consensus       159 ~v~~v~~~~~e~a~~~p~al~AI~~AD-~IIiGPgnp~tSI~PiL~VpgI~eAL~~s~  215 (303)
T cd07186         159 EVRDVRFVGAEEARPAPEVLEAIEDAD-LVIIGPSNPVTSIGPILALPGIREALRDKK  215 (303)
T ss_pred             CEEEEEECCCCCCCCCHHHHHHHHHCC-EEEECCCCCHHHHCCCCCCHHHHHHHHHCC
T ss_conf             658899658887878989999998599-899858862132153114556999998579


No 446
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809   There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC)  is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC)  is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits.   This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=24.26  E-value=27  Score=15.19  Aligned_cols=48  Identities=17%  Similarity=0.311  Sum_probs=19.9

Q ss_pred             EEECCCCHHHHHHHHHHHHCCC-CEEEEEEC--CCCCCCCC-HHHHHHHHHH
Q ss_conf             6405640477999999862236-56999973--89551562-7899998862
Q gi|254780414|r  227 CAVSGGVDSTVAAFLIYEAIGI-NLTCVLVD--HGFMRKNE-VENIISLFKG  274 (520)
Q Consensus       227 ~~lSGGVDStV~A~Ll~kAig~-~l~~vfVD--~GllRknE-~~~v~~~~~~  274 (520)
                      +=+=||=|.-+.+--+..-|-| ++..||||  =|-||=++ ++=+++..+.
T Consensus       287 LDvGGGA~~e~v~eA~~~vLsD~~VKvvfiNIFGGI~RCD~vA~G~v~A~~~  338 (389)
T TIGR01016       287 LDVGGGASEERVKEALKLVLSDKSVKVVFINIFGGITRCDEVAKGLVEALKD  338 (389)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCCCCEEEEEEECCCEECHHHHHHHHHHHHHC
T ss_conf             2458788989999998987359982089997068600187887889999831


No 447
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway. Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes the first committed step in the biosynthesis of pantothenate (vitamin B5), which is a precursor to coenzyme A and is required for penicillin biosynthesis.
Probab=24.15  E-value=47  Score=13.45  Aligned_cols=13  Identities=23%  Similarity=0.823  Sum_probs=8.9

Q ss_pred             HHHHHCCCCEEEE
Q ss_conf             6898089988997
Q gi|254780414|r   73 KEILESNIPLLGI   85 (520)
Q Consensus        73 ~~I~~~~iPILGI   85 (520)
                      +.+-+.+||+.|-
T Consensus       121 ~~L~~~GIPV~gH  133 (254)
T cd06557         121 RALVDAGIPVMGH  133 (254)
T ss_pred             HHHHHCCCCEEEE
T ss_conf             9999879976654


No 448
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily. Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily. The members of this family function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea. The sugar binding domain is also homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR. Moreover, this periplasmic binding domain, also known as Venus flytrap domain, undergoes transition from an open to a closed conformational state upon the binding of ligands such as lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. This family also includes the periplasmic binding domain of autoinducer-2 (AI-2
Probab=24.13  E-value=47  Score=13.45  Aligned_cols=72  Identities=18%  Similarity=0.194  Sum_probs=41.0

Q ss_pred             EEEEECCCCHHH----HHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             999988970578----89988886594069852898988-------9972399799998538899999997537689808
Q gi|254780414|r   10 VLIIDFGSQFTQ----LIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDIDSPQIPKEILES   78 (520)
Q Consensus        10 IlIlDfGSQytq----LIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~   78 (520)
                      +++=|....|-.    -|.+..++.|+...+...+.+.+       .+...+++|||+++.-.    ......-+.+.+.
T Consensus         4 vivp~~~~pf~~~~~~gi~~~a~~~g~~~~~~~~~~~~~~e~~~i~~~~~~~vdgiI~~~~~~----~~~~~~~~~~~~~   79 (267)
T cd01536           4 LVVPSLNNPFWQAMNKGAEAAAKELGVELIVLDAQNDVSKQIQQIEDLIAQGVDGIIISPVDS----AALTPALKKANAA   79 (267)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC----HHHHHHHHHHHHC
T ss_conf             996899898999999999999998499999996999999999999999975999999931584----1558999999987


Q ss_pred             CCCEEEE
Q ss_conf             9988997
Q gi|254780414|r   79 NIPLLGI   85 (520)
Q Consensus        79 ~iPILGI   85 (520)
                      ++|+.-+
T Consensus        80 ~iPvV~~   86 (267)
T cd01536          80 GIPVVTV   86 (267)
T ss_pred             CCCEEEE
T ss_conf             9969998


No 449
>pfam03613 EIID-AGA PTS system mannose/fructose/sorbose family IID component.
Probab=24.12  E-value=39  Score=14.05  Aligned_cols=16  Identities=25%  Similarity=0.472  Sum_probs=6.7

Q ss_pred             HHHHCCCCCHHHHHHHHH
Q ss_conf             999668988899998875
Q gi|254780414|r  290 IRKLKNIVDPETKRKVIG  307 (520)
Q Consensus       290 l~~L~gv~DPE~KRkiIG  307 (520)
                      |++|-.  |||+.++..-
T Consensus        40 lkklY~--d~e~~~~Al~   55 (264)
T pfam03613        40 LKKLYK--DKEELKEALK   55 (264)
T ss_pred             HHHHCC--CHHHHHHHHH
T ss_conf             999859--9899999999


No 450
>TIGR02653 Lon_rel_chp conserved hypothetical protein; InterPro: IPR013473    This entry describes a protein family of unknown function, about 690 residues in length, in which some members show C-terminal sequence similarity to IPR008269 from INTERPRO, which is the Lon protease C-terminal proteolytic domain, from MEROPS family S16. However, the annotated catalytic sites of Escherichia coli Lon protease are not conserved in members of this family. Members have a motif GP[RK][GS]TGKS, similar to the ATP-binding P-loop motif GxxGxGK[ST]..
Probab=24.10  E-value=47  Score=13.45  Aligned_cols=90  Identities=22%  Similarity=0.278  Sum_probs=48.3

Q ss_pred             HHHHHHH--HHCCCE-EEEECCCCCHHHH-HHCCCCEEEECCCCCCCC----CCCCC-----------CCCHHHHHC-CC
Q ss_conf             8899888--865940-6985289898899-723997999985388999----99997-----------537689808-99
Q gi|254780414|r   21 QLIARRV--RESKVY-CEVIAFKNALDYF-KEQNPQAIILSGSPASSL----DIDSP-----------QIPKEILES-NI   80 (520)
Q Consensus        21 qLIaRri--RelgVy-seI~P~~~~~e~i-~~~~p~GIILSGGP~SV~----d~~ap-----------~~~~~I~~~-~i   80 (520)
                      |+|.|-|  =|.|.- ||+=|-.|--... ++..|..|..||||-.|-    .-.+-           -+| ++-.+ ..
T Consensus       206 h~l~RliPlvEnNYNlcELGPrgTGKShvYkE~SPn~iL~sGGqTTVANLFyN~str~~GLVG~WDvVAFD-EVAgi~fk  284 (677)
T TIGR02653       206 HLLTRLIPLVENNYNLCELGPRGTGKSHVYKELSPNSILMSGGQTTVANLFYNMSTRQIGLVGLWDVVAFD-EVAGIEFK  284 (677)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCCCCCCEEEECCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEEEEE-EECCCCCC
T ss_conf             99975432300575547647889873405413584212205884356776665421630203300125310-00487204


Q ss_pred             CEEEECHHHHHHHHH-CCCEEEECCCCCCCEEEEEE
Q ss_conf             889977899998997-09699986986610366752
Q gi|254780414|r   81 PLLGICYGQQIMCQS-LGGKTKNSQSREFGRAFIEI  115 (520)
Q Consensus        81 PILGICyG~QlLa~~-~GG~V~~~~~~EyG~~~I~i  115 (520)
                      |==    |-|+|=.+ --|+-.|++..--|.|.+-.
T Consensus       285 dKd----gv~imKdYmaSGSFARGkes~~g~ASivf  316 (677)
T TIGR02653       285 DKD----GVQIMKDYMASGSFARGKESIEGKASIVF  316 (677)
T ss_pred             CCC----CHHHHHHHHCCCCCCCCCCCCCCCEEEEE
T ss_conf             863----10343354204785345346355334899


No 451
>TIGR02055 APS_reductase adenylylsulfate reductase, thioredoxin dependent; InterPro: IPR011798    This entry describes recently identified adenosine 5'-phosphosulphate (APS) reductase activity found in sulphate-assimilatory prokaryotes, thus separating it from the traditionally described phosphoadenosine 5'-phosphosulphate (PAPS) reductases found in bacteria and fungi. Homologous to PAPS reductase in enterobacteria, cyanobacteria, and yeast, APS reductase here clusters with, and demonstrates greater homology to plant APS reductase. Additionally, the presence of two conserved C-terminal motifs (CCXXRKXXPL and SXGCXXCT) distinguishes APS substrate specificity and serves as a FeS cluster.; GO: 0004604 phosphoadenylyl-sulfate reductase (thioredoxin) activity, 0019344 cysteine biosynthetic process.
Probab=24.05  E-value=47  Score=13.44  Aligned_cols=143  Identities=19%  Similarity=0.274  Sum_probs=71.9

Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH---HHCCCCCHHHHHHHHHH
Q ss_conf             404779999998622365699997389551562789999886236985799758899999---96689888999988756
Q gi|254780414|r  232 GVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR---KLKNIVDPETKRKVIGQ  308 (520)
Q Consensus       232 GVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~---~L~gv~DPE~KRkiIG~  308 (520)
                      |..-.|.+.|+.|. ..+.--+|.|||.|=+ |+-++.+..++.+++.+.+.--.+.=+.   +..|.           +
T Consensus         3 ~~ED~VL~dl~~k~-~~~~~v~~LDTGrlf~-ET~~~idqv~E~Y~~~~~~~~~~~~~~~e~v~~~G~-----------n   69 (200)
T TIGR02055         3 GAEDLVLVDLIAKV-RKDVEVFFLDTGRLFK-ETYELIDQVEERYDILIKVLVPPELTVEEQVEEYGL-----------N   69 (200)
T ss_pred             HHHHHHHHHHHHHC-CCCCCEEEECCCCCHH-HHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHCH-----------H
T ss_conf             01248999999860-7997278853888616-779887653201671012016887788899988473-----------5


Q ss_pred             HHHHHHHH-----HHHHC-------CCC-EEE-----EEC-CCCCHHHHHHCCCCCCCCEEEEEECCCCHHHHHCCCHHH
Q ss_conf             58999999-----99743-------997-099-----864-622024542024677763034430232011320320223
Q gi|254780414|r  309 LFIEVFEE-----EAKKI-------GGA-QFL-----GQG-TLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE  369 (520)
Q Consensus       309 ~Fi~vf~~-----~a~~~-------~~~-~~L-----~QG-TlypDvIES~~~~~~~~~~IKsHHNvgglp~~~~~~liE  369 (520)
                      .|.+-.|-     .++|+       .+. -|+     .|| --.           .++..+-- =--.+.|++--.| +=
T Consensus        70 lF~~~ve~~~~CC~~RKV~PL~raL~G~~AW~TGLRR~q~P~TR-----------A~~~~~e~-De~~~~PekPl~K-~n  136 (200)
T TIGR02055        70 LFYRSVELRKECCRIRKVEPLKRALSGVSAWITGLRREQSPPTR-----------AQAPFLEI-DEAFGSPEKPLVK-VN  136 (200)
T ss_pred             HHHHHCCCHHHCCCCCCCHHHHHCCCCCCCCEEECCCCCCCCCH-----------HHHHHHHC-CCCCCCCCCCEEE-EC
T ss_conf             55540211010661454214574048876203001006768755-----------44155420-2236789876144-36


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHCCCCCCC
Q ss_conf             7898738999999998199988942688898
Q gi|254780414|r  370 PLKELFKDEVRLLGKELRLPDSFVERHPCPG  400 (520)
Q Consensus       370 Pl~~l~KdEVR~lg~~Lglp~~~~~RhPFPG  400 (520)
                      ||.+---.||-+-=+..+||.+=++++=.|=
T Consensus       137 PLa~Wt~~~vw~Yi~~~~~~~NpL~~~GYpS  167 (200)
T TIGR02055       137 PLADWTLEDVWEYIADNEVPYNPLHDRGYPS  167 (200)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             6000466899999997078878631168853


No 452
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins.
Probab=24.05  E-value=47  Score=13.44  Aligned_cols=44  Identities=18%  Similarity=0.325  Sum_probs=32.4

Q ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCC
Q ss_conf             97650444036640564047799999986223-656999973895515
Q gi|254780414|r  216 IKEQVGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFMRK  262 (520)
Q Consensus       216 Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig-~~l~~vfVD~GllRk  262 (520)
                      ..+.-.|++|++--.+|.-|..||.+|.++ | ++++.  ++-|++.-
T Consensus        55 ~~~~~k~k~ivvyC~~G~RS~~Aa~~L~~~-Gf~~V~~--L~GGi~~W   99 (101)
T cd01518          55 NLDLLKGKKVLMYCTGGIRCEKASAYLKER-GFKNVYQ--LKGGILKY   99 (101)
T ss_pred             HHCCCCCCEEEEECCCCHHHHHHHHHHHHC-CCCCEEE--ECCHHHHH
T ss_conf             212143876999859982799999999984-9870689--66358975


No 453
>cd02197 HypE HypE (Hydrogenase expression/formation protein). HypE is involved in Ni-Fe hydrogenase biosynthesis.  HypE dehydrates its own carbamoyl moiety in an ATP-dependent process to yield the enzyme thiocyanate. The N-terminal domain of HypE is related to the ATP-binding domains of the AIR synthases, selenophosphate synthetase (SelD), and FGAM synthase and is thought to bind ATP.
Probab=24.04  E-value=32  Score=14.63  Aligned_cols=35  Identities=20%  Similarity=0.330  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHCCCHHHHCCCCCCCCCCEEEECCCCCHHHHH
Q ss_conf             3899999999819998894268889831112210003678999
Q gi|254780414|r  375 FKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN  417 (520)
Q Consensus       375 ~KdEVR~lg~~Lglp~~~~~RhPFPGPGLaiRi~g~vt~e~~~  417 (520)
                      ..+|||++++.||+..--+--   -|     +.+=.+.+|+.+
T Consensus       238 v~~~v~~~~e~lg~DPl~~as---~G-----~ll~~v~~e~a~  272 (293)
T cd02197         238 VREEVRGACEMLGLDPLYLAN---EG-----KFVAIVPPEDAE  272 (293)
T ss_pred             CCHHHHHHHHHHCCCHHHHHC---CC-----EEEEEECHHHHH
T ss_conf             888999999985939878834---85-----399998789999


No 454
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional
Probab=24.01  E-value=48  Score=13.44  Aligned_cols=76  Identities=17%  Similarity=0.253  Sum_probs=37.5

Q ss_pred             CEEEEEE-CCCCHH----HHHHHHHHHCCCEEEEEC-------CC----CCHHHHHHCCCCEEEECCCCCCCCCCCCCCC
Q ss_conf             8699998-897057----889988886594069852-------89----8988997239979999853889999999753
Q gi|254780414|r    8 SKVLIID-FGSQFT----QLIARRVRESKVYCEVIA-------FK----NALDYFKEQNPQAIILSGSPASSLDIDSPQI   71 (520)
Q Consensus         8 ~~IlIlD-fGSQyt----qLIaRriRelgVyseI~P-------~~----~~~e~i~~~~p~GIILSGGP~SV~d~~ap~~   71 (520)
                      .+|.|+= .++.-.    +.+.+.+++.|+.+-+-+       .+    .+.+.+ ....+-+|--||-.+     -.+.
T Consensus         5 k~vgIv~k~~~~~a~~~~~~l~~~L~~~gi~v~ld~~~a~~~~~~~~~~~~~~~~-~~~~Dlii~lGGDGT-----~L~~   78 (296)
T PRK01231          5 RNIGLIGRLGSSQVVETLRRLKRFLLDRHLHVILEEETAEVLPGHGLQTVSRKLL-GEVCDLVIVVGGDGS-----LLGA   78 (296)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEHHHHHHCCCCCCCCCCHHHC-CCCEEEEEEECCCCH-----HHHH
T ss_conf             8999998489879999999999999878899999324776658788662453341-653049999578728-----9999


Q ss_pred             CHHHHHCCCCEEEECHHH
Q ss_conf             768980899889977899
Q gi|254780414|r   72 PKEILESNIPLLGICYGQ   89 (520)
Q Consensus        72 ~~~I~~~~iPILGICyG~   89 (520)
                      .......++|||||-+|.
T Consensus        79 ~~~~~~~~~PilGiN~G~   96 (296)
T PRK01231         79 ARALARHNVPVLGINRGR   96 (296)
T ss_pred             HHHHCCCCCCEEEEECCC
T ss_conf             999603699789885587


No 455
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional
Probab=23.91  E-value=48  Score=13.42  Aligned_cols=77  Identities=14%  Similarity=0.307  Sum_probs=43.7

Q ss_pred             CCCCCEEEEE--ECCC----CHHHHHHHHHHHCCCEEEEECCCCCHH-------HHHHCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             3448869999--8897----057889988886594069852898988-------99723997999985388999999975
Q gi|254780414|r    4 RERSSKVLII--DFGS----QFTQLIARRVRESKVYCEVIAFKNALD-------YFKEQNPQAIILSGSPASSLDIDSPQ   70 (520)
Q Consensus         4 ~~~~~~IlIl--DfGS----QytqLIaRriRelgVyseI~P~~~~~e-------~i~~~~p~GIILSGGP~SV~d~~ap~   70 (520)
                      +.++..|.++  |+..    +..+-|.+..++.|....+...+...+       .+...+++|+|+.++..    .+.+.
T Consensus        58 ~~~t~~Igvvvp~~~n~~~~~l~~~i~~~~~~~gy~~li~~s~~~~~~e~~~~~~l~~~~vdgiIv~~~~~----~~~~~  133 (330)
T PRK11303         58 AGRTRSIGLIIPDLENTSYARIAKLLEQQARQRGYQLLIACSDDQPDNEMQCAEHLLQRQVDALIVATSLP----PEHPF  133 (330)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC----CCCHH
T ss_conf             08777677754544431567888999999996698799994799989999999999974899899946888----86299


Q ss_pred             CCHHHHHCCCCEEEE
Q ss_conf             376898089988997
Q gi|254780414|r   71 IPKEILESNIPLLGI   85 (520)
Q Consensus        71 ~~~~I~~~~iPILGI   85 (520)
                       ...+.+.++|+.-+
T Consensus       134 -~~~l~~~~iPvV~i  147 (330)
T PRK11303        134 -YQRLQNDGFPIIAL  147 (330)
T ss_pred             -HHHHHHCCCCEEEE
T ss_conf             -99998469978997


No 456
>KOG0174 consensus
Probab=23.85  E-value=29  Score=14.92  Aligned_cols=44  Identities=27%  Similarity=0.255  Sum_probs=28.4

Q ss_pred             HHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHH
Q ss_conf             7550106441114067899999999765044403664056404779
Q gi|254780414|r  192 FVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTV  237 (520)
Q Consensus       192 Fl~~Ic~~~~~W~~~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV  237 (520)
                      |++.-  |..+|.+.--.|++++-+|+.|.-.---=+-||||=-.|
T Consensus       153 fIYGf--~D~~~r~nMt~EE~~~fvk~Av~lAi~rDGsSGGviR~~  196 (224)
T KOG0174         153 FIYGF--CDANWRPNMTLEECVRFVKNAVSLAIERDGSSGGVIRLV  196 (224)
T ss_pred             EEEEE--EHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             45544--332217999999999999999999986068878789999


No 457
>pfam09656 PGPGW Putative transmembrane protein (PGPGW). Proteins in this entry are putative Actinobacterial proteins of about 150 amino acids in length, with three predicted transmembrane helices and an unusual motif with consensus sequence PGPGW.
Probab=23.84  E-value=21  Score=15.97  Aligned_cols=14  Identities=50%  Similarity=0.975  Sum_probs=10.8

Q ss_pred             CCCCCCCCEEEECC
Q ss_conf             88898311122100
Q gi|254780414|r  396 HPCPGPGLAIRCIG  409 (520)
Q Consensus       396 hPFPGPGLaiRi~g  409 (520)
                      -|.||||..+=.+|
T Consensus        19 i~lPGPGwl~if~G   32 (53)
T pfam09656        19 IPLPGPGWLLVFIG   32 (53)
T ss_pred             EECCCCCEEHHHHH
T ss_conf             20699840019999


No 458
>pfam08190 PIH1 pre-RNA processing PIH1/Nop17. This domain is involved in pre-rRNA processing. It has has been shown to be required either for nucleolar retention or correct assembly of the box C/D snoRNP in Saccharomyces cerevisiae. The C-terminal region of this family has similarity to the CS domain pfam04969.
Probab=23.67  E-value=46  Score=13.55  Aligned_cols=29  Identities=31%  Similarity=0.576  Sum_probs=24.1

Q ss_pred             CEEEEEEEEHHHCCCHHHHHHHHHHHHHC
Q ss_conf             01124652122215202577998755010
Q gi|254780414|r  169 KYYAVQFHPEVVHTVGGSQLIDNFVHHVA  197 (520)
Q Consensus       169 ~iyGVQFHPEV~hT~~G~~iL~NFl~~Ic  197 (520)
                      ..|-+-|||++.+--.-...|++|+..+|
T Consensus        98 ~v~Dv~~np~~~~~~~~~~~f~~~l~~~a  126 (325)
T pfam08190        98 TVYDVVFNPDTLQKAEKDQLFRNFLIQTA  126 (325)
T ss_pred             EEEEEEECHHHHHHHHCCHHHHHHHHHHH
T ss_conf             99999857899998860989999999999


No 459
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; InterPro: IPR011821   Proteins in this entry are important in the interconversion of the sulphur-containing amino acids L-cysteine and L-methionine in bacteria. In bacteria, inorganic sulphur is reduced to sulphide, which is then used to displace the acetyl group of O-acetyl-L-serine to form the essential amino acid L-cysteine. Biosynthesis of L-methionine then occurs via the transsulphuration pathway which involves the sequential action of two pyridoxal 5'-phosphate (PLP) enzymes, cystathionine gamma-synthase (CGS) and cystathionine beta-lyase (CBL). Firstly CGS catalyses the formation of the intermediate cystathione from a homoserine ester and L-cysteine. This intermediate is then converted by CBL to L-homoserine, which is subsequently methylated by methionine synthase to form L-methionine. For more information see .   The CGS enzyme (P00935 from SWISSPROT) from Escherichia coli is, like other CGS enzymes, a homotetramer composed of two catalytically active dimers . The active site of each dimer is found at the interface between the monomers and involves residues from each monomer. Catalysis occurs by alpha,gamma-elimination/replacement reactions..
Probab=23.66  E-value=17  Score=16.60  Aligned_cols=32  Identities=28%  Similarity=0.388  Sum_probs=22.6

Q ss_pred             CCCHHHHH--HHHHHHHCCCC-EEEEEECCCCCCC
Q ss_conf             64047799--99998622365-6999973895515
Q gi|254780414|r  231 GGVDSTVA--AFLIYEAIGIN-LTCVLVDHGFMRK  262 (520)
Q Consensus       231 GGVDStV~--A~Ll~kAig~~-l~~vfVD~GllRk  262 (520)
                      |||-|-||  |.+.|+|.+++ .--==|.+-|||.
T Consensus       328 GGVESLiaHPATMTH~aM~~eAR~~AGI~~~LLRl  362 (383)
T TIGR02080       328 GGVESLIAHPATMTHAAMGPEARAEAGISDTLLRL  362 (383)
T ss_pred             CCHHHHHCHHHCCCCHHHHHHHHHHCCCCCCCCEE
T ss_conf             55123333010126021018989745841142000


No 460
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis. Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis. The members of this group are belonging to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily.  Like other periplasmic receptors of the ABC-type transport systems, the allose-binding protein consists of two alpha/beta domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding.
Probab=23.64  E-value=48  Score=13.39  Aligned_cols=97  Identities=13%  Similarity=0.123  Sum_probs=50.6

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCC--CCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHHHHCC---
Q ss_conf             444036640564047799999986223--656999973895515627899998862369857997588999999668---
Q gi|254780414|r  221 GNERVICAVSGGVDSTVAAFLIYEAIG--INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN---  295 (520)
Q Consensus       221 g~~kVi~~lSGGVDStV~A~Ll~kAig--~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~~L~g---  295 (520)
                      ++-+++....+.-|..-+...+...+-  +++.+||.-|..|-.+=.+.+.+.-+. -.+.+.-.|.....+..++.   
T Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~~~L~~~pd~~ai~~~nD~~A~Ga~~al~~~g~~-~di~vvG~D~~~~~~~~i~~g~~  230 (275)
T cd06320         152 SGIEVVASQPADWDREKAYDVATTILQRNPDLKAIYCNNDTMALGVVEAVKNAGKQ-GKVLVVGTDGIPEAYKSIRAGEL  230 (275)
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCCC-CCEEEEEECCCHHHHHHHHCCCC
T ss_conf             99835643155303899999999988628766779966988999999999976999-98299998976999999864996


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98889999887565899999999
Q gi|254780414|r  296 IVDPETKRKVIGQLFIEVFEEEA  318 (520)
Q Consensus       296 v~DPE~KRkiIG~~Fi~vf~~~a  318 (520)
                      ..--.+...-+|..=++...+..
T Consensus       231 ~~tv~q~~~~~G~~av~~l~~~l  253 (275)
T cd06320         231 TATVDSFPALIGEVAMEVMLRAL  253 (275)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHH
T ss_conf             69981799999999999999997


No 461
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms. Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. This model identifies both archaeal (aRF1) and eukaryotic (eRF1) of the protein. Also known as translation termination factor 1.
Probab=23.57  E-value=38  Score=14.13  Aligned_cols=35  Identities=6%  Similarity=0.158  Sum_probs=19.4

Q ss_pred             EEEEECCCCHHHH-HHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             3664056404779-99999862236569999738955
Q gi|254780414|r  225 VICAVSGGVDSTV-AAFLIYEAIGINLTCVLVDHGFM  260 (520)
Q Consensus       225 Vi~~lSGGVDStV-~A~Ll~kAig~~l~~vfVD~Gll  260 (520)
                      +|+|-||.--... -.-+++..|.+++..+| |.+-=
T Consensus       212 iilgGp~~~K~~f~~~~~ld~rL~~kVi~~~-Dv~Y~  247 (403)
T TIGR03676       212 ILIGGPGPTKEEFAEGDYLHHELKKKILGLF-DVSYT  247 (403)
T ss_pred             EEECCCCHHHHHHHHCCCCCHHHHHHHHEEE-ECCCC
T ss_conf             9933784176776314553588996503343-04788


No 462
>pfam06483 ChiC Chitinase C. This ~170 aa region is found at the C-terminus of pfam00704.
Probab=23.55  E-value=48  Score=13.38  Aligned_cols=18  Identities=28%  Similarity=0.455  Sum_probs=9.0

Q ss_pred             CCCHHHHHHHHHHHCCCE
Q ss_conf             970578899888865940
Q gi|254780414|r   16 GSQFTQLIARRVRESKVY   33 (520)
Q Consensus        16 GSQytqLIaRriRelgVy   33 (520)
                      |+.-|.++-.+.+...-|
T Consensus         5 G~TlT~~~y~kF~~A~pY   22 (179)
T pfam06483         5 GSTLTSLAYDKFANATPY   22 (179)
T ss_pred             CHHHHHHHHHHHCCCCCC
T ss_conf             305899999986047875


No 463
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=23.39  E-value=49  Score=13.36  Aligned_cols=14  Identities=14%  Similarity=0.299  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             56589999999974
Q gi|254780414|r  307 GQLFIEVFEEEAKK  320 (520)
Q Consensus       307 G~~Fi~vf~~~a~~  320 (520)
                      ...|.+-|++.-.+
T Consensus       262 ~~~Fv~~y~~~~g~  275 (312)
T cd06333         262 ALDFVKAYEAKYGA  275 (312)
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             99999999998688


No 464
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction is located at the branching point of the tetrapyrrole biosynthetic pathway, leading to the biosynthesis of heme, chlorophyll or bacteriochlorophyll. URO-D deficiency is responsible for the human genetic diseases familial porphyria cutanea tarda (fPCT) and hepatoerythropoietic porphyria (HEP).
Probab=23.39  E-value=49  Score=13.36  Aligned_cols=123  Identities=16%  Similarity=0.264  Sum_probs=61.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCC--HHHHHHHH--------HH
Q ss_conf             6789999999976504440366405640477999999862236-5699997389551562--78999988--------62
Q gi|254780414|r  206 SSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI-NLTCVLVDHGFMRKNE--VENIISLF--------KG  274 (520)
Q Consensus       206 ~~~~~~~i~~Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~-~l~~vfVD~GllRknE--~~~v~~~~--------~~  274 (520)
                      -.++-++++.+|++.++++-|.|.+||== |+++.++.-- |. ++.-  + .-+|.++.  .+++++.+        +.
T Consensus       111 l~~v~eai~~~r~~L~~~~pLIGF~G~Pw-TLasYmieG~-~sk~~~~--~-k~~~~~~p~~~~~ll~~lt~~~~~yl~~  185 (335)
T cd00717         111 LSYVYEAIKLTRKELPGEVPLIGFAGAPW-TLASYMIEGG-GSKDFAK--A-KKMMYTDPEAFHALLDKLTDATIEYLKA  185 (335)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCHH-HHHHHHHCCC-CCCCHHH--H-HHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             56999999999997388887688638769-9999998389-9855799--9-8776138899999999999999999999


Q ss_pred             --CCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC--EEEEECC--CCCHHHHH
Q ss_conf             --36985799758899999966898889999887565899999999743997--0998646--22024542
Q gi|254780414|r  275 --YPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGA--QFLGQGT--LYPDVIES  339 (520)
Q Consensus       275 --~~~~~l~~vda~~~Fl~~L~gv~DPE~KRkiIG~~Fi~vf~~~a~~~~~~--~~L~QGT--lypDvIES  339 (520)
                        .-|.++..+-      +--.|.-+|++=++-+-.---+++++.-++.+++  =+.+-||  ++++.-++
T Consensus       186 Qi~aGAd~iqIF------DSwag~L~~~~f~~f~~p~~~~I~~~ik~~~~~vpiI~f~~~~~~~l~~~~~~  250 (335)
T cd00717         186 QIEAGAQAVQIF------DSWAGALSPEDFEEFVLPYLKRIIEEVKKRLPGVPVILFAKGAGGLLEDLAQL  250 (335)
T ss_pred             HHHHCCCEEEEC------CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHC
T ss_conf             998199878850------75202068999999899999999999985289997899768857899999863


No 465
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators. This group includes the ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding
Probab=23.35  E-value=49  Score=13.35  Aligned_cols=69  Identities=14%  Similarity=0.146  Sum_probs=39.0

Q ss_pred             EEEECCCCH----HHHHHHHHHHCCCEEEEECCCCCH-------HHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHCC
Q ss_conf             999889705----788998888659406985289898-------899723997999985388999999975376898089
Q gi|254780414|r   11 LIIDFGSQF----TQLIARRVRESKVYCEVIAFKNAL-------DYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESN   79 (520)
Q Consensus        11 lIlDfGSQy----tqLIaRriRelgVyseI~P~~~~~-------e~i~~~~p~GIILSGGP~SV~d~~ap~~~~~I~~~~   79 (520)
                      +|=|+..-|    .+-|.+..++.|+...+...+.+.       +.+...+++|+|++.+..    ...+ ....+.+.+
T Consensus         5 ivp~i~npf~~~~~~gie~~~~~~Gy~~~i~~t~~~~~~e~~~i~~l~~~~vdGiIi~~~~~----~~~~-~~~~l~~~~   79 (266)
T cd06282           5 VLPSLANPVFAECVQGIQEEARAAGYSLLLATTDYDAEREADAVETLLRQRVDGLILTVADA----ATSP-ALDLLDAER   79 (266)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC----CCHH-HHHHHHHCC
T ss_conf             97898688999999999999998799899997999979999999999965998799963787----7559-999998559


Q ss_pred             CCEEE
Q ss_conf             98899
Q gi|254780414|r   80 IPLLG   84 (520)
Q Consensus        80 iPILG   84 (520)
                      +|+.-
T Consensus        80 iPvV~   84 (266)
T cd06282          80 VPYVL   84 (266)
T ss_pred             CCEEE
T ss_conf             97899


No 466
>pfam03421 YopJ YopJ Serine/Threonine acetyltransferase. The Yersinia effector YopJ inhibits the innate immune response by blocking MAP kinase and NFkappaB signaling pathways. YopJ is a serine/threonine acetyltransferase which regulates signalling pathways by blocking phosphorylation. This family was previously incorrectly annotated in Pfam as being a peptidase family.
Probab=23.29  E-value=46  Score=13.54  Aligned_cols=22  Identities=36%  Similarity=0.803  Sum_probs=19.5

Q ss_pred             HHCCCCCEEEEEHHHHHHHHHC
Q ss_conf             6236985799758899999966
Q gi|254780414|r  273 KGYPNFPLRVVDASERFIRKLK  294 (520)
Q Consensus       273 ~~~~~~~l~~vda~~~Fl~~L~  294 (520)
                      +++.|+||++.|..+.|+.+||
T Consensus        42 ~r~p~LNL~~f~s~~~~~~alk   63 (178)
T pfam03421        42 QRYPGLNLRFFDSPQEFVQALK   63 (178)
T ss_pred             CCCCCCCEEECCCHHHHHHHHH
T ss_conf             3389987220089899999999


No 467
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism]
Probab=23.27  E-value=49  Score=13.34  Aligned_cols=58  Identities=19%  Similarity=0.188  Sum_probs=29.1

Q ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEEHHHHHHH
Q ss_conf             9765044403664056404779999998622365699997389551562789999886236985799758899999
Q gi|254780414|r  216 IKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIR  291 (520)
Q Consensus       216 Ir~~vg~~kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVD~GllRknE~~~v~~~~~~~~~~~l~~vda~~~Fl~  291 (520)
                      -+-+||+-- =+|||=|+-|        -|+|=+++- +     |..+-.+.-++.++.+ |++  +|...+.+-.
T Consensus       161 ysIaVGSTG-NLGlSIGI~s--------A~lGF~vtV-H-----MSADAr~WKKd~LRs~-gVt--ViEYe~DY~~  218 (443)
T COG3048         161 YSIAVGSTG-NLGLSIGIMS--------AALGFKVTV-H-----MSADARAWKKDKLRSH-GVT--VVEYEQDYGV  218 (443)
T ss_pred             HEEEECCCC-CCCEEHHHHH--------HHHCCEEEE-E-----ECCHHHHHHHHHHHHC-CCE--EEEECCHHHH
T ss_conf             357512567-6530034334--------320625999-9-----5200788889889863-965--9996030668


No 468
>COG5552 Uncharacterized conserved protein [Function unknown]
Probab=23.09  E-value=49  Score=13.32  Aligned_cols=48  Identities=38%  Similarity=0.567  Sum_probs=31.8

Q ss_pred             HHHHHHHH-CCCCCEEEEEHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99998862-369857997588999