BLAST/PSIBLAST alignment of GI: 254780414 and GI: 150398701 at iteration 1
>gi|150398701|ref|YP_001329168.1| GMP synthase [Sinorhizobium medicae WSM419] Length = 520
>gi|226739739|sp|A6UFA3|GUAA_SINMW RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName: Full=GMP synthetase; AltName: Full=Glutamine amidotransferase Length = 520
>gi|150030216|gb|ABR62333.1| GMP synthase, large subunit [Sinorhizobium medicae WSM419] Length = 520
 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 429/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRES VYCE++ F++A D F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDTVLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEDGFHRLKPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+LD+ SP+ P  I ES +P+ GICYGQQ MC  LGGK ++   REFGRAF+E++K+C 
Sbjct: 61  ASTLDVGSPRAPSVIFESGLPVFGICYGQQTMCAQLGGKVESGHHREFGRAFLEVEKDCP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + PFAFIADEKR+YYAVQFHPEVV
Sbjct: 121 LFEGLWSLGSRHQVWMSHGDRVTALPDGFEVVATSSNAPFAFIADEKRRYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NFVH +AGI+ +W MS+Y  + V  I+ QVG+++VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIANFVHKIAGIKGDWTMSAYRAKAVEAIRNQVGDKKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++FK + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFKEHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIEVFEEEA K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIEVFEEEAGKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR+LG+EL LPDSF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRVLGRELGLPDSFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520