HHsearch alignment for GI: 254780414 and conserved domain: pfam04204

>pfam04204 HTS Homoserine O-succinyltransferase.
Probab=98.48  E-value=3.9e-06  Score=64.12  Aligned_cols=160  Identities=22%  Similarity=0.301  Sum_probs=100.1

Q ss_pred             CHHHHHHCCCCEEEECCCCCCC--CCCCCCCC-CHHHHH---C-CCCEEEECHHHHH-HHHHCCCEEEECCCCCCCEEEE
Q ss_conf             9889972399799998538899--99999753-768980---8-9988997789999-8997096999869866103667
Q gi|254780414|r   42 ALDYFKEQNPQAIILSGSPASS--LDIDSPQI-PKEILE---S-NIPLLGICYGQQI-MCQSLGGKTKNSQSREFGRAFI  113 (520)
Q Consensus        42 ~~e~i~~~~p~GIILSGGP~SV--~d~~ap~~-~~~I~~---~-~iPILGICyG~Ql-La~~~GG~V~~~~~~EyG~~~I  113 (520)
T Consensus        90 ~f~~ik~~~~DGlIITGAPvE~l~FeeV~YW~El~~I~dWs~~~v~Stl~iCWaAqAaL~~~ygI~K~~l~~KlfGVf~h  169 (298)
T pfam04204        90 TFDEIKDEKFDGLIITGAPVEHLPFEDVDYWEELTEIMDWSKTNVTSTLHICWGAQAALYHFYGIPKHLLPEKLFGVFRH  169 (298)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             19999658875699728987778855374199999999999862544045749999999998199800178745885123


Q ss_pred             EE-CCCCCCCCCCCCCCCCEEEEEECCCHH--HC--CCCCCCEEECCCCCCEEEEEECCCCEEEEEEEEHHHCCCHHHHH
Q ss_conf             52-388622278726655336860022011--01--24442112323983178898635001124652122215202577
Q gi|254780414|r  114 EI-KKNCSLLKGMWEKGSKQQVWMSHGDQV--EH--IPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL  188 (520)
Q Consensus       114 ~i-~~~~~lf~gl~~~~~~~~VwmSH~D~V--~~--lP~gf~viA~S~~~~iaai~~~~~~iyGVQFHPEV~hT~~G~~i  188 (520)
T Consensus       170 ~~~~~~~pLlrGfdd---~f~~PhSR~t~i~~~~i~~~~~L~iLa~s~~~G~~l~~~~d~r~vf~~GH~EYd~----~TL  242 (298)
T pfam04204       170 RVLDPHSPLLRGFDD---EFYAPHSRHTEVRREDIEAVPGLEILAESEEAGVYLVASKDGRQVFVTGHPEYDA----DTL  242 (298)
T ss_pred             CCCCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHCCCCCEEEECCCCCCEEEEECCCCCEEEEECCCCCCH----HHH
T ss_conf             457899801047876---5306742334699889713788479867787761799828988688827866675----489


Q ss_pred             HHHHHHHHCCCCCCCCCHHH
Q ss_conf             99875501064411140678
Q gi|254780414|r  189 IDNFVHHVAGIQDNWVMSSY  208 (520)
Q Consensus       189 L~NFl~~Ic~~~~~W~~~~~  208 (520)
T Consensus       243 ~~EY~RD~~~g~~~~~P~NY  262 (298)
T pfam04204       243 KDEYERDLAKGLDIPIPENY  262 (298)
T ss_pred             HHHHHHHHHCCCCCCCCCCC
T ss_conf             99999999769998999888