HHsearch alignment for GI: 254780414 and conserved domain: pfam07722

>pfam07722 Peptidase_C26 Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyse the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C terminus.
Probab=99.90  E-value=5.4e-23  Score=184.56  Aligned_cols=153  Identities=18%  Similarity=0.320  Sum_probs=111.3

Q ss_pred             HHHHHHCCCEEEEECCCCCHHHHHH--CCCCEEEECCCCCCC----CCCCC-C-----CCC---------HHHHHCCCCE
Q ss_conf             9888865940698528989889972--399799998538899----99999-7-----537---------6898089988
Q gi|254780414|r   24 ARRVRESKVYCEVIAFKNALDYFKE--QNPQAIILSGSPASS----LDIDS-P-----QIP---------KEILESNIPL   82 (520)
Q Consensus        24 aRriRelgVyseI~P~~~~~e~i~~--~~p~GIILSGGP~SV----~d~~a-p-----~~~---------~~I~~~~iPI   82 (520)
T Consensus        30 v~~i~~aGg~pv~iP~~~~~~~~~~~l~~~dGlll~GG~~di~P~~yg~~~~~~~~~~~~~Rd~~e~~l~~~a~~~~~Pi  109 (219)
T pfam07722        30 VKAVEGAGGLPVLLPILEDPEDLEALLDLVDGLLLTGGQSNVDPSLYGEEPSPSGGYYDPARDAFELALIRAALERGKPI  109 (219)
T ss_pred             HHHHHHCCCEEEEECCCCCHHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCE
T ss_conf             99999859999997899998999999976798998598876782214677686678757888999999999998769987


Q ss_pred             EEECHHHHHHHHHCCCEEEEC--------------CCCCCCEEEEEECCCCCCCCCCCCCCCCEEEEEECCCHHHCCCCC
Q ss_conf             997789999899709699986--------------986610366752388622278726655336860022011012444
Q gi|254780414|r   83 LGICYGQQIMCQSLGGKTKNS--------------QSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEG  148 (520)
Q Consensus        83 LGICyG~QlLa~~~GG~V~~~--------------~~~EyG~~~I~i~~~~~lf~gl~~~~~~~~VwmSH~D~V~~lP~g  148 (520)
T Consensus       110 lGICrG~Qllnv~~GGtL~q~i~~~~~~~~~~~~~~~~~~~~h~v~i~~~s~l~~-~~~-~~~~~vnS~Hhq~I~~l~~~  187 (219)
T pfam07722       110 LGICRGMQLLNVALGGTLYQDIPEHPGNSDHHHQLAVQYAPSHAVSLEPGSLLAR-LLG-AEEILVNSLHHQAIKRLAPG  187 (219)
T ss_pred             EEECHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHH-HHC-CCCEEEECCHHHHHHCCCCC
T ss_conf             9976508999999678300023012575445668876425603899778973998-729-98457974506577404898


Q ss_pred             CCEEECCCCCCEEEEEECCCC--EEEEEEEEH
Q ss_conf             211232398317889863500--112465212
Q gi|254780414|r  149 FEVIASSDSTPFAFIADEKRK--YYAVQFHPE  178 (520)
Q Consensus       149 f~viA~S~~~~iaai~~~~~~--iyGVQFHPE  178 (520)
T Consensus       188 l~v~A~a~Dg~iEaie~~~~~~f~~GVQwHPE  219 (219)
T pfam07722       188 LRVEATAPDGTIEAIESPNAPYFVLGVQWHPE  219 (219)
T ss_pred             CEEEEEECCCCEEEEEECCCCCCEEEEEECCC
T ss_conf             58999948997899996699986799972889