BLAST/PSIBLAST alignment of GI: 254780414 and GI: 241207252 at iteration 1
>gi|241207252|ref|YP_002978348.1| GMP synthase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 520
>gi|240861142|gb|ACS58809.1| GMP synthase, large subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 520
 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/520 (66%), Positives = 428/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFHRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P  I ES +P+ GICYGQQ MC  LGGK ++   REFGRAF+E+ ++C 
Sbjct: 61  ASTVDEGSPRAPNIIFESGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLEVDRDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AG++ +W MS+Y ++ V +I+EQVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGLKGDWSMSAYRQKAVEQIREQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N  L  VDA++RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHYNLHLLHVDAADRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520