BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus
Liberibacter asiaticus str. psy62]
         (520 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040091|gb|ACT56887.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 520

 Score = 1072 bits (2772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/520 (100%), Positives = 520/520 (100%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP
Sbjct: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS
Sbjct: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV
Sbjct: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF
Sbjct: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE
Sbjct: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP
Sbjct: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR
Sbjct: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF
Sbjct: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE
Sbjct: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520


>gi|315122142|ref|YP_004062631.1| GMP synthase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495544|gb|ADR52143.1| GMP synthase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 520

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/520 (84%), Positives = 483/520 (92%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           MH  ++S+KVLIIDFGSQFTQLIAR VRE+KVYCEVIAF+ ALDYF++  PQAIILSGSP
Sbjct: 1   MHAGKKSNKVLIIDFGSQFTQLIARCVRENKVYCEVIAFECALDYFRKTRPQAIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS LDIDSPQIP+EILESN PLLGICYGQQIMC SLGG  K SQ+REFGRAFIEIKK+CS
Sbjct: 61  ASPLDIDSPQIPQEILESNTPLLGICYGQQIMCTSLGGTIKKSQNREFGRAFIEIKKDCS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LLKG+WEK S QQVWMSHGDQVE +PEGFEVIASSD+TPFAF+ADEKRKYYAVQFHPEVV
Sbjct: 121 LLKGLWEKDSIQQVWMSHGDQVERMPEGFEVIASSDNTPFAFVADEKRKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GGSQLI NFV  VAGIQ +W+MSSY KEIVS IK+QVG+ERVICA+SGGVDS+VAAF
Sbjct: 181 HTEGGSQLIANFVRDVAGIQGDWIMSSYRKEIVSCIKKQVGDERVICALSGGVDSSVAAF 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LIYEAIG NLTCVLVDHGFMRKNEV+N++ LFK YP+FPL VVDASERFI KLKN++DPE
Sbjct: 241 LIYEAIGKNLTCVLVDHGFMRKNEVDNVVGLFKKYPDFPLIVVDASERFIGKLKNVIDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG+LFIEVFEEEA+KIGGA+FLGQGTLYPDVIES+SFFGGPSS+IKSHHNVGGLP
Sbjct: 301 DKRKIIGKLFIEVFEEEAEKIGGAKFLGQGTLYPDVIESVSFFGGPSSVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E+M+M LVEPL++LFKDEVRLLGKEL L DSF++RHPCPGPGLAIRCIGE+TEE+INILR
Sbjct: 361 EYMNMDLVEPLRDLFKDEVRLLGKELGLSDSFIDRHPCPGPGLAIRCIGEVTEEKINILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ESDAIY EEI KAGIY +IWQAFTVLLP+QTVGVMGDERTYE VCSLRAVTS DGMTADF
Sbjct: 421 ESDAIYCEEICKAGIYNEIWQAFTVLLPIQTVGVMGDERTYECVCSLRAVTSRDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YHHDM+FLSQV+ RIVNEVKGI+RVVYDITSKPPATIEWE
Sbjct: 481 YHHDMDFLSQVSTRIVNEVKGISRVVYDITSKPPATIEWE 520


>gi|227824153|ref|YP_002828126.1| GMP synthase [Sinorhizobium fredii NGR234]
 gi|254800111|sp|C3MCS5|GUAA_RHISN RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|227343155|gb|ACP27373.1| glutamine-hydrolyzing GMP synthase [Sinorhizobium fredii NGR234]
          Length = 520

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/520 (67%), Positives = 430/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+A+ILSGSP
Sbjct: 1   MTQTAHPDTVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLKPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+LDI SP+ P  I ES +P+ GICYGQQ MC  LGGK ++   REFGRAF+E++K+C+
Sbjct: 61  ASTLDIGSPRAPSVIFESGLPVFGICYGQQTMCAQLGGKVESGHHREFGRAFLEVEKDCA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W  GS+ QVWMSHGD+V  +PEGFEV+A+S + PFAFIADE RKYYAVQFHPEVV
Sbjct: 121 LFDGLWSLGSRHQVWMSHGDRVTALPEGFEVVATSSNAPFAFIADETRKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NFVH +AGI+ +W MS+Y  + V  I++QVG ++VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLISNFVHKIAGIKGDWTMSAYRAKAVEAIRKQVGGKKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F+ + N  L  +DAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFQEHYNLHLLHIDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIEVFEEEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR+LG+EL LP+SF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRVLGRELGLPESFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|150398701|ref|YP_001329168.1| GMP synthase [Sinorhizobium medicae WSM419]
 gi|226739739|sp|A6UFA3|GUAA_SINMW RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|150030216|gb|ABR62333.1| GMP synthase, large subunit [Sinorhizobium medicae WSM419]
          Length = 520

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 429/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRES VYCE++ F++A D F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDTVLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEDGFHRLKPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+LD+ SP+ P  I ES +P+ GICYGQQ MC  LGGK ++   REFGRAF+E++K+C 
Sbjct: 61  ASTLDVGSPRAPSVIFESGLPVFGICYGQQTMCAQLGGKVESGHHREFGRAFLEVEKDCP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + PFAFIADEKR+YYAVQFHPEVV
Sbjct: 121 LFEGLWSLGSRHQVWMSHGDRVTALPDGFEVVATSSNAPFAFIADEKRRYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NFVH +AGI+ +W MS+Y  + V  I+ QVG+++VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIANFVHKIAGIKGDWTMSAYRAKAVEAIRNQVGDKKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++FK + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFKEHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIEVFEEEA K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIEVFEEEAGKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR+LG+EL LPDSF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRVLGRELGLPDSFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|222084579|ref|YP_002543108.1| GMP synthase - glutamine amidotransferase protein [Agrobacterium
           radiobacter K84]
 gi|254799665|sp|B9J7L1|GUAA_AGRRK RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|221722027|gb|ACM25183.1| GMP synthase - glutamine amidotransferase protein [Agrobacterium
           radiobacter K84]
          Length = 520

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/520 (66%), Positives = 430/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +  +   VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A   FK   P+A+ILSGSP
Sbjct: 1   MTQTAQPDTVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSADAGFKRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P+ I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+++ K+C+
Sbjct: 61  ASTVDEGSPRAPQIIFDSGVPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLDVNKDCA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AGI+ +W MS+Y  + V  I++QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGIKGDWSMSAYRAKAVQAIRDQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F  + N  L  VDASERFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFSEHYNLHLLHVDASERFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR LGKEL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRALGKELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|15964067|ref|NP_384420.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Sinorhizobium meliloti 1021]
 gi|307301211|ref|ZP_07580973.1| GMP synthase, large subunit [Sinorhizobium meliloti BL225C]
 gi|307321113|ref|ZP_07600518.1| GMP synthase, large subunit [Sinorhizobium meliloti AK83]
 gi|24211760|sp|Q92SQ3|GUAA_RHIME RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|15073243|emb|CAC41751.1| Probable GMP synthase glutamine-hydrolyzing protein [Sinorhizobium
           meliloti 1021]
 gi|306893285|gb|EFN24066.1| GMP synthase, large subunit [Sinorhizobium meliloti AK83]
 gi|306903667|gb|EFN34254.1| GMP synthase, large subunit [Sinorhizobium meliloti BL225C]
          Length = 520

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/520 (67%), Positives = 428/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRES VYCE++ F++A + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDTVLIVDFGSQVTQLIARRVRESGVYCEIVPFQSAEEGFHRLKPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+LD  SP+ P  I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+E++K+C 
Sbjct: 61  ASTLDTGSPRAPSVIFDSGLPVFGICYGQQTMCAQLGGKVESGHHREFGRAFLEVEKDCP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W  GS+ QVWMSHGD+V  +PEGFEV+A+S + PFAFIADEKRKYYAVQFHPEVV
Sbjct: 121 LFDGLWSLGSRHQVWMSHGDRVTALPEGFEVVATSSNAPFAFIADEKRKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NFVH +AGI  +W MS+Y  + V  I++QVG+++VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIANFVHKIAGITGDWTMSAYRAKAVEAIRKQVGDKKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++FK + N  L  +DAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFKEHYNLHLLHIDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIEVFEEEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR+LG+EL LP+SF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRVLGRELGLPESFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|86355954|ref|YP_467846.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhizobium etli CFN 42]
 gi|123513305|sp|Q2KDG7|GUAA_RHIEC RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|86280056|gb|ABC89119.1| GMP synthase - glutamine amidotransferase protein [Rhizobium etli
           CFN 42]
          Length = 520

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/520 (66%), Positives = 430/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P+ I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+++ K+C 
Sbjct: 61  ASTVDEGSPRAPQIIFDSGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLDVDKDCE 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GF+V+A+S + PFAFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFKVVATSSNAPFAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H+VAGI+ +W MS+Y ++ V  I++QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNVAGIKGDWSMSAYRQKAVEEIRKQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F+ + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFREHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|190889964|ref|YP_001976506.1| GMP synthase (glutamine-hydrolyzing) protein [Rhizobium etli CIAT
           652]
 gi|218515693|ref|ZP_03512533.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhizobium etli 8C-3]
 gi|226739709|sp|B3PYH7|GUAA_RHIE6 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|190695243|gb|ACE89328.1| GMP synthase (glutamine-hydrolyzing) protein [Rhizobium etli CIAT
           652]
          Length = 520

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/520 (66%), Positives = 429/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+A+ILSGSP
Sbjct: 1   MTHTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P+ I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+++ K+C 
Sbjct: 61  ASTVDEGSPRAPQIIFDSGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLDVDKDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + PFAFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPFAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AGI+ +W MS+Y ++ V  I++QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVDEIRKQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F+ + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFREHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|327191998|gb|EGE58979.1| GMP synthase (glutamine-hydrolyzing) protein [Rhizobium etli
           CNPAF512]
          Length = 520

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/520 (66%), Positives = 429/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+A+ILSGSP
Sbjct: 1   MTHTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFKRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P+ I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+++ K+C 
Sbjct: 61  ASTVDEGSPRAPQIIFDSGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLDVDKDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AGI+ +W MS+Y ++ V  I++QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVDEIRKQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F+ + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFREHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAK++GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKRLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|209551875|ref|YP_002283792.1| GMP synthase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226739711|sp|B5ZYE9|GUAA_RHILW RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|209537631|gb|ACI57566.1| GMP synthase, large subunit [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 520

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/520 (65%), Positives = 429/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFNRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P+ + +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+++ K+C 
Sbjct: 61  ASTVDEGSPRAPQIVFDSGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLDVDKDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AGI+ +W MS+Y ++ V  I++QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVDEIRKQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E  N++++F+ + N  L  VDAS+RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAANVVAMFREHYNLHLLHVDASDRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G I+ E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGISREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|241207252|ref|YP_002978348.1| GMP synthase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861142|gb|ACS58809.1| GMP synthase, large subunit [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 520

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/520 (66%), Positives = 428/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFHRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P  I ES +P+ GICYGQQ MC  LGGK ++   REFGRAF+E+ ++C 
Sbjct: 61  ASTVDEGSPRAPNIIFESGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLEVDRDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AG++ +W MS+Y ++ V +I+EQVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGLKGDWSMSAYRQKAVEQIREQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N  L  VDA++RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHYNLHLLHVDAADRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|222147262|ref|YP_002548219.1| GMP synthase [Agrobacterium vitis S4]
 gi|254799666|sp|B9JZA3|GUAA_AGRVS RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|221734252|gb|ACM35215.1| GMP synthase [Agrobacterium vitis S4]
          Length = 520

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/520 (66%), Positives = 428/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLIIDFGSQ TQLIARRVRE+ VYCE++ F+++ + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIIDFGSQVTQLIARRVRETGVYCEIVPFQSSEEGFARLKPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+LD  SP++P+ I +S +P+ GICYGQQ +C  LGGK +    REFGRAF+EI+++C 
Sbjct: 61  ASALDEGSPRVPQVIFDSGLPIFGICYGQQTICAQLGGKVEAGHHREFGRAFLEIEQDCK 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  IP GF V+A+S + PFAFIADE RKYYAVQFHPEVV
Sbjct: 121 LFEGLWSVGSRHQVWMSHGDRVTAIPPGFRVLATSSNAPFAFIADEARKYYAVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NFVH++AGI  +W MS+Y  + V +I+ QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIQNFVHNIAGITGDWSMSAYRAKAVEQIRAQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRKNE  +++++FK + N  L  VDA +RF+ +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKNEAADVVAMFKEHYNLHLIHVDAIDRFVGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEAKK+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEAKKLGGADFLGQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+MKLVEPL+ELFKDEVR+LGKEL LPDSF+ RHP PGPGLAIRC G +T E+++ILR
Sbjct: 361 DRMNMKLVEPLRELFKDEVRVLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLDILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|116250083|ref|YP_765921.1| GMP synthase [Rhizobium leguminosarum bv. viciae 3841]
 gi|226739710|sp|Q1MMJ7|GUAA_RHIL3 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|115254731|emb|CAK05805.1| putative GMP synthase [glutamine hydrolysing] [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 520

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/520 (65%), Positives = 427/520 (82%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      VLI+DFGSQ TQLIARRVRE+ VYCE++ F++A + F    P+A+ILSGSP
Sbjct: 1   MTQTAHPDSVLIVDFGSQVTQLIARRVREAGVYCEIVPFQSAEEGFHRLQPKAVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS++D  SP+ P  I +S +P+ GICYGQQ MC  LGGK ++   REFGRAF+E+ ++C 
Sbjct: 61  ASTVDEGSPRAPDIIFDSGLPVFGICYGQQTMCMQLGGKVESGHHREFGRAFLEVDRDCQ 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  GS+ QVWMSHGD+V  +P+GFEV+A+S + P+AFIADEKRKYY VQFHPEVV
Sbjct: 121 LFEGLWSSGSRHQVWMSHGDRVTALPDGFEVVATSSNAPYAFIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++LI NF+H++AGI+ +W MS+Y ++ V +I+ QVG++RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLIGNFIHNIAGIKGDWSMSAYRQKAVEQIRAQVGDKRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N  L  VDA++RFI +L+ + DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHYNLHLLHVDAADRFIGELEGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFIE FEEEA+K+GGA FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 TKRKIIGRLFIETFEEEARKLGGADFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMEFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|239833572|ref|ZP_04681900.1| GMP synthase, C-terminal domain-containing protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239821635|gb|EEQ93204.1| GMP synthase, C-terminal domain-containing protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 523

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/511 (66%), Positives = 418/511 (81%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP S+ DI SP
Sbjct: 13  ILIIDFGSQVTQLIARRVREANVYCEIVPFQSAEEAFKRLKPKGVILSGSPHSTTDIGSP 72

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+ + E+ IP+LGICYG+Q +C  LGGK ++   REFGRAF++++++  L +G+W KG
Sbjct: 73  RAPQAVFEAGIPVLGICYGEQTICAQLGGKVESGHDREFGRAFLDVQEDSPLFEGIWAKG 132

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++ QVWMSHGD+V  +P+GF +I +S + PFA IADEKRKYY VQFHPEVVHT  G++L+
Sbjct: 133 TRHQVWMSHGDRVTSLPDGFTIIGTSPNAPFAAIADEKRKYYGVQFHPEVVHTPDGAKLL 192

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA L +EAIG  
Sbjct: 193 QNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAALLAHEAIGDQ 252

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRKNE + ++ +F+ + N PL +VDAS+RFI +L+   DPE KRK IG+L
Sbjct: 253 LTCILVDHGLMRKNEAQQVVEMFREHYNLPLILVDASDRFIGELEGETDPEKKRKTIGRL 312

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M M+LVE
Sbjct: 313 FIEVFEEEAKKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVE 372

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G IT E++ ILRE+DAIY +E
Sbjct: 373 PLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILREADAIYLDE 432

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFYH+DMNFL 
Sbjct: 433 IRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDMNFLG 492

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 493 NAATRIINEVRGINRVVYDVTSKPPGTIEWE 523


>gi|153010381|ref|YP_001371595.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Ochrobactrum anthropi ATCC 49188]
 gi|151562269|gb|ABS15766.1| GMP synthase, large subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 523

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/520 (65%), Positives = 417/520 (80%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 4   MSTTAHPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSAEEAFKRLKPKGVILSGSP 63

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI +P+ P+ + E  IP+LGICYG+Q MC  LGGK ++   REFGRAF++++++  
Sbjct: 64  HSTTDIGAPRAPQAVFEEGIPVLGICYGEQTMCAQLGGKVESGHDREFGRAFLDVQEDSP 123

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W KG++ QVWMSHGD+V  +P+GF +I +S + PFA IADEKRKYY VQFHPEVV
Sbjct: 124 LFEGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPFAAIADEKRKYYGVQFHPEVV 183

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA 
Sbjct: 184 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL 243

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EAIG  LTC+LVDHG MRKNE   ++ +F+ + N PL +VDA++RFI +L+   DPE
Sbjct: 244 LAHEAIGDQLTCILVDHGLMRKNEANQVVEMFREHYNLPLILVDAADRFIGELEGETDPE 303

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 304 KKRKTIGRLFIEVFEEEAKKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 363

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 364 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGITREKLEILR 423

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 424 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 483

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 484 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 523


>gi|254473501|ref|ZP_05086898.1| GMP synthase - glutamine amidotransferase protein [Pseudovibrio sp.
           JE062]
 gi|211957617|gb|EEA92820.1| GMP synthase - glutamine amidotransferase protein [Pseudovibrio sp.
           JE062]
          Length = 515

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/514 (65%), Positives = 419/514 (81%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + ++LIIDFGSQ TQLIARRVRES VY E++ F++A   FKE NP+A+ILSG PAS+ ++
Sbjct: 2   TDRILIIDFGSQVTQLIARRVRESGVYSEIVPFQSAEAAFKEMNPKAVILSGGPASTTEM 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P+ + E+ IP+LGICYGQQ MC  LGG+   S  +EFGRAF+ ++K+ +L +G W
Sbjct: 62  GSPRAPQIVFEAGIPVLGICYGQQTMCAQLGGEVATSDHKEFGRAFVSVEKSSALFEGCW 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E+GSK QVWMSHGD+V  +PEGFEVI +S+  PFA IADEKR +YAVQFHPEVVHT  G+
Sbjct: 122 EQGSKHQVWMSHGDRVVSLPEGFEVIGTSEGAPFAAIADEKRHFYAVQFHPEVVHTPDGA 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +LI+NF H +AG   +W M+ Y ++ +  I++QVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 182 KLIENFTHKIAGCSGDWTMAEYRQQAIQAIRDQVGDKKVICGLSGGVDSSVAAVLIHEAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VDHG MR  E E ++S+F+ + N PL  VDAS+ FI +L+   DPE KRK I
Sbjct: 242 GDQLTCIYVDHGLMRMGETEQVLSMFRDHYNIPLVHVDASDLFIGQLEGESDPEVKRKTI 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+
Sbjct: 302 GKLFIEVFEEEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMQ 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC G IT E+++ILR++DAIY
Sbjct: 362 LVEPLRELFKDEVRDLGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLDILRQADAIY 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFYH+DM 
Sbjct: 422 LDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDME 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 482 FLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 515


>gi|306840809|ref|ZP_07473556.1| GMP synthase [Brucella sp. BO2]
 gi|306289204|gb|EFM60453.1| GMP synthase [Brucella sp. BO2]
          Length = 520

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/520 (64%), Positives = 416/520 (80%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 1   MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI SP+ P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  
Sbjct: 61  HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W KG++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVV
Sbjct: 121 LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ RVICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGRVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EA+G  LTC+LVDHG MRK+E + ++ +F+ + N PL +VDAS+RFI  L+   DPE
Sbjct: 241 LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|225686194|ref|YP_002734166.1| GMP synthase [Brucella melitensis ATCC 23457]
 gi|256043277|ref|ZP_05446212.1| GMP synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111721|ref|ZP_05452705.1| GMP synthase [Brucella melitensis bv. 3 str. Ether]
 gi|256262678|ref|ZP_05465210.1| GuaA [Brucella melitensis bv. 2 str. 63/9]
 gi|260564483|ref|ZP_05834968.1| GuaA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|265989701|ref|ZP_06102258.1| GMP synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993194|ref|ZP_06105751.1| GMP synthase [Brucella melitensis bv. 3 str. Ether]
 gi|254800089|sp|C0RKS9|GUAA_BRUMB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|225642299|gb|ACO02212.1| GMP synthase, C-terminal domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|260152126|gb|EEW87219.1| GuaA family protein [Brucella melitensis bv. 1 str. 16M]
 gi|262764064|gb|EEZ10096.1| GMP synthase [Brucella melitensis bv. 3 str. Ether]
 gi|263000370|gb|EEZ13060.1| GMP synthase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092464|gb|EEZ16717.1| GuaA [Brucella melitensis bv. 2 str. 63/9]
 gi|326410537|gb|ADZ67601.1| GMP synthase [Brucella melitensis M28]
 gi|326553828|gb|ADZ88467.1| GMP synthase [Brucella melitensis M5-90]
          Length = 520

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/520 (64%), Positives = 417/520 (80%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 1   MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI SP+ P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  
Sbjct: 61  HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W KG++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVV
Sbjct: 121 LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EA+G  LTC+LVDHG MRK+EV+ ++ +F+ + N PL +VDAS+RFI  L+   DPE
Sbjct: 241 LAHEAVGDQLTCILVDHGLMRKDEVQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|148558733|ref|YP_001257376.1| GMP synthase [Brucella ovis ATCC 25840]
 gi|226738395|sp|A5VU71|GUAA_BRUO2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|148370018|gb|ABQ62890.1| GMP synthase [Brucella ovis ATCC 25840]
          Length = 520

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/520 (64%), Positives = 417/520 (80%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 1   MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI SP+ P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  
Sbjct: 61  HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W KG++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVV
Sbjct: 121 LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EA+G  LTC+LVDHG MRK+E + ++ +F+ + N PL +VDAS+RFI  L++  DPE
Sbjct: 241 LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALESESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|62317722|ref|YP_223575.1| GMP synthase [Brucella abortus bv. 1 str. 9-941]
 gi|83269705|ref|YP_418996.1| GMP synthase [Brucella melitensis biovar Abortus 2308]
 gi|163844537|ref|YP_001622192.1| GMP synthase [Brucella suis ATCC 23445]
 gi|189022977|ref|YP_001932718.1| GMP synthase [Brucella abortus S19]
 gi|225628806|ref|ZP_03786840.1| GMP synthase, C-terminal domain-containing protein [Brucella ceti
           str. Cudo]
 gi|237817265|ref|ZP_04596257.1| GMP synthase, C-terminal domain-containing protein [Brucella
           abortus str. 2308 A]
 gi|254691225|ref|ZP_05154479.1| GMP synthase [Brucella abortus bv. 6 str. 870]
 gi|254695471|ref|ZP_05157299.1| GMP synthase [Brucella abortus bv. 3 str. Tulya]
 gi|254699012|ref|ZP_05160840.1| GMP synthase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254699635|ref|ZP_05161463.1| GMP synthase [Brucella suis bv. 5 str. 513]
 gi|254706107|ref|ZP_05167935.1| GMP synthase [Brucella pinnipedialis M163/99/10]
 gi|254711593|ref|ZP_05173404.1| GMP synthase [Brucella pinnipedialis B2/94]
 gi|254712190|ref|ZP_05174001.1| GMP synthase [Brucella ceti M644/93/1]
 gi|254715260|ref|ZP_05177071.1| GMP synthase [Brucella ceti M13/05/1]
 gi|254720561|ref|ZP_05182372.1| GMP synthase [Brucella sp. 83/13]
 gi|254732459|ref|ZP_05191037.1| GMP synthase [Brucella abortus bv. 4 str. 292]
 gi|256015143|ref|YP_003105152.1| GMP synthase [Brucella microti CCM 4915]
 gi|256029771|ref|ZP_05443385.1| GMP synthase [Brucella pinnipedialis M292/94/1]
 gi|256059419|ref|ZP_05449621.1| GMP synthase [Brucella neotomae 5K33]
 gi|256157944|ref|ZP_05455862.1| GMP synthase [Brucella ceti M490/95/1]
 gi|256253097|ref|ZP_05458633.1| GMP synthase [Brucella ceti B1/94]
 gi|256256412|ref|ZP_05461948.1| GMP synthase [Brucella abortus bv. 9 str. C68]
 gi|260167121|ref|ZP_05753932.1| GMP synthase [Brucella sp. F5/99]
 gi|260544963|ref|ZP_05820784.1| GuaA protein [Brucella abortus NCTC 8038]
 gi|260756828|ref|ZP_05869176.1| GMP synthetase [Brucella abortus bv. 6 str. 870]
 gi|260760259|ref|ZP_05872607.1| GMP synthetase [Brucella abortus bv. 4 str. 292]
 gi|260763498|ref|ZP_05875830.1| GMP synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882644|ref|ZP_05894258.1| GMP synthase [Brucella abortus bv. 9 str. C68]
 gi|261215857|ref|ZP_05930138.1| GMP synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|261216986|ref|ZP_05931267.1| GMP synthase [Brucella ceti M13/05/1]
 gi|261220200|ref|ZP_05934481.1| GMP synthase [Brucella ceti B1/94]
 gi|261313545|ref|ZP_05952742.1| GMP synthase [Brucella pinnipedialis M163/99/10]
 gi|261319216|ref|ZP_05958413.1| GMP synthase [Brucella pinnipedialis B2/94]
 gi|261319856|ref|ZP_05959053.1| GMP synthase [Brucella ceti M644/93/1]
 gi|261323385|ref|ZP_05962582.1| GMP synthase [Brucella neotomae 5K33]
 gi|261750099|ref|ZP_05993808.1| GMP synthase [Brucella suis bv. 5 str. 513]
 gi|261756521|ref|ZP_06000230.1| bifunctional GMP synthase/glutamine amidotransferase [Brucella sp.
           F5/99]
 gi|265985594|ref|ZP_06098329.1| GMP synthase [Brucella sp. 83/13]
 gi|265986783|ref|ZP_06099340.1| GMP synthase [Brucella pinnipedialis M292/94/1]
 gi|265996453|ref|ZP_06109010.1| GMP synthase [Brucella ceti M490/95/1]
 gi|294853356|ref|ZP_06794028.1| GMP synthase [Brucella sp. NVSL 07-0026]
 gi|297249772|ref|ZP_06933473.1| guaA, GMP synthase [Brucella abortus bv. 5 str. B3196]
 gi|306838072|ref|ZP_07470929.1| GMP synthase [Brucella sp. NF 2653]
 gi|306845655|ref|ZP_07478224.1| GMP synthase [Brucella sp. BO1]
 gi|75495459|sp|Q577H0|GUAA_BRUAB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|91206796|sp|Q2YK38|GUAA_BRUA2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738393|sp|B2SBN5|GUAA_BRUA1 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738396|sp|A9WY54|GUAA_BRUSI RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|62197915|gb|AAX76214.1| GuaA, GMP synthase [Brucella abortus bv. 1 str. 9-941]
 gi|82939979|emb|CAJ13008.1| Glutamine amidotransferase class-I:Carbamoyl-phosphate synthase,
           GATase domain:GMP synthase, C terminal:GMP synthase,
           N-termi [Brucella melitensis biovar Abortus 2308]
 gi|163675260|gb|ABY39370.1| GMP synthase, C-terminal domain [Brucella suis ATCC 23445]
 gi|189021551|gb|ACD74272.1| GuaA, GMP synthase [Brucella abortus S19]
 gi|225616652|gb|EEH13700.1| GMP synthase, C-terminal domain-containing protein [Brucella ceti
           str. Cudo]
 gi|237788078|gb|EEP62294.1| GMP synthase, C-terminal domain-containing protein [Brucella
           abortus str. 2308 A]
 gi|255997803|gb|ACU49490.1| GMP synthase [Brucella microti CCM 4915]
 gi|260098234|gb|EEW82108.1| GuaA protein [Brucella abortus NCTC 8038]
 gi|260670577|gb|EEX57517.1| GMP synthetase [Brucella abortus bv. 4 str. 292]
 gi|260673919|gb|EEX60740.1| GMP synthetase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676936|gb|EEX63757.1| GMP synthetase [Brucella abortus bv. 6 str. 870]
 gi|260872172|gb|EEX79241.1| GMP synthase [Brucella abortus bv. 9 str. C68]
 gi|260917464|gb|EEX84325.1| GMP synthetase [Brucella abortus bv. 3 str. Tulya]
 gi|260918784|gb|EEX85437.1| GMP synthase [Brucella ceti B1/94]
 gi|260922075|gb|EEX88643.1| GMP synthase [Brucella ceti M13/05/1]
 gi|261292546|gb|EEX96042.1| GMP synthase [Brucella ceti M644/93/1]
 gi|261298439|gb|EEY01936.1| GMP synthase [Brucella pinnipedialis B2/94]
 gi|261299365|gb|EEY02862.1| GMP synthase [Brucella neotomae 5K33]
 gi|261302571|gb|EEY06068.1| GMP synthase [Brucella pinnipedialis M163/99/10]
 gi|261736505|gb|EEY24501.1| bifunctional GMP synthase/glutamine amidotransferase [Brucella sp.
           F5/99]
 gi|261739852|gb|EEY27778.1| GMP synthase [Brucella suis bv. 5 str. 513]
 gi|262550750|gb|EEZ06911.1| GMP synthase [Brucella ceti M490/95/1]
 gi|264658980|gb|EEZ29241.1| GMP synthase [Brucella pinnipedialis M292/94/1]
 gi|264664186|gb|EEZ34447.1| GMP synthase [Brucella sp. 83/13]
 gi|294819011|gb|EFG36011.1| GMP synthase [Brucella sp. NVSL 07-0026]
 gi|297173641|gb|EFH33005.1| guaA, GMP synthase [Brucella abortus bv. 5 str. B3196]
 gi|306273976|gb|EFM55803.1| GMP synthase [Brucella sp. BO1]
 gi|306406809|gb|EFM63031.1| GMP synthase [Brucella sp. NF 2653]
          Length = 520

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/520 (64%), Positives = 416/520 (80%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 1   MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI SP+ P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  
Sbjct: 61  HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W KG++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVV
Sbjct: 121 LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EA+G  LTC+LVDHG MRK+E + ++ +F+ + N PL +VDAS+RFI  L+   DPE
Sbjct: 241 LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T E++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|110632855|ref|YP_673063.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Mesorhizobium sp. BNC1]
 gi|110283839|gb|ABG61898.1| GMP synthase (glutamine-hydrolyzing) [Chelativorans sp. BNC1]
          Length = 519

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/511 (65%), Positives = 416/511 (81%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVRE+ VY E+  F++A + +    P+A+ILSGSPAS+++IDSP
Sbjct: 9   VLIIDFGSQVTQLIARRVREAGVYSEIAPFQSAEEAYLRLKPKAVILSGSPASTVEIDSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P  I +S +P+LGICYG+Q MC  LGGK ++S  REFGRAF+EI+++C L  G+W  G
Sbjct: 69  RAPDVIFQSGVPVLGICYGEQTMCAQLGGKVESSDHREFGRAFLEIEEDCGLFAGIWAPG 128

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++ QVWMSHGD+V  +P GF+V+ +S   PFA IAD+KRKYY VQFHPEVVHT  G++L+
Sbjct: 129 TRHQVWMSHGDRVTALPPGFKVVGTSAGAPFAAIADDKRKYYGVQFHPEVVHTPDGAKLL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH +AG++ +W M++Y ++ V  I+ QVG+ +VICA+SGGVDS+VAA L +EA+G  
Sbjct: 189 ANFVHRIAGLKGDWTMAAYREQAVDAIRAQVGSGKVICALSGGVDSSVAALLTHEAVGEQ 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRKNE   ++S+F+ + N PL +VDAS+RF+  L+   DPE KRK IG+L
Sbjct: 249 LTCILVDHGLMRKNEAAEVVSMFREHYNVPLVLVDASDRFLSALEGETDPEKKRKTIGRL 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFE+EAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 309 FIEVFEDEAKKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVE 368

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR+LG++L LPD F+ RHP PGPGLAIRC G IT E++ ILR +DAIY +E
Sbjct: 369 PLRELFKDEVRVLGRKLGLPDHFIGRHPFPGPGLAIRCPGGITREKLEILRAADAIYLDE 428

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I K+G+Y  IWQAF VLLPVQTVGVMGD RTYEYVC+LRAVTS+DGMTADFYH DM FL 
Sbjct: 429 IRKSGLYDAIWQAFAVLLPVQTVGVMGDGRTYEYVCALRAVTSVDGMTADFYHFDMEFLG 488

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 489 RAATRIINEVRGINRVVYDVTSKPPGTIEWE 519


>gi|23500114|ref|NP_699554.1| GMP synthase [Brucella suis 1330]
 gi|161620433|ref|YP_001594319.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Brucella canis ATCC 23365]
 gi|254702758|ref|ZP_05164586.1| GMP synthase [Brucella suis bv. 3 str. 686]
 gi|260568335|ref|ZP_05838804.1| GMP synthase [Brucella suis bv. 4 str. 40]
 gi|261753353|ref|ZP_05997062.1| GMP synthase [Brucella suis bv. 3 str. 686]
 gi|38257625|sp|Q8FWT4|GUAA_BRUSU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738394|sp|A9MEB0|GUAA_BRUC2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|23463708|gb|AAN33559.1| GMP synthase [Brucella suis 1330]
 gi|161337244|gb|ABX63548.1| GMP synthase, C-terminal domain [Brucella canis ATCC 23365]
 gi|260155000|gb|EEW90081.1| GMP synthase [Brucella suis bv. 4 str. 40]
 gi|261743106|gb|EEY31032.1| GMP synthase [Brucella suis bv. 3 str. 686]
          Length = 520

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/520 (64%), Positives = 415/520 (79%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP
Sbjct: 1   MSTTAYPDTILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ DI SP+ P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  
Sbjct: 61  HSTTDIGSPRAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+W KG++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVV
Sbjct: 121 LFAGIWAKGTRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGAKLLQNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L +EA+G  LTC+LVDHG MRK+E + ++ +F+ + N PL +VDAS+RFI  L+   DPE
Sbjct: 241 LAHEAVGDQLTCILVDHGLMRKDEAQQVVEMFREHYNLPLILVDASDRFIGALEGESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M M+LVEPL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T  ++ ILR
Sbjct: 361 ERMKMQLVEPLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTRGKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DMNFL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMNFLGNAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|260462692|ref|ZP_05810898.1| GMP synthase, large subunit [Mesorhizobium opportunistum WSM2075]
 gi|259031598|gb|EEW32868.1| GMP synthase, large subunit [Mesorhizobium opportunistum WSM2075]
          Length = 520

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/520 (63%), Positives = 413/520 (79%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        VLI+DFGSQFTQLIARR+RE+ V+ E++ F++A   FK  NP+A+ILSG P
Sbjct: 1   MKTANHPDTVLIVDFGSQFTQLIARRIREAGVFSEIVPFQSAEAAFKRINPKAVILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+ DI SP+ P+ + ++ +P+LGICYGQ  MC  +GG  ++S  REFGRAF+EI+K+  
Sbjct: 61  ASTSDIGSPRAPQIVFDAGVPVLGICYGQMAMCVQMGGVAESSNHREFGRAFVEIEKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  G + QVWMSHGD+V  +P GFEV   S+S+PFA   + +R+ Y + FHPEVV
Sbjct: 121 LFEGLWATGQRHQVWMSHGDRVIALPPGFEVFGKSESSPFAIFGNVERRMYGIMFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH++AGI+ +W M +Y +  V  I++QVG  +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGARLLRNFVHNIAGIEGDWTMRAYREHAVETIRKQVGKGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N PL +VDASE+FI  L+  VDPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFRQHYNLPLILVDASEKFISALEGEVDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR LGKEL LP+SF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRALGKELGLPESFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMAFLGAAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|13475784|ref|NP_107351.1| GMP synthase [Mesorhizobium loti MAFF303099]
 gi|21263677|sp|Q987R3|GUAA_RHILO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|14026540|dbj|BAB53137.1| GMP synthetase [Mesorhizobium loti MAFF303099]
          Length = 520

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/520 (63%), Positives = 413/520 (79%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        VLI+DFGSQFTQLIARR+RE+ V+ E++ F++A   FK  NP+A+ILSG P
Sbjct: 1   MKTANHPDTVLIVDFGSQFTQLIARRIREAGVFSEIVPFQSAEAAFKRINPKAVILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+ DI SP+ P+ + ++ +P+LGICYGQ  MC  +GG  ++S  REFGRAF+EI+K+  
Sbjct: 61  ASTSDIGSPRAPQIVFDAGVPVLGICYGQMAMCVQMGGVAESSNHREFGRAFVEIEKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  G + QVWMSHGD+V  +P GF+V   S+S+PFA   + +RK Y + FHPEVV
Sbjct: 121 LFEGLWATGQRHQVWMSHGDRVIALPPGFQVFGKSESSPFAIFGNVERKMYGIMFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH++AGI+ +W M +Y +  V  I++QVG  +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGARLLRNFVHNIAGIEGDWTMRAYREHAVEAIRKQVGKGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N PL +VDASE+FI  L+  VDPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFRQHYNLPLILVDASEKFISALEGEVDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+M+LVEPL+ELFKDEVR LGKEL LP+SF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ERMNMQLVEPLRELFKDEVRALGKELGLPESFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMAFLGAAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|319407593|emb|CBI81243.1| GMP synthase [Bartonella sp. 1-1C]
          Length = 518

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/515 (65%), Positives = 415/515 (80%), Gaps = 1/515 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           RS  +LIIDFGSQ TQLIARRVRE  VY E+I F++AL+ FK   PQA+ILSGSP S++D
Sbjct: 5   RSDTILIIDFGSQVTQLIARRVREIGVYSEIIPFQSALEGFKRIEPQAVILSGSPYSTVD 64

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             SP++P EI  + IP+LGICYG+Q+MC  LGGK +    REFGRA ++IK+  +L  G+
Sbjct: 65  DGSPRVPMEIFNAGIPILGICYGEQVMCVQLGGKVERGHEREFGRALLDIKEESALFDGV 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           WEKGS  QVWMSHGD+V  +PEGF VI +S   P+A IADEKR++YAVQFHPEVVHT  G
Sbjct: 125 WEKGSCHQVWMSHGDRVVALPEGFHVIGASQGAPYAAIADEKRRFYAVQFHPEVVHTTDG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L+ NFVH ++G++ NW M++Y ++ V+ I+E+VG   VIC +SGGVDS+VAA L++EA
Sbjct: 185 AKLLKNFVHKISGLKSNWSMAAYREQAVAAIREKVGKSHVICGLSGGVDSSVAAILLHEA 244

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           +G  LTCV VDHG MRKNE E +++LF+G+ N  L  V+A++ FI  L+   DPE KRK+
Sbjct: 245 VGDQLTCVFVDHGLMRKNEAEEVLTLFRGHYNIKLIHVNAADMFINALEGETDPEKKRKI 304

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFIEVFEEE KKIGGA+FL QGTLYPDVIES+S   G +  IKSHHNVGGLPE M M
Sbjct: 305 IGRLFIEVFEEETKKIGGAEFLAQGTLYPDVIESVSAI-GEAVTIKSHHNVGGLPEQMKM 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +LVEPL+ELFKD+VR LG+EL LP+ F+ RHP PGPGLAIRC G IT E++ ILRE+DAI
Sbjct: 364 QLVEPLRELFKDDVRSLGRELGLPEQFIRRHPFPGPGLAIRCPGAITREKLEILREADAI 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y +EI KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY ++M
Sbjct: 424 YLDEIRKAGLYDQIWQAFAVLLPVQTVGVMGDARTYEFVCALRAVTSVDGMTADFYPYNM 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FLS+VA RI+NEV+GINRVVYDITSKPP TIEWE
Sbjct: 484 EFLSKVATRIINEVEGINRVVYDITSKPPGTIEWE 518


>gi|319404602|emb|CBI78208.1| GMP synthase [Bartonella rochalimae ATCC BAA-1498]
          Length = 518

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/515 (65%), Positives = 414/515 (80%), Gaps = 1/515 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           RS  +LIIDFGSQ TQLIARRVRE  VY E++ F++AL+ FK   PQA+ILSGSP S++D
Sbjct: 5   RSDTILIIDFGSQVTQLIARRVREIGVYSEIVPFQSALEGFKRIEPQAVILSGSPYSTVD 64

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             SP++P EI  + IP+LGICYG+Q+MC  LGGK +    REFGRA ++IK+   L  G+
Sbjct: 65  DGSPRVPMEIFNAGIPILGICYGEQVMCVQLGGKVERGHEREFGRALLDIKEESVLFDGV 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           WEKGS  QVWMSHGD+V  +PEGF VI +S   P+A IADEKR++YAVQFHPEVVHT  G
Sbjct: 125 WEKGSCHQVWMSHGDRVVALPEGFHVIGASQGAPYAAIADEKRRFYAVQFHPEVVHTTDG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L+ NFVH ++G++ NW M++Y ++ V+ I+E+VG   VIC +SGGVDS+VAA L++EA
Sbjct: 185 AKLLKNFVHKISGLKSNWSMATYREQAVTAIREKVGKSHVICGLSGGVDSSVAAILLHEA 244

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           +G  LTCV VDHG MRKNEVE +++LF+G+ N  L  V+A++ FI  L+   DPE KRK+
Sbjct: 245 VGDQLTCVFVDHGLMRKNEVEEVLTLFRGHYNIKLIHVNAADMFINALEGETDPEKKRKI 304

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFIEVFEEE KKI GA+FL QGTLYPDVIES+S   G +  IKSHHNVGGLPE M M
Sbjct: 305 IGRLFIEVFEEETKKIRGAEFLAQGTLYPDVIESVSAI-GEAVTIKSHHNVGGLPERMKM 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +LVEPL+ELFKD+VR LG+EL LP+ F+ RHP PGPGLAIRC G IT E++ ILRE+DAI
Sbjct: 364 QLVEPLRELFKDDVRSLGRELGLPEQFIGRHPFPGPGLAIRCPGAITREKLEILREADAI 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y +EI KAG+Y KIWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DM
Sbjct: 424 YLDEIRKAGLYDKIWQAFAVLLPVQTVGVMGDARTYEFVCALRAVTSVDGMTADFYPYDM 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FLS+VA RI+NEV+GINRVVYDITSKPP TIEWE
Sbjct: 484 EFLSKVATRIINEVEGINRVVYDITSKPPGTIEWE 518


>gi|328544048|ref|YP_004304157.1| GMP synthase-glutamine amidotransferase protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413792|gb|ADZ70855.1| GMP synthase-glutamine amidotransferase protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 515

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/514 (63%), Positives = 405/514 (78%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +  +LIIDFGSQ TQLIARRVRE+ VY E++ F++A   F+   P+ +ILSG PAS LD 
Sbjct: 2   TDSILIIDFGSQVTQLIARRVREAGVYSEIVPFQSAEAAFERMRPKGVILSGGPASVLDQ 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            +P  P  +  + +P+LGICYG+Q+M   LGG+ +    REFGRAF+E+ + C+L +G+W
Sbjct: 62  SAPLAPMSVFAAGVPVLGICYGEQVMAHQLGGRVEGEHHREFGRAFVEVTRPCALTEGVW 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E GS+ QVWMSHGD+V  +P+GFEV+A S++ P+A IADE R++YA QFH EVVHT  G+
Sbjct: 122 EAGSRHQVWMSHGDRVTALPDGFEVVAVSENAPYAMIADEARRFYATQFHMEVVHTPDGA 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NFVH +AG   +W M+ +  + ++RI+ QVG+ RVIC +SGGVDS+VAA LI+EAI
Sbjct: 182 KLLSNFVHKIAGCAGDWTMAHFRTDAIARIRAQVGSGRVICGLSGGVDSSVAAVLIHEAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VDHG MRK E + ++SLF+G+ N PL  VDA++ FI  L+   DPE KRK I
Sbjct: 242 GDQLTCIFVDHGLMRKGEAKEVVSLFRGHYNIPLVHVDAADTFIDALEGESDPEVKRKTI 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVFE EA K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M MK
Sbjct: 302 GRLFIEVFEAEATKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKMK 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LPD+FV RHP PGPGLAIRC G +T +++ ILRE+DAIY
Sbjct: 362 LVEPLRELFKDEVRALGRELGLPDAFVGRHPFPGPGLAIRCPGGVTRDKLKILREADAIY 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y  IWQAF+VLLPVQTVGVMGD RTYEYV +LRAVTS+DGMTADFYH DM 
Sbjct: 422 LDEIRKAGLYDAIWQAFSVLLPVQTVGVMGDGRTYEYVLALRAVTSVDGMTADFYHFDME 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 482 FLGRAATRIINEVKGVNRVVYDVTSKPPGTIEWE 515


>gi|90418687|ref|ZP_01226598.1| GMP synthase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336767|gb|EAS50472.1| GMP synthase [Aurantimonas manganoxydans SI85-9A1]
          Length = 518

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/511 (63%), Positives = 406/511 (79%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLI+DFGSQ TQLIARR+RE+ VY E++ F++A + F+  +P+A+ILSGSPAS  D D+P
Sbjct: 8   VLIVDFGSQVTQLIARRIREAGVYSEIVPFQSAAEGFRRLSPKAVILSGSPASVTDTDAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
             P EILE+ +P+LGICYGQQ MC  LGG  +    REFGR+F+E+KK   L +G+W +G
Sbjct: 68  TAPMEILEAGVPVLGICYGQQTMCAQLGGNIEGGLHREFGRSFMEVKKASPLFEGIWAEG 127

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++ QVWMSHGD+V  +PEGFE+I  S   PFA IADE R++Y VQFHPEVVHT  G++L+
Sbjct: 128 TRHQVWMSHGDRVTALPEGFEIIGQSSGAPFAAIADEARRFYGVQFHPEVVHTPDGARLL 187

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH +AG+  +W M+++ ++ V  I+ +VG+ +VIC +SGGVDS+VAA LI+EAIG  
Sbjct: 188 SNFVHRIAGLSGDWTMAAFREQAVEEIRAKVGDGKVICGLSGGVDSSVAAVLIHEAIGDQ 247

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +R NE + ++++F+ + N PL  V A + FI  L+  +DPE KRK IG+L
Sbjct: 248 LTCIFVDHGLLRMNEADEVVAMFRDHYNIPLVHVQAQDTFIDALEGEMDPEVKRKTIGRL 307

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIE FE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+LVE
Sbjct: 308 FIETFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMQLVE 367

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVRLLG EL LP  FV R P PGPGLAIRC G +T E+++ILR++DAIY +E
Sbjct: 368 PLRELFKDEVRLLGHELGLPAHFVGRQPFPGPGLAIRCPGGVTREKLDILRQADAIYLDE 427

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFYH+DM+FL 
Sbjct: 428 IRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYHYDMDFLG 487

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 488 NTATRIINEVRGINRVVYDVTSKPPGTIEWE 518


>gi|319782264|ref|YP_004141740.1| GMP synthase, large subunit [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317168152|gb|ADV11690.1| GMP synthase, large subunit [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 520

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/520 (63%), Positives = 412/520 (79%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        VLI+DFGSQFTQLIARR+RE+ V+ E++ F++A   FK  NP+A+ILSG P
Sbjct: 1   MKTANHPDTVLIVDFGSQFTQLIARRIREAGVFSEIVPFQSAEAAFKRINPKAVILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS+ DI SP+ P+ + ++ +P+LGICYGQ  MC  +GG  ++S  REFGRAF+EI+K+  
Sbjct: 61  ASTGDIGSPRAPQIVFDAGVPVLGICYGQMAMCVQMGGVAESSDHREFGRAFVEIQKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W  G + QVWMSHGD+V  +P+GFEV   S+ +PFA   + +RK Y + FHPEVV
Sbjct: 121 LFEGLWAPGQRHQVWMSHGDRVISLPDGFEVFGKSEGSPFAIFGNIERKMYGIMFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NFVH++AGI+ +W M +Y +  V  I++QVG  +VICA+SGGVDS+VAA 
Sbjct: 181 HTPDGARLLRNFVHNIAGIEGDWTMRAYREHAVEAIRKQVGKGKVICALSGGVDSSVAAL 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EA+G  LTC+LVDHG MRK+E   ++++F+ + N PL +V+AS+RFI  L+   DPE
Sbjct: 241 LIHEAVGDQLTCILVDHGLMRKDEAAGVVAMFREHYNLPLILVNASDRFIDALEGESDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEAKK+GGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 301 KKRKTIGRLFIEVFEEEAKKLGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
             M+M+LVEPL+ELFKDEVR LGKEL LP+SF+ RHP PGPGLAIRC G IT E++ ILR
Sbjct: 361 ARMNMQLVEPLRELFKDEVRALGKELGLPESFIGRHPFPGPGLAIRCPGGITREKLEILR 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 421 EADAIYLDEIRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           YH+DM FL   A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 YHYDMAFLGAAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|163867477|ref|YP_001608676.1| GMP synthase [Bartonella tribocorum CIP 105476]
 gi|161017123|emb|CAK00681.1| GMP synthase [Bartonella tribocorum CIP 105476]
          Length = 530

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/511 (65%), Positives = 411/511 (80%), Gaps = 1/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVR   VYCE++ F+ AL+  +  NPQAIILSGSP S +D  SP
Sbjct: 21  VLIIDFGSQVTQLIARRVRAMGVYCEIVPFQLALEAVRRINPQAIILSGSPYSVIDEGSP 80

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P EI E+ IP+LGICYG+Q+MC  LGGK +    REFGRAF+EI++  +L  G+WEKG
Sbjct: 81  RAPMEIFEAGIPILGICYGEQVMCVQLGGKVEAGHEREFGRAFLEIQEESALFDGVWEKG 140

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S  QVWMSHGD+V  +PEGF VI +S   P+A IADEKR++YAVQFHPEV+HT  G++L+
Sbjct: 141 SHYQVWMSHGDRVASLPEGFRVIGTSKGAPYAAIADEKRRFYAVQFHPEVIHTPDGTKLL 200

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+H ++ I+ NW M+SY ++ ++ I+++VG  RVIC +SGGVDS+V A L++EAIG  
Sbjct: 201 QNFIHRISAIKGNWSMASYREQAIATIRQKVGKNRVICGLSGGVDSSVVAVLLHEAIGDQ 260

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRKNE + +++LF+ + N  L  V+A++ F+  L+   DPE KRK IG+L
Sbjct: 261 LTCILVDHGLMRKNEAQEVLTLFRDHYNIELIHVNAADIFLNALEGETDPEKKRKTIGRL 320

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEE KKIGGA+FL QGTLYPDVIES+S   G S  IKSHHNVGGLPE M+MKLVE
Sbjct: 321 FIEVFEEETKKIGGAEFLAQGTLYPDVIESVSAI-GESVTIKSHHNVGGLPEQMNMKLVE 379

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVRLLG+EL LP+ F+ RHP PGPGLAIRC G +T E++ ILRE+D+IY EE
Sbjct: 380 PLRELFKDEVRLLGRELGLPEQFIGRHPFPGPGLAIRCPGAVTREKLEILREADSIYLEE 439

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DM FLS
Sbjct: 440 IRKAGLYDEIWQAFAVLLPVQTVGVMGDSRTYEFVCALRAVTSVDGMTADFYPYDMAFLS 499

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 500 KTASRIINEVRGINRVVYDVTSKPPGTIEWE 530


>gi|319406107|emb|CBI79737.1| GMP synthase [Bartonella sp. AR 15-3]
          Length = 518

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/515 (64%), Positives = 416/515 (80%), Gaps = 1/515 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           RS  +LIIDFGSQ TQLIARRVRE  VY  ++ F++AL+ FK   PQA+ILSGSP S++D
Sbjct: 5   RSDTILIIDFGSQVTQLIARRVREIGVYSTIVPFQSALEEFKRIKPQAVILSGSPYSAVD 64

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
            D+P++P EI  ++IP+LGICYG+QIMC  LGGK +    REFGRA ++IK+  +L  G+
Sbjct: 65  DDAPRVPMEIFNADIPVLGICYGEQIMCVQLGGKVEAGHEREFGRALLDIKEESALFDGV 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W+KGS  QVWMSHGD+V  +PEGF VI +S   P+A IADEKR++YAVQFHPEVVHT  G
Sbjct: 125 WKKGSCHQVWMSHGDRVVALPEGFHVIGTSQGAPYAAIADEKRRFYAVQFHPEVVHTTDG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L+ NFV+ ++G+++NW M++Y ++ V+ I+++VG   V+C +SGGVDS+V A L++EA
Sbjct: 185 AKLLKNFVYKISGLKNNWSMAAYREQAVAAIRKKVGKSHVVCGLSGGVDSSVVAILLHEA 244

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MRKNE E +++LF+ Y N  L  V+A++ FI  L+   DPE KRK+
Sbjct: 245 IGDQLTCVFVDHGLMRKNEAEEVLTLFREYYNIKLVHVNAADMFINTLEGETDPEKKRKI 304

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFIEVFEEE KKI GA+FL QGTLYPDVIES+S  G P + IKSHHNVGGLPE M M
Sbjct: 305 IGRLFIEVFEEETKKIEGAEFLAQGTLYPDVIESVSAIGEPIT-IKSHHNVGGLPERMKM 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +L+EPL+ELFKD+VR LG+EL LP+ F+ERHP PGPGLAIRC G IT E++ ILRE+DAI
Sbjct: 364 QLIEPLRELFKDDVRSLGRELGLPEQFIERHPFPGPGLAIRCPGAITREKLEILREADAI 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y +EI KAG+Y KIWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTSIDGMTADFY +DM
Sbjct: 424 YLDEIRKAGLYNKIWQAFAVLLPVQTVGVMGDARTYEFVCALRAVTSIDGMTADFYPYDM 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FLS+V+ RI+NEV+GINR+VYDITSKPP TIEWE
Sbjct: 484 EFLSKVSTRIINEVQGINRIVYDITSKPPGTIEWE 518


>gi|49474995|ref|YP_033036.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Bartonella henselae str. Houston-1]
 gi|81648415|sp|Q6G5J3|GUAA_BARHE RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|49237800|emb|CAF26994.1| GMP synthetase [Bartonella henselae str. Houston-1]
          Length = 518

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/514 (64%), Positives = 412/514 (80%), Gaps = 1/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S  VLIIDFGSQ TQLIARRVR   VYCEV+ F+ AL+  +   P+A+ILSGSP S +D 
Sbjct: 6   SDTVLIIDFGSQVTQLIARRVRAMGVYCEVVPFQLALEGMQRIKPKAVILSGSPYSVIDE 65

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P EI E +IP+LGICYGQQIMC  LGGK  +   REFGRAF+E+++N +L +G+W
Sbjct: 66  GSPRAPMEIFEMDIPVLGICYGQQIMCVQLGGKVASGHEREFGRAFLEVQENSALFEGVW 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           EKGS  QVWMSHGD+V  +PEGF VI +S   P+A IADEKR+ YAVQFHPEVVHT+ G+
Sbjct: 126 EKGSCYQVWMSHGDRVTALPEGFRVIGTSKGAPYAAIADEKRRLYAVQFHPEVVHTLDGT 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NFV  ++ ++ NW M+SY ++ +++I+++VG  RVIC +SGGVDS+V A L++EAI
Sbjct: 186 KLLQNFVLKISNLKGNWSMASYREQTIAKIRQKVGKSRVICGLSGGVDSSVVAVLLHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+LVDHG MRKNE + +++LF+ + N  L  V+A+  F+  L+  +DPE KRK I
Sbjct: 246 GDQLTCILVDHGLMRKNEAQEVLTLFRDHYNIKLIHVNAANMFLNALEGEIDPEKKRKTI 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVFEEE KKIGGA+FL QGTLYPDVIESIS   G S  IKSHHNVGGLPE M+MK
Sbjct: 306 GRLFIEVFEEETKKIGGAEFLAQGTLYPDVIESISAI-GKSVTIKSHHNVGGLPERMNMK 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LGKEL LP+ F+ RHP PGPGLAIRC G +T E++ ILRE+DAIY
Sbjct: 365 LVEPLRELFKDEVRSLGKELGLPEQFIGRHPFPGPGLAIRCPGAVTREKLEILREADAIY 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y +IWQAF +LLPVQTVGVMGD RTYE+VC+LRAVTS+DGM+ADFY +DM 
Sbjct: 425 LDEIRKAGLYDEIWQAFAILLPVQTVGVMGDGRTYEFVCALRAVTSVDGMSADFYPYDME 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FLS+ A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 485 FLSKTAARIINEVRGINRVVYDVTSKPPGTIEWE 518


>gi|114706565|ref|ZP_01439466.1| GMP synthetase [Fulvimarina pelagi HTCC2506]
 gi|114537957|gb|EAU41080.1| GMP synthetase [Fulvimarina pelagi HTCC2506]
          Length = 518

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/511 (63%), Positives = 407/511 (79%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLI+DFGSQ TQLIARRVRE+ VY E++ F++A + F++  P+A+ILSGSPAS+ DIDSP
Sbjct: 8   VLIVDFGSQVTQLIARRVREAGVYSEIVPFQSAEESFRKLKPKAVILSGSPASTGDIDSP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+ I +S +P+LGICYGQ  MC  +GGK + S  RE+GRAF+ I+K+C+L K +W  G
Sbjct: 68  KAPQVIFDSGLPVLGICYGQMTMCVQMGGKAEPSDHREYGRAFLNIEKDCALFKDLWPAG 127

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++ QVWMSHGD+V  +P GFE+ A S   P+A   +E+R+ Y + FHPEVVHT  G+QLI
Sbjct: 128 TRHQVWMSHGDRVIQMPPGFEIFAKSPGAPYAVFGNEERRMYGLMFHPEVVHTTDGAQLI 187

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH VAG++ +W M+++  + ++ I+E+VG+ +VIC +SGGVDS+VAA LI+EAIG  
Sbjct: 188 ANFVHKVAGLKGDWTMAAFRDKAIAEIREKVGDGKVICGLSGGVDSSVAAVLIHEAIGDQ 247

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +R NE E ++S+F+ + N PL  V A + F+  L+  +DPE KRK IG+L
Sbjct: 248 LTCIFVDHGLLRLNEAEEVVSMFRDHYNIPLVHVQAEDTFVDALEGEMDPEVKRKTIGRL 307

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIE FE EAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+LVE
Sbjct: 308 FIETFEAEAKKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMQLVE 367

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR+LGKEL LP+SFV R P PGPGLAIRC G IT +++ +LRE+DAIY +E
Sbjct: 368 PLRELFKDEVRILGKELGLPESFVGRQPFPGPGLAIRCPGGITRDKLRVLREADAIYLDE 427

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFYH DM FL 
Sbjct: 428 IRKAGLYDAIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYHFDMEFLG 487

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             A RI+NEVKGINRVVYD+TSKPP TIEWE
Sbjct: 488 NAATRIINEVKGINRVVYDVTSKPPGTIEWE 518


>gi|240849849|ref|YP_002971237.1| GMP synthase [Bartonella grahamii as4aup]
 gi|240266972|gb|ACS50560.1| GMP synthase [Bartonella grahamii as4aup]
          Length = 518

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/511 (64%), Positives = 410/511 (80%), Gaps = 1/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVR   VYCE+  F+ AL+  +  NP+AIILSGSP S +D  SP
Sbjct: 9   VLIIDFGSQVTQLIARRVRAMGVYCEIAPFQLALEAVRRINPKAIILSGSPYSVIDEGSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P EI E+ IP+LGICYG+Q+MC  LGGK +    REFGRAF+E+++  +L  G+WEKG
Sbjct: 69  RAPMEIFEAGIPILGICYGEQVMCVQLGGKVEAGHEREFGRAFLEVQEESALFDGVWEKG 128

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S+ QVWMSHGD+V  +PEGF VI +S+  P+A IADEKR +YAVQFHPEV+HT  G++L+
Sbjct: 129 SRYQVWMSHGDRVAALPEGFRVIGTSNGAPYAAIADEKRHFYAVQFHPEVIHTPDGTKLL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+H ++ I+  W M+SY ++ ++ I+++VG  RVIC +SGGVDS+V A L++EAIG  
Sbjct: 189 QNFIHKISAIKGGWSMASYREQAIATIRQKVGKSRVICGLSGGVDSSVVAVLLHEAIGDQ 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRKNE E +++LF+ + N  L  V+A++ F+  L+   DPE KRK IG+L
Sbjct: 249 LTCILVDHGLMRKNEAEEVLTLFRDHYNIELIHVNAADIFLNALEGETDPEKKRKTIGRL 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEE KKIGGA+FL QGTLYPDVIES+S   G +  IKSHHNVGGLPE M+M+LVE
Sbjct: 309 FIEVFEEETKKIGGAEFLAQGTLYPDVIESVSAI-GKTVTIKSHHNVGGLPEQMNMQLVE 367

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVRLLG+EL LP+ F+ RHP PGPGLAIRC G +T E++ ILRE+DAIY EE
Sbjct: 368 PLRELFKDEVRLLGRELGLPEQFIGRHPFPGPGLAIRCPGTVTREKLEILREADAIYLEE 427

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DM FL 
Sbjct: 428 IRKAGLYNEIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYPYDMAFLG 487

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYD+TSKPP+TIEWE
Sbjct: 488 KTAARIINEVRGINRVVYDVTSKPPSTIEWE 518


>gi|163757570|ref|ZP_02164659.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Hoeflea phototrophica DFL-43]
 gi|162285072|gb|EDQ35354.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Hoeflea phototrophica DFL-43]
          Length = 523

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/511 (63%), Positives = 407/511 (79%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ TQLIARRVRE+ VYCE++ F+ A D F    P+ +I SG P S     SP
Sbjct: 13  ILIIDFGSQVTQLIARRVREAGVYCEIVPFQLADDGFARMKPKGVIFSGGPDSVTREGSP 72

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+ + ES +P+L ICYGQQ +C  +GG+ +    REFGRA +EI K+  L +G+WE G
Sbjct: 73  RAPQAVFESGVPILAICYGQQTLCLQIGGQVEGGHHREFGRADVEILKSSPLFEGIWEVG 132

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K  VWMSHGD+V   PEGFEVI +S + PFA   +E ++YY   FHPEVVHT  G++L+
Sbjct: 133 KKYPVWMSHGDRVTVAPEGFEVIGTSPNAPFAICVNEAKRYYTTMFHPEVVHTPDGAKLL 192

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH + G++ +W M++Y  E+V +I++QVG+ +VICA+SGGVDS+VAA LI+EAIG  
Sbjct: 193 SNFVHKIVGLKSDWSMAAYRAEMVQKIRDQVGSGKVICALSGGVDSSVAALLIHEAIGDQ 252

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L+C+LVDHG MR NE  +++++F+ + N  L++VDAS+RFI +L+   DPETKRK IG+L
Sbjct: 253 LSCILVDHGLMRMNEAADVVAMFREHYNLSLKLVDASDRFISQLEGEADPETKRKTIGRL 312

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+LVE
Sbjct: 313 FIEVFEEEAKKIGGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMQLVE 372

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR+LG+EL LPDSF+ RHP PGPGLAIRC G IT E+++ILR++DAIY +E
Sbjct: 373 PLRELFKDEVRVLGRELGLPDSFIGRHPFPGPGLAIRCPGGITREKLDILRQADAIYLDE 432

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DM+FL 
Sbjct: 433 IRKAGLYDTIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYPYDMDFLG 492

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEVKGINRVVYD+TSKPP TIEWE
Sbjct: 493 KTATRIINEVKGINRVVYDVTSKPPGTIEWE 523


>gi|319899244|ref|YP_004159337.1| GMP synthase [Bartonella clarridgeiae 73]
 gi|319403208|emb|CBI76767.1| GMP synthase [Bartonella clarridgeiae 73]
          Length = 518

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/515 (64%), Positives = 409/515 (79%), Gaps = 1/515 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           RS  VLIIDFGSQ T+LIARRVRE  VY EV+ F+ AL+ F+   PQA+ILSGSP S++D
Sbjct: 5   RSDTVLIIDFGSQVTRLIARRVRELGVYSEVVPFQFALEEFRRIKPQAVILSGSPYSTVD 64

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             SP++P EI  + IP+LGICYG+Q+MC  LGGK +    REFGRA +++KK  +L  G+
Sbjct: 65  DGSPRVPMEIFNAGIPVLGICYGEQVMCIQLGGKVEAGHEREFGRALLDVKKESALFDGV 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           WEKGS  QVWMSHGD V  +PEGF VI +S   P+A IADEKR++YAVQFHPEVVHT  G
Sbjct: 125 WEKGSCHQVWMSHGDCVVALPEGFHVIGTSKGAPYAAIADEKRRFYAVQFHPEVVHTTDG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L+ NFVH ++G++ NW M++Y ++ V+ I+++VG  RVIC +SGGVDS+V A L++EA
Sbjct: 185 AKLLQNFVHKISGLKSNWSMAAYREQAVAAIRKKVGKSRVICGLSGGVDSSVVAVLLHEA 244

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L CV VDHG MRKNE E ++ LF+ + N  L  V+A+  FI  L+  +DPE KRK+
Sbjct: 245 IGDQLICVFVDHGLMRKNEAEEVLKLFRDHYNIKLVHVNAASIFINALEGEIDPEKKRKI 304

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFIEVFEEE KKIGGA+FL QGTLYPDVIES+S   G +  IKSHHNVGGLPE M M
Sbjct: 305 IGRLFIEVFEEETKKIGGAEFLAQGTLYPDVIESVSAI-GEAVTIKSHHNVGGLPERMKM 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +L+EPL+ELFKD+VR LG+EL LP+ F+ RHP PGPGLAIRC G IT E++ ILRE+DAI
Sbjct: 364 ELIEPLRELFKDDVRSLGRELGLPEQFIGRHPFPGPGLAIRCPGAITREKLEILREADAI 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y +EI KAG+Y KIWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTSIDGM+ADFY +DM
Sbjct: 424 YLDEIQKAGLYDKIWQAFAVLLPVQTVGVMGDARTYEFVCALRAVTSIDGMSADFYPYDM 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FLS+ A RI+NEV+GINRVVYDITSKPP TIEWE
Sbjct: 484 EFLSKAATRIINEVRGINRVVYDITSKPPGTIEWE 518


>gi|121602609|ref|YP_988663.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Bartonella bacilliformis KC583]
 gi|226738390|sp|A1URR0|GUAA_BARBK RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|120614786|gb|ABM45387.1| GMP synthase [Bartonella bacilliformis KC583]
          Length = 518

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/514 (64%), Positives = 407/514 (79%), Gaps = 1/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S  VLIIDFGSQ TQLIARRVR   VY E++ F++AL       P+A+ILSGSP S+LD 
Sbjct: 6   SDTVLIIDFGSQVTQLIARRVRAMGVYSEIVPFQSALGGINRIKPKAVILSGSPYSTLDN 65

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P E+ E+ IP+LGICYGQQ+MC  LGGK +    REFGRAF+EIK+  +L  G+W
Sbjct: 66  GSPRAPIEVFEAGIPVLGICYGQQVMCVQLGGKVEAGHEREFGRAFLEIKEESALFDGVW 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           EKGS QQVWMSHGD+V  +PEGF VI +S   P+A I+DEKR +YAVQFHPEVVHT  G 
Sbjct: 126 EKGSSQQVWMSHGDRVTALPEGFCVIGTSKGAPYAAISDEKRNFYAVQFHPEVVHTPDGE 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NFV  ++GI++NW M++Y  + ++ I+E+VG  RVIC +SGGVDS+V A L++EAI
Sbjct: 186 KLLQNFVCKISGIKNNWSMAAYRDQAIAAIREKVGKNRVICGLSGGVDSSVTAVLLHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VDHG +RKNE E ++ LF+   N  L  V+A++ FI  L+   DPE KRK I
Sbjct: 246 GDQLTCIFVDHGLIRKNEAEEVLKLFRDNYNIELIHVNAADMFINALEGETDPEKKRKTI 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVFEEE KKIGGA+FL QGTLYPDVIES+S   G +  IKSHHNVGGLPE M+MK
Sbjct: 306 GRLFIEVFEEETKKIGGAKFLAQGTLYPDVIESVSAI-GEAITIKSHHNVGGLPERMNMK 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKD+VR LG+EL LP+ F++RHP PGPGLAIRC G +T E+I ILRE+DAIY
Sbjct: 365 LVEPLRELFKDDVRSLGRELGLPEEFIKRHPFPGPGLAIRCPGAVTREKIEILREADAIY 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y KIWQAF +LLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY HDM+
Sbjct: 425 LDEIRKAGLYDKIWQAFAILLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYPHDMD 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FLS+ A RI+NEV+GINRVVYDITSKPP TIEWE
Sbjct: 485 FLSRTAARIINEVRGINRVVYDITSKPPGTIEWE 518


>gi|304391249|ref|ZP_07373193.1| GMP synthase [Ahrensia sp. R2A130]
 gi|303296605|gb|EFL90961.1| GMP synthase [Ahrensia sp. R2A130]
          Length = 528

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/512 (63%), Positives = 402/512 (78%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
            VL+IDFGSQ TQLIARRVRES VYCE+  F +A + F+  +P+A+I SG PAS  D DS
Sbjct: 17  SVLVIDFGSQVTQLIARRVRESGVYCEIAPFNSAQEAFERLSPEAVIFSGGPASVTDEDS 76

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +++S +P++ ICYGQQ +C  LGG  +    REFGRA ++IKK   L +G+WE 
Sbjct: 77  PRAPQAVIDSGVPIMAICYGQQTLCTQLGGVVEGGHHREFGRADVDIKKASPLFEGLWEA 136

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G    VWMSHGD+V  +P+GFEV+  S + PFA  ADE RKYY   FHPEVVHT  G++L
Sbjct: 137 GGSYPVWMSHGDRVTELPDGFEVLGQSPNAPFAIAADEARKYYTTMFHPEVVHTPDGAKL 196

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFVH++AG+  +W M++Y  + +  I+ QVG+ +VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 197 IANFVHNIAGLTGDWTMAAYKAQAIEAIRAQVGDGKVICGLSGGVDSSVAALLIHEAIGD 256

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+LVDHG MR +E   ++++F  + +  L  VDA++ FI  L+   DPETKRK IG+
Sbjct: 257 QLTCILVDHGLMRMDEAAQVVAMFNEHYDIKLIHVDAADMFIDALEGESDPETKRKTIGK 316

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFEEEA+KIGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+LV
Sbjct: 317 LFIDVFEEEARKIGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMQLV 376

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG EL LPDSF+ RHP PGPGLAIRC G I+ +++ ILR++DAIY +
Sbjct: 377 EPLRELFKDEVRVLGHELGLPDSFIGRHPFPGPGLAIRCPGGISRDKLEILRKADAIYLD 436

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTSIDGMTADFYH DMNFL
Sbjct: 437 EIRKAGLYDTIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSIDGMTADFYHFDMNFL 496

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 497 GRAATRIINEVQGINRVVYDVTSKPPGTIEWE 528


>gi|319408158|emb|CBI81811.1| GMP synthase [Bartonella schoenbuchensis R1]
          Length = 518

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/514 (64%), Positives = 408/514 (79%), Gaps = 1/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S+ +LIIDFGSQ TQLIARRVR   VY E++ F+ AL+ FK   P+A+ILSGSP S++D 
Sbjct: 6   SNTILIIDFGSQVTQLIARRVRAIGVYSEIVPFQLALEKFKNIKPKAVILSGSPYSTVDD 65

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P EI E+ IP+LGICYG+QIMC  LGGK +    REFGRA +E+K+  +L  G+W
Sbjct: 66  GSPRAPIEIFEAGIPVLGICYGEQIMCVQLGGKVETGHEREFGRASLEVKEESALFDGVW 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           EKGS QQVWMSHGD+V  +PEGF VI +S   P+A IADEKR +YAVQFHPEVVHT  G 
Sbjct: 126 EKGSSQQVWMSHGDRVTALPEGFRVIGTSQGAPYAAIADEKRHFYAVQFHPEVVHTPDGI 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NFV+ + G++ +W M++Y  + ++ I+++VG  RVIC +SGGVDS+V A L++EAI
Sbjct: 186 KLLQNFVYKICGLKSDWSMAAYRDQAIAAIRKKVGKGRVICGLSGGVDSSVTAILLHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VDHG MRKNE E +++LF+   N  L  V+A+ RFI  LK   DPE KRK I
Sbjct: 246 GEQLTCIFVDHGLMRKNEAEEVLTLFRDNYNIKLVHVNAAHRFINALKGETDPEKKRKTI 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVFEEEAKK+GGAQFL QGTLYPDVIESIS   G    IKSHHNVGGLPE M+M+
Sbjct: 306 GRLFIEVFEEEAKKVGGAQFLAQGTLYPDVIESISAV-GDGITIKSHHNVGGLPERMNMQ 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKD+VR LG+EL LP+ F+ RHP PGPGLAIRC G +T E++ ILRE+DAIY
Sbjct: 365 LVEPLRELFKDDVRSLGRELGLPEQFIGRHPFPGPGLAIRCPGGVTPEKLEILREADAIY 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DMN
Sbjct: 425 LDEIRKAGLYDEIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYPYDMN 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +VA RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 485 FLGKVATRIINEVRGINRVVYDVTSKPPGTIEWE 518


>gi|299133665|ref|ZP_07026859.1| GMP synthase, large subunit [Afipia sp. 1NLS2]
 gi|298591501|gb|EFI51702.1| GMP synthase, large subunit [Afipia sp. 1NLS2]
          Length = 531

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/512 (63%), Positives = 398/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A + F+   P+A+ILSG PAS LD D+
Sbjct: 20  KILIVDFGSQVTQLIARRVREDGVYSEIVPFQKAEEAFQAMKPKAVILSGGPASVLDEDA 79

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  I  S +P+LGICYG+Q M Q LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 80  PSAPMSIFTSGVPVLGICYGEQTMAQQLGGTVEAGHHREFGRAAIEITDDCALFDGVWKK 139

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSHGD+V  +PEGF  +A +  +P + IAD+KRK+YA+QFHPEVVHT  G++L
Sbjct: 140 GERHDVWMSHGDRVTKLPEGFRGVAKAAGSPISIIADDKRKFYAMQFHPEVVHTPDGAKL 199

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  VAG++ +W M ++ +E + +I+ QVG  RVIC +SGGVDS VAA LI+EAIG 
Sbjct: 200 IKNFVRKVAGLKGDWTMRAFREEAIEKIRAQVGQGRVICGLSGGVDSAVAAVLIHEAIGD 259

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R  E E ++ LF+ + N PL  VDAS+ F+ +L  + DPE KRK+IG+
Sbjct: 260 QLTCVFVDHGLLRMAEAETVVDLFRHHYNIPLVHVDASKTFLGELAGVTDPEAKRKIIGK 319

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VF+EEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M MKLV
Sbjct: 320 LFIDVFDEEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPARMKMKLV 379

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEIT E+++ILR++DAIY E
Sbjct: 380 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITPEKLDILRQADAIYIE 439

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF VLLPV+TVGVMGD RTYE+V  LRAVTS DGMTADFY  DM FL
Sbjct: 440 EIRRAGLYDTIWQAFAVLLPVKTVGVMGDGRTYEFVVGLRAVTSTDGMTADFYPFDMKFL 499

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++ A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 500 AEAATRIINEVKGVNRVVYDVTSKPPGTIEWE 531


>gi|300022358|ref|YP_003754969.1| GMP synthase, large subunit [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524179|gb|ADJ22648.1| GMP synthase, large subunit [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 515

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/514 (63%), Positives = 401/514 (78%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +  VLIIDFGSQ TQLIARRVRE  VY E+  F+NA + F +  P+A+ILSG PAS  + 
Sbjct: 2   TDSVLIIDFGSQVTQLIARRVREGGVYSEIHPFQNAAEAFAKLKPKAVILSGGPASVTEG 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P+ +  + +P+LGICYGQQ M + LGGK +    REFGRAF+ I     L  G W
Sbjct: 62  GSPRAPEAVFAAGVPVLGICYGQQTMAEQLGGKVEAGHHREFGRAFLSIDTPSPLFDGFW 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G+K QVWMSHGD+V  +P+GF VIA+S++ P+A +ADE R +YAVQFHPEVVHT  G+
Sbjct: 122 SPGTKHQVWMSHGDRVTRLPDGFAVIATSENAPYAAVADEARHFYAVQFHPEVVHTPDGA 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +LI NFVH +AG++ +W M++Y + ++ +++ QVGN RVIC +SGGVDS VAA LI+EAI
Sbjct: 182 KLISNFVHKIAGLKSDWTMAAYRRSMIDKVRAQVGNGRVICGLSGGVDSAVAAVLIHEAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG MR  E + ++ LF+ + N PL  VDASE+F+  L  + DPETKRK I
Sbjct: 242 GDQLTCVFVDHGLMRLGEADEVVGLFRDHYNIPLVHVDASEQFLTALDGVSDPETKRKTI 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+ FI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M MK
Sbjct: 302 GKHFIDVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMHMK 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIR  GEIT E+++ILR++DA+Y
Sbjct: 362 LVEPLRELFKDEVRALGRELGLPEAFVGRHPFPGPGLAIRIPGEITREKLDILRQADAVY 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y  IWQAF VLLPV+TVGVMGD RTY++V  LRAVTS+DGMTADF+H DM 
Sbjct: 422 LDEIRKAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDHVLGLRAVTSVDGMTADFFHFDMA 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +VA RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 482 FLGRVATRIINEVRGVNRVVYDVTSKPPGTIEWE 515


>gi|158425329|ref|YP_001526621.1| GMP synthase [Azorhizobium caulinodans ORS 571]
 gi|158332218|dbj|BAF89703.1| putative GMP synthase [Azorhizobium caulinodans ORS 571]
          Length = 515

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/511 (64%), Positives = 402/511 (78%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVRE  VY EV+ F+ A +      P+A+ILSG PAS ++ +SP
Sbjct: 5   VLIIDFGSQVTQLIARRVREEGVYSEVVPFQKAAEAMDRLKPRAVILSGGPASVIEGESP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+ + E+ IP+LGICYG+Q M   LGGK +    REFGRA +E+ K  +L +G+W++G
Sbjct: 65  RAPQAVFEAGIPVLGICYGEQAMADQLGGKVEAGHHREFGRAEVEVVKPAALFEGVWQEG 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSHGD+V  +P GFEVIA S++ PFA IADE RK+Y VQFHPEVVHT  G+QL+
Sbjct: 125 QRYLVWMSHGDRVTQLPAGFEVIAQSENAPFAAIADESRKFYGVQFHPEVVHTPQGAQLL 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV  VAG+Q +W M ++ +E + +I+ QVG++RV+C +SGGVDS VAA LI+EAIG  
Sbjct: 185 RNFVRKVAGLQGDWTMGAFREESIRKIRAQVGDKRVLCGLSGGVDSAVAAVLIHEAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MR  E E ++SLF+   N PL  VDASE F+++L  + DPE KRK IG+L
Sbjct: 245 LTCVFVDHGLMRLGEAEQVVSLFRNTYNIPLVHVDASELFLKELDGVSDPEKKRKTIGKL 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 305 FIDVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVE 364

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG+EL LP+SFV RHP PGPGLAIRC GEIT E++ ILR++DAIY EE
Sbjct: 365 PLRELFKDEVRALGRELGLPESFVGRHPFPGPGLAIRCPGEITPEKLEILRQADAIYLEE 424

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y  IWQAF VLLPV+TVGVMGD RTY++V +LRAVTSIDGMTADFY   M+FL 
Sbjct: 425 IRAAGLYDVIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSIDGMTADFYPFQMDFLG 484

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 485 RAATRIINEVRGINRVVYDVTSKPPGTIEWE 515


>gi|91976746|ref|YP_569405.1| GMP synthase [Rhodopseudomonas palustris BisB5]
 gi|91683202|gb|ABE39504.1| GMP synthase (glutamine-hydrolyzing) [Rhodopseudomonas palustris
           BisB5]
          Length = 556

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 397/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS L+ D+
Sbjct: 45  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLEADA 104

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P  IL++ +P+LGICYG+Q M   LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 105 PKAPMAILQAGVPVLGICYGEQTMAAQLGGTVEGGHHREFGRATIEITDDCALFDGVWQK 164

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSHGD+V  +PEGF  +A +  +P A IAD+ RK+YA+QFHPEVVHT  G+++
Sbjct: 165 GGQYDVWMSHGDRVTKLPEGFRGVAKAAGSPIAVIADDSRKFYAMQFHPEVVHTPDGAKI 224

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  VAG+  +W M ++ +E V +I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 225 LRNFVRKVAGLTGDWTMRAFREEAVEKIRAQVGQGKVICGLSGGVDSAVAAVLIHEAIGD 284

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E ++++ LF+ + N PL  VDA++ F+  LK + DPE KRK+IG+
Sbjct: 285 QLTCVFVDHGLLRKDEGKSVVDLFRHHYNIPLVHVDAADTFLGALKGVTDPEQKRKIIGK 344

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VF+ EAK +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 345 LFIDVFDAEAKVVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 404

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEIT E++ ILR +DA+Y +
Sbjct: 405 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITAEKLEILRNADAVYID 464

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y  IWQAF VLLPV+TVGVMGD RTYEYV  LRAVTS DGMTADFY  DMNFL
Sbjct: 465 QIRKAGLYDVIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGMTADFYAFDMNFL 524

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 525 GATATRIINEVKGVNRVVYDITSKPPGTIEWE 556


>gi|209885588|ref|YP_002289445.1| glutamine-hydrolyzing GMP synthase [Oligotropha carboxidovorans
           OM5]
 gi|226739651|sp|B6JHM4|GUAA_OLICO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|209873784|gb|ACI93580.1| glutamine-hydrolyzing GMP synthase [Oligotropha carboxidovorans
           OM5]
          Length = 531

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/512 (63%), Positives = 394/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F    P+A+ILSG PAS L+  +
Sbjct: 20  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEQAFTAMQPKAVILSGGPASVLEAGA 79

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  I  + +P+LGICYG+Q M Q LGG  +    REFGRA IEI  +C+L +G+W+K
Sbjct: 80  PSAPMSIFTAGVPVLGICYGEQTMAQQLGGMVEGGHHREFGRAAIEITDDCALFEGVWKK 139

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSHGD+V  +PEGF  +A +  +P A IAD+ RK+YA+QFHPEVVHT  G++L
Sbjct: 140 GEQHDVWMSHGDRVTKLPEGFRGVARAAGSPIAIIADDTRKFYAMQFHPEVVHTPDGAKL 199

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  VAG++ +W M ++ +E + +I+ QVG  RVIC +SGGVDS VAA LI+EAIG 
Sbjct: 200 IRNFVRKVAGLKGDWTMRAFREEAIEKIRAQVGQGRVICGLSGGVDSAVAAVLIHEAIGD 259

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R  E E ++SLF+ + N PL  VDAS+ F+ +L  + DPE KRK IG+
Sbjct: 260 QLTCVFVDHGLLRMAEAETVVSLFRDHYNIPLVHVDASKTFLGELAGVTDPELKRKTIGR 319

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VF+EEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M MKLV
Sbjct: 320 LFIDVFDEEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPARMKMKLV 379

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEIT E+++ILR++DAIY E
Sbjct: 380 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITPEKLDILRQADAIYIE 439

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF VLLPV+TVGVMGD RTYE+V  LRAVTS DGMTADFY  DM FL
Sbjct: 440 EIRRAGLYDTIWQAFAVLLPVKTVGVMGDGRTYEFVVGLRAVTSTDGMTADFYPFDMRFL 499

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 500 GETATRIINEVKGVNRVVYDVTSKPPGTIEWE 531


>gi|15887630|ref|NP_353311.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Agrobacterium tumefaciens str. C58]
 gi|21759162|sp|Q8UIL2|GUAA_AGRT5 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|15155177|gb|AAK86096.1| GMP synthase [Agrobacterium tumefaciens str. C58]
          Length = 525

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/525 (61%), Positives = 403/525 (76%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      +LIIDFGSQ TQLIARR+RE+ VYCE+  F+NA + F++  P+ +I SG P
Sbjct: 1   MTQIAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEAFEKLQPKGVIFSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS     SP+ P+ + +S +P+LGICYGQQ +C  LGG  +   + EFGRA I+IKK   
Sbjct: 61  ASVTAEGSPRAPQAVFDSKVPILGICYGQQTLCTQLGGVVEGGHAAEFGRADIDIKKASP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G WE+G    VWMSHGD+V  +PEGFEVIA+S++ PFA  ADEKR YY   FHPEVV
Sbjct: 121 LFEGFWEQGKSYPVWMSHGDRVTKLPEGFEVIATSENAPFAIAADEKRHYYTTMFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G +L+ NFVH + G++ +W M++Y  E++ +I+EQVG  RV+CA+SGGVDS+VAA 
Sbjct: 181 HTPDGGKLLSNFVHKIVGLKSDWTMAAYRAEMIRKIREQVGTGRVLCALSGGVDSSVAAI 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG MR  E E ++ +F+ + N PL  VDA++ F+ +L  + DPE
Sbjct: 241 LIHEAIGDQLTCVYVDHGLMRLGESEQVVGMFRDHYNIPLVHVDAADLFLGELSGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
            KRK IG+LFIEVFE EA KI     G  +FL QGTLYPDVIES+SF GGPS  IKSHHN
Sbjct: 301 VKRKTIGRLFIEVFEAEAAKIAADGKGAPKFLAQGTLYPDVIESVSFSGGPSVTIKSHHN 360

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLPE M+M+LVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC G IT E+
Sbjct: 361 VGGLPERMNMQLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGAITREK 420

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
           ++ILR++DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTY++VC+LRAVTS+DG
Sbjct: 421 LDILRKADAIYLDEIRKAGLYDTIWQAFAVLLPVQTVGVMGDYRTYDFVCALRAVTSVDG 480

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTADFY +DMNFL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 MTADFYPYDMNFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 525


>gi|85715675|ref|ZP_01046655.1| GMP synthase [Nitrobacter sp. Nb-311A]
 gi|85697614|gb|EAQ35491.1| GMP synthase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/512 (63%), Positives = 397/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS LD D+
Sbjct: 38  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFLEMKPKAVILSGGPASVLDRDA 97

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  IL + +P+LGICYG+Q M + LGG  +    REFGRA IE+   C+L  G+WEK
Sbjct: 98  PAAPMSILRAGVPVLGICYGEQTMARQLGGAVEAGHHREFGRAAIEVIDACALFDGVWEK 157

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G    VWMSHGD+V  +P+GF  +A +  +P A IAD+ RK+YA+QFHPEVVHT  G++L
Sbjct: 158 GGAYDVWMSHGDRVTKLPDGFRAVAKAPGSPIAVIADDARKFYAMQFHPEVVHTPDGAKL 217

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  VAG++ +W M ++ +E + +I+ QVG  RVIC +SGGVDS+VAA LI+EAIG 
Sbjct: 218 IRNFVRKVAGLKGDWTMRAFREEAIGKIRAQVGKGRVICGLSGGVDSSVAAILIHEAIGD 277

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E + ++ LF+ + N PL  VDAS++F+ +L  + DPE+KRK IG+
Sbjct: 278 QLTCVFVDHGMLRKDEGKTVVDLFRHHYNIPLVHVDASKQFLDELAGVTDPESKRKTIGR 337

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAK IGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M+MKLV
Sbjct: 338 LFIDVFEAEAKTIGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMNMKLV 397

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEIT E+++ILRE+DAIY +
Sbjct: 398 EPLRELFKDEVRALGRELGLPDIFVGRHPFPGPGLAIRCPGEITREKLDILREADAIYID 457

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y KIWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  D  FL
Sbjct: 458 QIRKAGLYDKIWQAFAVLLPVKTVGVMGDSRTYDYVVGLRAVTSTDGMTADFYPFDAQFL 517

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVK +NRVVYD+TSKPP TIEWE
Sbjct: 518 GTTATRIINEVKCVNRVVYDVTSKPPGTIEWE 549


>gi|115525265|ref|YP_782176.1| GMP synthase [Rhodopseudomonas palustris BisA53]
 gi|115519212|gb|ABJ07196.1| GMP synthase (glutamine-hydrolyzing) [Rhodopseudomonas palustris
           BisA53]
          Length = 561

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/519 (61%), Positives = 400/519 (77%)

Query: 2   HKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA 61
           H      K+LI+DFGSQ TQLIARRVRE  VY E++ F  A   F E  P+A+ILSG PA
Sbjct: 43  HVAAAHDKILIVDFGSQVTQLIARRVREEGVYSEIVPFNKAAAAFAEMKPKAVILSGGPA 102

Query: 62  SSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSL 121
           S LD ++P  P+ IL + +P+LGICYG+Q + + LGG  +    REFGRA IE+  +C+L
Sbjct: 103 SVLDDNAPSAPEAILSAGVPILGICYGEQTLAKQLGGTVEAGHHREFGRATIEVTDDCAL 162

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
             G+W+KG K  VWMSHGD+V  +PEGF  +A +  +P + IAD+ RK+YA+QFHPEVVH
Sbjct: 163 FDGVWQKGGKYDVWMSHGDRVTKLPEGFRAVAQAPGSPISVIADDVRKFYAMQFHPEVVH 222

Query: 182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFL 241
           T  G++LI NFV ++AG   +W M ++ +E + +I+ QVG  +VIC +SGGVDS VAA L
Sbjct: 223 TPDGAKLIRNFVRNIAGFAGDWTMRAFREEAIDKIRGQVGQGKVICGLSGGVDSAVAAVL 282

Query: 242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPET 301
           I+EAIG  LTCV VDHG +RK+E  +++ LF+ + N PL  VDA++ F+ +L  + DPE 
Sbjct: 283 IHEAIGDQLTCVFVDHGLLRKDEARSVVDLFRHHYNIPLVHVDAAKLFLGQLDGVTDPEQ 342

Query: 302 KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE 361
           KRK+IG+LFI+VFE EAK IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP 
Sbjct: 343 KRKIIGKLFIDVFEGEAKMIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPA 402

Query: 362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRE 421
            M+MKLVEPL+ELFKDEVR+LGKEL LPD+FV RHP PGPGLAIRC GEIT E+++ILR 
Sbjct: 403 RMNMKLVEPLRELFKDEVRVLGKELGLPDAFVGRHPFPGPGLAIRCPGEITPEKLDILRH 462

Query: 422 SDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFY 481
           +DA+Y ++I KAG+Y KIWQAF VLLPV+TVGVMGD RTYEYV  LRAVTS DGMTADFY
Sbjct: 463 ADAVYIDQIRKAGLYDKIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGMTADFY 522

Query: 482 HHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +M+FL + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 523 PFEMSFLGETATRIINEVKGVNRVVYDVTSKPPGTIEWE 561


>gi|49473838|ref|YP_031880.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Bartonella quintana str. Toulouse]
 gi|81647394|sp|Q6G197|GUAA_BARQU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|49239341|emb|CAF25674.1| GMP synthase [Bartonella quintana str. Toulouse]
          Length = 518

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/511 (64%), Positives = 402/511 (78%), Gaps = 1/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVR   VYCE++ F+ AL+  K   PQA+ILSGSP S +D  SP
Sbjct: 9   VLIIDFGSQVTQLIARRVRAMGVYCEIVPFQLALEGVKRLRPQAVILSGSPYSVIDDGSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P EI E  +P+LGICYG+Q+MC  LGGK ++   REFGRAF+E+++  +L  G+WEKG
Sbjct: 69  RAPMEIFEIGVPVLGICYGEQVMCVQLGGKVESGHRREFGRAFLEVQEKSALFDGVWEKG 128

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S  QVWMSHGD V  +PEGF VI +S   P+A IADEKR  YAVQFHPEVVHT  G++L+
Sbjct: 129 SCYQVWMSHGDHVAALPEGFRVIGTSKGAPYAAIADEKRCLYAVQFHPEVVHTPDGTKLL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH ++G++ NW M+SY  + ++ I+++VG  RVIC +SGGVDS+V A L++EAIG  
Sbjct: 189 QNFVHKISGLKGNWSMASYRDQAIATIRKKVGKSRVICGLSGGVDSSVVAVLLHEAIGDQ 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRKNE E ++ LF+ + N  L  V+A+  F+  L+   DPE KRK IG+L
Sbjct: 249 LTCILVDHGLMRKNEAEEVLKLFRDHYNIELIHVNAANIFLNALEGETDPEKKRKTIGRL 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEE KKI G +FL QGTLYPDVIES+S   G S  IKSHHNVGGLPE M+MKLVE
Sbjct: 309 FIEVFEEETKKIEGVEFLAQGTLYPDVIESVSAI-GESVTIKSHHNVGGLPERMNMKLVE 367

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG+EL LP+ F+ RHP PGPGLAIRC G +T E++ I+RE+DAIY +E
Sbjct: 368 PLRELFKDEVRSLGRELGLPEQFLGRHPFPGPGLAIRCPGAVTREKLEIIREADAIYLDE 427

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADFY +DM FLS
Sbjct: 428 ICKAGLYDEIWQAFVVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADFYPYDMEFLS 487

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYDITSKPP TIEWE
Sbjct: 488 KTAARIINEVRGINRVVYDITSKPPGTIEWE 518


>gi|316934639|ref|YP_004109621.1| GMP synthase large subunit [Rhodopseudomonas palustris DX-1]
 gi|315602353|gb|ADU44888.1| GMP synthase, large subunit [Rhodopseudomonas palustris DX-1]
          Length = 540

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/512 (62%), Positives = 396/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS LD ++
Sbjct: 29  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDDNA 88

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  ILE+ +P+LGICYG+Q + + LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 89  PSAPMAILEAGVPVLGICYGEQTLAKQLGGTVEGGHHREFGRAQIEITDDCALFDGVWQK 148

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P GF  +A +  +P + IAD+ RK+YA+QFHPEVVHT  G++L
Sbjct: 149 GGKYDVWMSHGDRVTKLPAGFRAVAQAPGSPISVIADDTRKFYAMQFHPEVVHTPDGAKL 208

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  VAG+  +W M ++ +E + +I+ QVG+ +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 209 LRNFVRKVAGLTGDWTMRAFREEAIEKIRTQVGSGKVICGLSGGVDSAVAAVLIHEAIGD 268

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E + ++ LF+ + N PL  VDASE F+  LK + DPE KRK IG+
Sbjct: 269 QLTCVFVDHGLLRKDEGKAVVDLFRHHYNIPLVHVDASETFLGALKGVTDPEQKRKTIGK 328

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA+++GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M+MKLV
Sbjct: 329 LFIDVFEAEARRVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPARMNMKLV 388

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEITEE++ ILR +DA+Y +
Sbjct: 389 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITEEKLEILRNADAVYID 448

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  +M+FL
Sbjct: 449 QIRKAGLYDDIWQAFAVLLPVRTVGVMGDGRTYDYVVGLRAVTSTDGMTADFYQFEMSFL 508

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 509 GATATRIINEVKGVNRVVYDITSKPPGTIEWE 540


>gi|325291715|ref|YP_004277579.1| GMP synthase [Agrobacterium sp. H13-3]
 gi|325059568|gb|ADY63259.1| GMP synthase [Agrobacterium sp. H13-3]
          Length = 525

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/525 (61%), Positives = 400/525 (76%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      +LIIDFGSQ TQLIARR+RE+ VYCE+  F+NA + F++  P+ +I SG P
Sbjct: 1   MTQIAHPDSILIIDFGSQVTQLIARRIREAGVYCEIHPFQNAAEAFEKLQPKGVIFSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS     SP+ P+ + +S +P+LGICYGQQ +C  LGG  +   + EFGRA I+IKK   
Sbjct: 61  ASVTAEGSPRAPQAVFDSKVPILGICYGQQTLCTQLGGVVEGGHAAEFGRADIDIKKASP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G WE+G    VWMSHGD+V  +PEGFEVIA+S++ PFA  ADE R YY   FHPEVV
Sbjct: 121 LFDGFWEQGKSYPVWMSHGDRVTKLPEGFEVIATSENAPFAIAADETRHYYTTMFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G +L+ NFVH + G++ +W M++Y  E++ +I++QVG  RV+CA+SGGVDS+VAA 
Sbjct: 181 HTPDGGKLLSNFVHKIVGLKSDWTMAAYRAEMIRKIRDQVGTGRVLCALSGGVDSSVAAI 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG MR  E E ++ +F+ + N PL  VDA++ F+ +L  + DPE
Sbjct: 241 LIHEAIGDQLTCVYVDHGLMRLGESEQVVGMFRDHYNIPLVHVDAADMFLGQLSGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
            KRK IG+LFIEVFE EA KI     G   FL QGTLYPDVIES+SF GGPS  IKSHHN
Sbjct: 301 VKRKTIGRLFIEVFEAEAAKIAADGKGAPNFLAQGTLYPDVIESVSFSGGPSVTIKSHHN 360

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLPE M+M+LVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC G +T E+
Sbjct: 361 VGGLPERMNMQLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGAVTREK 420

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
           ++ILR++DAIY +EI KAG+Y  IWQAF VLLPVQTVGVMGD RTY++VC+LRAVTS+DG
Sbjct: 421 LDILRKADAIYLDEIRKAGLYDTIWQAFAVLLPVQTVGVMGDYRTYDFVCALRAVTSVDG 480

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTADFY +DMNFL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 481 MTADFYPYDMNFLGRAATRIINEVRGINRVVYDVTSKPPGTIEWE 525


>gi|192290882|ref|YP_001991487.1| GMP synthase [Rhodopseudomonas palustris TIE-1]
 gi|192284631|gb|ACF01012.1| GMP synthase, large subunit [Rhodopseudomonas palustris TIE-1]
          Length = 565

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/512 (62%), Positives = 398/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS LD ++
Sbjct: 54  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDDNA 113

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  ILE+ +P+LGICYG+Q + + LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 114 PSAPMAILEAGVPVLGICYGEQTLAKQLGGTVEGGHHREFGRAQIEITDDCALFDGVWQK 173

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P+GF  +A +  +P + IAD+ RK+YA+QFHPEVVHT  G++L
Sbjct: 174 GGKYDVWMSHGDRVTKLPDGFRAVAQAPGSPISVIADDTRKFYAMQFHPEVVHTPDGAKL 233

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  VAG+  +W M ++ +E + +I+ QVG+ +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 234 LRNFVRKVAGLTGDWTMRAFREEAIEKIRAQVGSGKVICGLSGGVDSAVAAVLIHEAIGD 293

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E ++++ LF+ + N PL  VD SE F+  LK + DPE KRK IG+
Sbjct: 294 QLTCVFVDHGLLRKDEGKSVVDLFRHHYNIPLVHVDVSETFLGALKGVTDPEQKRKTIGK 353

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA+++GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 354 LFIDVFEAEARRVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 413

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEITEE++ ILR +DA+Y +
Sbjct: 414 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITEEKLEILRNADAVYID 473

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  +M+FL
Sbjct: 474 QIRKAGLYDVIWQAFAVLLPVRTVGVMGDGRTYDYVVGLRAVTSTDGMTADFYPFEMSFL 533

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 534 GATATRIINEVKGVNRVVYDVTSKPPGTIEWE 565


>gi|39935272|ref|NP_947548.1| GMP synthase [Rhodopseudomonas palustris CGA009]
 gi|44887926|sp|P60501|GUAA_RHOPA RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|39649124|emb|CAE27644.1| GMP synthetase [Rhodopseudomonas palustris CGA009]
          Length = 540

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/512 (62%), Positives = 396/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS LD ++
Sbjct: 29  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDDNA 88

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  ILE+ +P+LGICYG+Q + + LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 89  PSAPMTILEAGVPVLGICYGEQTLAKQLGGTVEGGHHREFGRAQIEITDDCALFDGIWQK 148

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P GF  +A +  +P + IAD+ RK+YA+QFHPEVVHT  G++L
Sbjct: 149 GGKYDVWMSHGDRVTKLPAGFRAVAQAPGSPISVIADDTRKFYAMQFHPEVVHTPDGAKL 208

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  VAG+  +W M ++ +E + +I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 209 LSNFVRKVAGLTGDWTMRAFREEAIEKIRAQVGTGKVICGLSGGVDSAVAAVLIHEAIGD 268

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E ++++ LF+ + N PL  VD SE F+  LK + DPE KRK IG+
Sbjct: 269 QLTCVFVDHGLLRKDEGKSVVDLFRHHYNIPLVHVDVSETFLGALKGVTDPEQKRKTIGK 328

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA+++GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 329 LFIDVFEAEARRVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 388

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIRC GEITEE++ ILR +DA+Y +
Sbjct: 389 EPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRCPGEITEEKLEILRNADAVYID 448

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y  IWQAF VLLPV++VGVMGD RTY+YV  LRAVTS DGMTADFY  +M+FL
Sbjct: 449 QIRKAGLYDVIWQAFAVLLPVRSVGVMGDGRTYDYVVGLRAVTSTDGMTADFYPFEMSFL 508

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 509 GATATRIINEVKGVNRVVYDVTSKPPGTIEWE 540


>gi|92118055|ref|YP_577784.1| GMP synthase [Nitrobacter hamburgensis X14]
 gi|122990144|sp|Q1QKC3|GUAA_NITHX RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|91800949|gb|ABE63324.1| GMP synthase (glutamine-hydrolyzing) [Nitrobacter hamburgensis X14]
          Length = 540

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 398/524 (75%), Gaps = 5/524 (0%)

Query: 2   HKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA 61
           H      K+LI+DFGSQ TQLIARR+RE  VY E++ F+ A   F E  P+A+ILSG PA
Sbjct: 17  HAASAHDKILIVDFGSQVTQLIARRIREEGVYSEIVPFQKAEAAFLEMKPKAVILSGGPA 76

Query: 62  SSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSL 121
           S LD D+P  P  IL++ +P+LGICYG+Q M Q LGG  +    REFGRA IE+   C+L
Sbjct: 77  SVLDKDAPAAPMSILKAGVPVLGICYGEQTMAQQLGGTVEAGHHREFGRAAIEVTDTCAL 136

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
            +G+WEKG    VWMSHGD+V  +P+GF  +A +  +P A IAD+ R++YA+QFHPEVVH
Sbjct: 137 FEGVWEKGGHYNVWMSHGDRVTKLPDGFRAVAKAQGSPIAVIADDARRFYAMQFHPEVVH 196

Query: 182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFL 241
           T  G++L+ NFV  VAG+  +W M ++ +E + +I+ QVG  RVIC +SGGVDS+VAA L
Sbjct: 197 TPDGAKLLRNFVRKVAGLTGDWTMRAFREEAIEKIRAQVGKGRVICGLSGGVDSSVAAIL 256

Query: 242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPET 301
           I+EAIG  LTCV VDHG +RK+E + ++ LF+ + N PL  VDAS++F+ +L  + DPE 
Sbjct: 257 IHEAIGEQLTCVFVDHGMLRKDEGKTVVELFRHHYNIPLVHVDASKQFLGELAGVTDPEM 316

Query: 302 KRKVIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
           KRK IG+LFI+VFE EAKKI     G A+FL QGTLYPDVIES+SF GGPS  IKSHHNV
Sbjct: 317 KRKTIGRLFIDVFEAEAKKIAALGKGSAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV 376

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLP+ M+MKLVEPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIRC GEIT E++
Sbjct: 377 GGLPDRMNMKLVEPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRCPGEITREKL 436

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           +ILRE+DA+Y ++I KAG+Y KIWQAF VLLPV+TVGVMGD RTYEYV  LRAVTS DGM
Sbjct: 437 DILREADAVYIDQIRKAGLYDKIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGM 496

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TADFY  D  FL   A  I+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 497 TADFYAFDATFLGATATSIINEVKGVNRVVYDVTSKPPGTIEWE 540


>gi|27379100|ref|NP_770629.1| GMP synthase [Bradyrhizobium japonicum USDA 110]
 gi|44887956|sp|Q89N53|GUAA_BRAJA RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|27352250|dbj|BAC49254.1| GMP synthase [Bradyrhizobium japonicum USDA 110]
          Length = 551

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/512 (62%), Positives = 394/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A + FKE  P+A+ILSG P S  +  S
Sbjct: 40  KILIVDFGSQVTQLIARRVREDGVYCEIVPFNKAEEAFKEMKPKAVILSGGPESVHEAGS 99

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ I  S +P++GICYGQ  M   LGG+ +    REFGRA +E+K    L + +W  
Sbjct: 100 PRAPQLIFASGVPVMGICYGQMTMAAQLGGEVEGGHHREFGRADVEVKAQSKLFEDVWSS 159

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           GSK QVWMSHGD++  +P GF V  +S + PFA I DEKRKYY + FHPEVVHT  G++L
Sbjct: 160 GSKNQVWMSHGDRITKMPPGFSVAGTSPNAPFAIIQDEKRKYYGLMFHPEVVHTPDGAKL 219

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +AG+  +W M ++ +E +++I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 220 IRNFVRKIAGLTGDWTMRAFREEEIAKIRAQVGKGKVICGLSGGVDSAVAAVLIHEAIGD 279

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR NE E ++ LF+ + N PL  VDAS++F+ +L+ + DPETKRK IG+
Sbjct: 280 QLTCVFVDHGLMRLNEAEQVVDLFRHHYNIPLVHVDASKQFLGELEGVTDPETKRKTIGR 339

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIEVFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 340 LFIEVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 399

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIRC G+IT ++++ILR++DA+Y +
Sbjct: 400 EPLRELFKDEVRKLGRELGLPEIFVGRHPFPGPGLAIRCPGDITSDKLDILRKADAVYID 459

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I K G+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  DM FL
Sbjct: 460 QIRKHGLYDDIWQAFAVLLPVKTVGVMGDGRTYDYVVGLRAVTSTDGMTADFYQFDMKFL 519

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 520 GETATRIINEVKGVNRVVYDVTSKPPGTIEWE 551


>gi|90424556|ref|YP_532926.1| GMP synthase [Rhodopseudomonas palustris BisB18]
 gi|122475962|sp|Q212S9|GUAA_RHOPB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|90106570|gb|ABD88607.1| GMP synthase (glutamine-hydrolyzing) [Rhodopseudomonas palustris
           BisB18]
          Length = 535

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/519 (62%), Positives = 398/519 (76%)

Query: 2   HKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPA 61
           H      K+LI+DFGSQ TQLIARRVRE  VY E++ F  A   F    P+A+ILSG PA
Sbjct: 17  HVAAAHDKILIVDFGSQVTQLIARRVREEGVYSEIVPFNKAEAAFAAMKPKAVILSGGPA 76

Query: 62  SSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSL 121
           S LD D+PQ P  IL + +P+LGICYG+Q + + LGG  +    REFGRA IEI  +C+L
Sbjct: 77  SVLDDDAPQAPLSILTAGVPILGICYGEQTLAKQLGGIVEGGHHREFGRAQIEITDDCAL 136

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
             G+WEKG K  VWMSHGD+V  +PEGF  +A +  +P + IAD+ RK+YA+QFHPEVVH
Sbjct: 137 FDGVWEKGGKYDVWMSHGDRVTQLPEGFRGVAKAAGSPISVIADDARKFYAMQFHPEVVH 196

Query: 182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFL 241
           T  G++LI NFV  VAG++ +W M ++ +E + +I+ QVG+ +VIC +SGGVDS VAA L
Sbjct: 197 TPDGAKLIRNFVRKVAGLKGDWTMRAFREEAIEKIRAQVGSGKVICGLSGGVDSAVAAVL 256

Query: 242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPET 301
           I+EAIG  LTCV VDHG +RK+E + ++ LF+ + N PL  VDA++ F+ +L+ + DPE 
Sbjct: 257 IHEAIGDQLTCVFVDHGLLRKDEGKTVVDLFRHHYNIPLVHVDAAKLFLGELEGVSDPEL 316

Query: 302 KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE 361
           KRK IG+LFI VFE EAK IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE
Sbjct: 317 KRKTIGRLFINVFEGEAKMIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPE 376

Query: 362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRE 421
            M+M+LVEPL+ELFKDEVR+LG+EL LP+ FV RHP PGPGLAIRC GEIT E++ ILR 
Sbjct: 377 RMNMQLVEPLRELFKDEVRVLGRELGLPEVFVGRHPFPGPGLAIRCPGEITAEKLEILRN 436

Query: 422 SDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFY 481
           +DA+Y ++I KAG+Y KIWQAF VLLPV+TVGVMGD RTYEYV  LRAVTS DGMTADFY
Sbjct: 437 ADAVYIDQIRKAGLYDKIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGMTADFY 496

Query: 482 HHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +M+FL   A RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 497 GFEMSFLGAAATRIINEVKGVNRVVYDITSKPPGTIEWE 535


>gi|154244402|ref|YP_001415360.1| GMP synthase [Xanthobacter autotrophicus Py2]
 gi|154158487|gb|ABS65703.1| GMP synthase, large subunit [Xanthobacter autotrophicus Py2]
          Length = 524

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/511 (63%), Positives = 398/511 (77%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLIIDFGSQ TQLIARRVRE  VY EV+ F+   +  +   P+AIILSG PAS ++  SP
Sbjct: 14  VLIIDFGSQVTQLIARRVREEGVYSEVVPFQKGAEAIQRLKPKAIILSGGPASVIEGQSP 73

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+E   + +P+LGICYG+Q M   LGG  +    REFGRA + ++K   L +G+W  G
Sbjct: 74  KAPEEAFAAGVPVLGICYGEQCMAAQLGGAVEAGHHREFGRAELTVQKVVPLFEGVWRAG 133

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSHGD+V  +PEGFEV+A+SD+ PFA IAD  R YY VQFHPEVVHT  G++L+
Sbjct: 134 ERHTVWMSHGDRVTALPEGFEVVATSDNAPFAAIADLSRNYYGVQFHPEVVHTPDGARLL 193

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV  VA ++  W M ++ +  ++RI+EQVG  RVIC +SGGVDS+VAA LI+EAIG  
Sbjct: 194 SNFVRKVAKLEGAWTMGAFRERAIARIREQVGTGRVICGLSGGVDSSVAAVLIHEAIGDQ 253

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MR+ E + ++SLF+G+ N PL  VDASE F+++L+ + DPE KRK IG+L
Sbjct: 254 LTCVFVDHGLMRQAEADEVVSLFRGHYNIPLVHVDASELFLKELEGVEDPEAKRKTIGRL 313

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VF+ EA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 314 FIDVFDAEARKVGGADFLAQGTLYPDVIESVSFAGGPSVTIKSHHNVGGLPERMNMKLVE 373

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL++LFKDEVR LG+EL LP+SFV RHP PGPGLAIRC G IT E+++ILR++DAIY EE
Sbjct: 374 PLRDLFKDEVRALGRELGLPESFVGRHPFPGPGLAIRCPGAITREKLDILRKADAIYLEE 433

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y  IWQAF VLLPV+TVGVMGD RTY++V +LRAVTS+DGMTADFY  DM FL 
Sbjct: 434 IRYAGLYDVIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSVDGMTADFYPFDMGFLG 493

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 494 RTATRIINEVKGVNRVVYDVTSKPPGTIEWE 524


>gi|75676328|ref|YP_318749.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Nitrobacter winogradskyi Nb-255]
 gi|91206813|sp|Q3SQP4|GUAA_NITWN RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|74421198|gb|ABA05397.1| GMP synthase (glutamine-hydrolyzing) [Nitrobacter winogradskyi
           Nb-255]
          Length = 535

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/512 (62%), Positives = 392/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F    P+A+ILSG PAS LD  +
Sbjct: 24  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFLAMKPKAVILSGGPASVLDRAA 83

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  I  + +P+LGICYG+Q M Q LGG  +    REFGRA IE+   C+L  G+WEK
Sbjct: 84  PAAPMAIFTAGVPVLGICYGEQTMAQQLGGTVEAGHHREFGRAAIEVIDACALFDGVWEK 143

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G    VWMSHGD+V  +P+GF  +A +  +P A IAD+ R++YA+QFHPEVVHT  G++L
Sbjct: 144 GGTYDVWMSHGDRVTKLPDGFRAVAKAPGSPIAVIADDARRFYAMQFHPEVVHTPDGAKL 203

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  VAG+  +W M ++ +E V +I+ QVG  RVIC +SGGVDS+VAA LI+EAIG 
Sbjct: 204 IRNFVRKVAGLTGDWTMRAFREEAVEKIRTQVGKGRVICGLSGGVDSSVAAILIHEAIGD 263

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E + ++ LF+ + N PL  VDAS++F+ +L  + DPE KRK IG+
Sbjct: 264 QLTCVFVDHGMLRKDEGKTVVDLFRHHYNIPLIHVDASKKFLSELAGVTDPEAKRKTIGR 323

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M+MKLV
Sbjct: 324 LFIDVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMNMKLV 383

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIRC GEIT E+++ILRE+DA+Y +
Sbjct: 384 EPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRCPGEITNEKLDILREADAVYID 443

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  D  FL
Sbjct: 444 EIRKAGLYDNIWQAFAVLLPVKTVGVMGDSRTYDYVVGLRAVTSTDGMTADFYPFDAQFL 503

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 504 GSTSTRIINEVKGVNRVVYDVTSKPPGTIEWE 535


>gi|170746885|ref|YP_001753145.1| GMP synthase [Methylobacterium radiotolerans JCM 2831]
 gi|170653407|gb|ACB22462.1| GMP synthase, large subunit [Methylobacterium radiotolerans JCM
           2831]
          Length = 518

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/512 (63%), Positives = 393/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A   F+EQ P+ +ILSG P S     S
Sbjct: 7   KILIVDFGSQVTQLIARRVREEGVYCEIVPFTKAEAAFREQKPKGVILSGGPESVTVEAS 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + +S +P+ GICYGQQ M   LGG  +     EFGRA +EI  +C L KG+W K
Sbjct: 67  PRAPQLVFDSGVPVFGICYGQQTMAAQLGGAVEGGHHAEFGRAEVEILADCPLFKGVWHK 126

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P+GF  +A S + PFA +ADE R YYAVQFHPEV HT  G+ L
Sbjct: 127 GEKYPVWMSHGDRVTKLPDGFTTVAISRNAPFAAVADEARNYYAVQFHPEVAHTPHGALL 186

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  VAG   +W M +Y +E +++I+EQVG+E+VIC +SGGVDS VAA LI+EAIG 
Sbjct: 187 IRNFVRDVAGCSGDWTMGAYREEAIAKIREQVGSEKVICGLSGGVDSAVAAVLIHEAIGD 246

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R  E E +++LF+ + N PL  V+AS  F+  L+ + DPE KRK IG+
Sbjct: 247 QLTCVFVDHGLLRLGEAEQVVALFRDHYNIPLVHVEASGMFLAALEGVSDPEIKRKTIGR 306

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE E+KKIGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 307 LFIDVFEAESKKIGGAKFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 366

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LGKEL LP+ FV RHP PGPGLAIRC G IT E++  LR++DAIY +
Sbjct: 367 EPLRELFKDEVRVLGKELGLPEGFVGRHPFPGPGLAIRCPGTITGEKLEALRKADAIYLD 426

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 427 EIRQAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMAFL 486

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 487 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 518


>gi|323139064|ref|ZP_08074123.1| GMP synthase, large subunit [Methylocystis sp. ATCC 49242]
 gi|322395724|gb|EFX98266.1| GMP synthase, large subunit [Methylocystis sp. ATCC 49242]
          Length = 534

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/521 (62%), Positives = 401/521 (76%), Gaps = 5/521 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           +R  KVLI+DFGSQ TQLIARRVRE+ VYCE+  F+NA   F +  P+A+ILSG P S  
Sbjct: 14  DRHDKVLIVDFGSQVTQLIARRVREAGVYCEIAPFQNAERAFADIRPKAVILSGGPCSVT 73

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           D  SP+ P+ I ES +P+LGICYG+Q M   LGGK +    REFGRA I   ++ +L  G
Sbjct: 74  DEGSPRAPQSIFESGVPVLGICYGEQTMATQLGGKVEAGHHREFGRADITALESSALFDG 133

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +WEKG+   VWMSHGD+V  +P+GF VIA+S + P A IADEKR+YY VQFH EVVHT  
Sbjct: 134 VWEKGTSHTVWMSHGDRVTKLPDGFRVIAASGNAPMAAIADEKRRYYGVQFHLEVVHTPD 193

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L+ NFVH VAG++ +W M+++ +E ++ I+ QVG+ RV+C +SGGVDS VAA LI+E
Sbjct: 194 GAKLLSNFVHKVAGLKSDWTMAAFRQEAIAAIRHQVGDGRVLCGLSGGVDSAVAAVLIHE 253

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +R  E E ++SLF+ + N PL  V+A++ F+  L+ + DPE KRK
Sbjct: 254 AIGDRLTCVFVDHGLLRLGEAEEVVSLFRDHYNIPLHHVEAADLFLGALEGVEDPEVKRK 313

Query: 305 VIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGL 359
            IG+LFIE FE EAKKI     G  QFL QGTLYPDVIES+SF GGPS  IKSHHNVGGL
Sbjct: 314 TIGRLFIETFEAEAKKIAQDGRGAPQFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGL 373

Query: 360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINIL 419
           PE M+M LVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIRC G IT E+++IL
Sbjct: 374 PERMNMALVEPLRELFKDEVRALGRELGLPEAFVGRHPFPGPGLAIRCPGLITREKLDIL 433

Query: 420 RESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTAD 479
           R++DA+Y +EI KAG+Y +IWQAF  LLPV++VGVMGD RTY+YV +LRAVTS DGMTAD
Sbjct: 434 RKADAVYLDEIRKAGLYDEIWQAFAALLPVRSVGVMGDGRTYDYVLALRAVTSSDGMTAD 493

Query: 480 FYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FY  DMNFL + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 494 FYPFDMNFLGRAATRIINEVKGVNRVVYDVTSKPPGTIEWE 534


>gi|217976569|ref|YP_002360716.1| GMP synthase, large subunit [Methylocella silvestris BL2]
 gi|217501945|gb|ACK49354.1| GMP synthase, large subunit [Methylocella silvestris BL2]
          Length = 534

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/522 (62%), Positives = 397/522 (76%), Gaps = 7/522 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           R  KVLI+DFGSQ TQLIARRVRE+ VYCE+  F+ A   F   NP+A+ILSG P S L+
Sbjct: 13  RHDKVLIVDFGSQVTQLIARRVREAGVYCEIAPFQAAEKAFNALNPKAVILSGGPRSVLE 72

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGK--TKNSQSREFGRAFIEIKKNCSLLK 123
            DSP+ PK + ES +P+LGICYG+Q+M + LGG     +S SREFGRA +EI +  +L  
Sbjct: 73  PDSPRAPKTLFESGVPILGICYGEQVMAEQLGGTVIAGHSHSREFGRAEVEILRESALFD 132

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G+W +G    VWMSHGD V  +PEGF  IA+S S P A IADE R+++ VQFH EV HT 
Sbjct: 133 GVWGRGKSYPVWMSHGDAVSELPEGFVPIATSPSAPLAAIADEARRFFGVQFHLEVAHTP 192

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G++LI NFVH VAG+  +W M ++ +E ++ I+ QVG+ RV+C +SGGVDS VAA LI+
Sbjct: 193 DGAKLISNFVHKVAGLSADWTMGAFRQEAIAAIRAQVGSGRVLCGLSGGVDSAVAALLIF 252

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R+ E E +++LF+G+ N PL  V+A   F+  L  + DPE KR
Sbjct: 253 EAIGERLTCVFVDHGLLRQGEAEEVVTLFRGHYNIPLHHVEAKALFLGALTGVRDPEEKR 312

Query: 304 KVIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG 358
           K+IG+LFI  FE EAKKI     G  +FL QGTLYPDVIES+SF GGPS  IKSHHNVGG
Sbjct: 313 KIIGRLFITAFEAEAKKIAADGRGAPEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGG 372

Query: 359 LPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINI 418
           LPE M+MKLVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIRC G IT E++ I
Sbjct: 373 LPERMNMKLVEPLRELFKDEVRALGRELGLPEAFVGRHPFPGPGLAIRCPGGITPEKLEI 432

Query: 419 LRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTA 478
           LR++DAIY +EI KAG+Y +IWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTA
Sbjct: 433 LRQADAIYLDEIRKAGLYDEIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTA 492

Query: 479 DFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           DFY   M FL + A RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 493 DFYPFGMGFLGRAATRIVNEVKGVNRVVYDITSKPPGTIEWE 534


>gi|85710077|ref|ZP_01041142.1| GMP synthase [Erythrobacter sp. NAP1]
 gi|85688787|gb|EAQ28791.1| GMP synthase [Erythrobacter sp. NAP1]
          Length = 524

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/524 (62%), Positives = 392/524 (74%), Gaps = 4/524 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M  +     +LI+DFGSQ TQLIARRVRE+ VY E+  F  A + FK  NP+ IILSGSP
Sbjct: 1   MDDQHLPDSILIVDFGSQVTQLIARRVREAGVYSEIAPFSMAEEAFKRLNPKGIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK----NSQSREFGRAFIEIK 116
           AS  D  SP+ P+   E+ +P+LGICYGQQ+M   LGG+ +      +  EFGRA++ + 
Sbjct: 61  ASVPDDGSPRTPQAFFEAGVPILGICYGQQVMSHQLGGEVRPGHETGEGGEFGRAYLTVT 120

Query: 117 KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH 176
           K C+L  G+W++G + QVWMSHGD+V     GFE++A+SD  PFA IADEKRK+Y  QFH
Sbjct: 121 KECALFDGLWKEGERHQVWMSHGDKVTEFAPGFEIVATSDGAPFAVIADEKRKFYGTQFH 180

Query: 177 PEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST 236
           PEVVHT  G +L+ NFV HV G++ +W M+ + K  +  I+ QVG  RVIC +SGGVDS 
Sbjct: 181 PEVVHTPDGGKLLANFVRHVCGLKGDWTMAEFRKTKIEEIRAQVGEGRVICGLSGGVDSA 240

Query: 237 VAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI 296
           VAA LI+EAIG  LTCV VDHG MR NE E ++SLF+ + N PL  VDA E F+  L  +
Sbjct: 241 VAAVLIHEAIGDQLTCVYVDHGLMRLNETEQVVSLFRDHYNIPLIAVDAEETFLAGLAGV 300

Query: 297 VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
            DPE KRK IG  FI++FE EAKK+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNV
Sbjct: 301 TDPEKKRKFIGGAFIDLFEAEAKKVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV 360

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLPE M+M+LVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIR  GE+T+ER 
Sbjct: 361 GGLPERMNMELVEPLRELFKDEVRELGRELGLPEAFVGRHPFPGPGLAIRIPGEVTKERC 420

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           +ILR++DAIY EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC LRAVTS DGM
Sbjct: 421 DILRKADAIYLEEIRNAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDSVCGLRAVTSTDGM 480

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TAD +  D  FLSQVA RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 481 TADVFPFDAAFLSQVATRIINEVKGINRVVYDYTSKPPGTIEWE 524


>gi|288958012|ref|YP_003448353.1| GMP synthase (glutamine-hydrolyzing) [Azospirillum sp. B510]
 gi|288910320|dbj|BAI71809.1| GMP synthase (glutamine-hydrolyzing) [Azospirillum sp. B510]
          Length = 522

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/514 (62%), Positives = 401/514 (78%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + +VLI+DFGSQ TQLIARRVRES VYCE+  F  + +  +E +P+AIILSGSPAS  + 
Sbjct: 9   AERVLILDFGSQVTQLIARRVRESGVYCEIHPFGMSDERIREYDPKAIILSGSPASVTEA 68

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           + P+ P+ + +  +P+LGICYGQQ MC  LGG    S  REFGRAFIEIK+ C+L  G+W
Sbjct: 69  NGPRAPQAVFDLKVPVLGICYGQQTMCHQLGGTVSGSDHREFGRAFIEIKEPCALFDGLW 128

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E GSK+QVWMSHGD+V  +P+GF  +A SD  PFA IAD+ R+ Y VQFHPEVVHT  G+
Sbjct: 129 EIGSKEQVWMSHGDRVTALPDGFRAVAVSDGAPFAAIADDSRRMYGVQFHPEVVHTPHGA 188

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           QL+ NFVH VAGI+ +W M+++ ++ + +I+ QVG  +VIC +SGGVDS+VAA LI+EAI
Sbjct: 189 QLLANFVHRVAGIEGDWTMAAFKQQAIEKIRAQVGKGKVICGLSGGVDSSVAAVLIHEAI 248

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VD G MR  E E ++ LF+ + N PL   +A++ F+ KL  + DPE KRK+I
Sbjct: 249 GDQLTCIFVDTGLMRAGESEEVVRLFRDHYNIPLVHREAADLFLGKLAGVTDPEQKRKII 308

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFIEVF+EE+ K+GGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 309 GGLFIEVFDEESAKVGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKLK 368

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP +F+ RHP PGPGLAIR  GEIT E++ ILR++D +Y
Sbjct: 369 LVEPLRELFKDEVRALGRELGLPPAFIGRHPFPGPGLAIRVPGEITPEKLEILRKADTVY 428

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY++V +LRAVTS DGMTAD+Y    +
Sbjct: 429 LEEIRNAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDHVLALRAVTSTDGMTADWYPFPHD 488

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL++V+ RIVNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 489 FLARVSNRIVNEVRGVNRVVYDITSKPPGTIEWE 522


>gi|85375169|ref|YP_459231.1| GMP synthase [Erythrobacter litoralis HTCC2594]
 gi|84788252|gb|ABC64434.1| GMP synthase [Erythrobacter litoralis HTCC2594]
          Length = 524

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/524 (61%), Positives = 392/524 (74%), Gaps = 4/524 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      +LI+DFGSQ TQLIARRVRE+ VY E+  F  A + F+   P+ IILSGSP
Sbjct: 1   MDQAHLPDSILIVDFGSQVTQLIARRVREAGVYSEIAPFSMAEEAFQRMKPKGIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK----NSQSREFGRAFIEIK 116
           A   D  SP+ P+ + E+ +P+LGICYGQQ+M   LGG+ +         EFGRA++ + 
Sbjct: 61  AGVPDEGSPRAPQILFEAGVPILGICYGQQVMTHQLGGEVRPGHETGDGGEFGRAYLTVT 120

Query: 117 KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH 176
           K+C+L  GMW+ G + QVWMSHGD+V    +GFE++A+SD  PFA IADE RK+Y  QFH
Sbjct: 121 KDCALFDGMWQVGERHQVWMSHGDKVTQFADGFEIVATSDGAPFAVIADEARKFYGTQFH 180

Query: 177 PEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST 236
           PEVVHT  G++L+ NFV HV G+  +W M+ + K  +  I+ QVG+ +VIC +SGGVDS 
Sbjct: 181 PEVVHTPDGAKLLANFVRHVCGLAGDWTMAEFRKTKIEEIRAQVGDGKVICGLSGGVDSA 240

Query: 237 VAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI 296
           VAA LI+EAIG  LTCV VDHG MR+ E E ++SLF+G+ N PL  VDA + F+  L  +
Sbjct: 241 VAAVLIHEAIGEQLTCVFVDHGLMRQGEAEQVVSLFRGHYNIPLVHVDAEDMFLGGLAGV 300

Query: 297 VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
            DPE KRK IG  FI++FEEEA+KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNV
Sbjct: 301 TDPEKKRKFIGGAFIDLFEEEARKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV 360

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLPE M+M+LVEPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIR  GE+T+ER 
Sbjct: 361 GGLPERMNMQLVEPLRELFKDEVRALGRELGLPDVFVGRHPFPGPGLAIRIPGEVTKERC 420

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           +ILR++DAIY EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC LRAVTS DGM
Sbjct: 421 DILRKADAIYLEEIRAAGLYDAIWQAFAVLLPVRTVGVMGDARTYDSVCGLRAVTSTDGM 480

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TAD Y  D  FL+QVA RIVNEV+GINRVVYD TSKPP TIEWE
Sbjct: 481 TADVYPFDATFLTQVATRIVNEVQGINRVVYDYTSKPPGTIEWE 524


>gi|146340154|ref|YP_001205202.1| GMP synthase [Bradyrhizobium sp. ORS278]
 gi|226738392|sp|A4YSU1|GUAA_BRASO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|146192960|emb|CAL76967.1| GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase)
           (GMP synthetase) [Bradyrhizobium sp. ORS278]
          Length = 535

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/512 (62%), Positives = 391/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F+ A   F++ NP+A+ILSG P S  +  S
Sbjct: 24  KILIVDFGSQVTQLIARRVREDGVYCEIVPFQKAEAAFRQMNPKAVILSGGPESVHEEGS 83

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ I ES +P++GICYGQ  M   LGG  +    REFGRA +E+K N  L  G+W+ 
Sbjct: 84  PRAPQLIFESGVPVMGICYGQMTMAAQLGGTVEGGHHREFGRADVEVKTNSLLFDGVWQP 143

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G + QVWMSHGD++  +P GF V   S + PFA I DE RKYY + FHPEVVHT  G++L
Sbjct: 144 GEQHQVWMSHGDRITQMPPGFSVAGVSPNAPFAVIQDEARKYYGLMFHPEVVHTPDGAKL 203

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV +++G+  +W M ++ +E + +I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 204 IRNFVRNISGLGGDWTMHAFREEEIKKIRAQVGQGKVICGLSGGVDSAVAAVLIHEAIGD 263

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R NE E ++ LF+ + N PL  VDAS+ F+ +L  + DPE KRK IG+
Sbjct: 264 QLTCVFVDHGLLRLNEAETVVDLFRHHYNIPLVHVDASKLFLGELAGVTDPEAKRKTIGR 323

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M+MKLV
Sbjct: 324 LFIDVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPARMNMKLV 383

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL LPD FV RHP PGPGLAIRC GEIT ++++ILR++DAIY +
Sbjct: 384 EPLRELFKDEVRVLGRELGLPDVFVGRHPFPGPGLAIRCPGEITTDKLDILRKADAIYID 443

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  DM FL
Sbjct: 444 EIRKAGLYDTIWQAFAVLLPVKTVGVMGDGRTYDYVVGLRAVTSTDGMTADFYPFDMKFL 503

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 504 GNTATRIINEVKGVNRVVYDVTSKPPGTIEWE 535


>gi|188582356|ref|YP_001925801.1| GMP synthase [Methylobacterium populi BJ001]
 gi|179345854|gb|ACB81266.1| GMP synthase, large subunit [Methylobacterium populi BJ001]
          Length = 521

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/512 (63%), Positives = 391/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A   F E  P+ +ILSG P S     S
Sbjct: 10  KILIVDFGSQVTQLIARRVREEGVYCEIVPFTKADAAFDEHRPKGVILSGGPESVTTDLS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P++I ES +P+ GICYGQQ M   LGG+ +     EFGRA +EI  +  L +G+W  
Sbjct: 70  PRAPQKIFESGVPVFGICYGQQTMAAQLGGEVEGGHHAEFGRAEVEIVSDSPLFRGIWHP 129

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +PEGF  IA S + PFA +ADE RKYYAVQFHPEV HT  G+ L
Sbjct: 130 GEKYPVWMSHGDRVTKLPEGFATIAMSRNAPFAAVADEARKYYAVQFHPEVHHTPHGALL 189

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +AG   +W M +Y +E +++I+EQVG E+VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 190 IRNFVRDIAGCSGDWTMGTYREEAIAKIREQVGTEKVICGLSGGVDSSVAAVLIHEAIGD 249

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR  E E ++ LF+ + N PL  V+A + FI  L+ + DPE KRK IG+
Sbjct: 250 QLTCVFVDHGLMRLGEGEEVVRLFRDHYNIPLVHVEAQDLFIGALEGVDDPEVKRKTIGR 309

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M+LV
Sbjct: 310 LFIDVFEAEAKKIGGAAFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMRLV 369

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVRLLGKEL LP++FV RHP PGPGLAIRC G IT E++  LR++DAIY +
Sbjct: 370 EPLRELFKDEVRLLGKELGLPEAFVGRHPFPGPGLAIRCPGIITREKLEALRKADAIYLD 429

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 430 EIRQAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMAFL 489

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 490 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 521


>gi|326386574|ref|ZP_08208196.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208889|gb|EGD59684.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 519

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/516 (62%), Positives = 388/516 (75%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E S  +LI+DFGSQ TQLIARRVRE+ VY E+  F  A   F    P+ IILSGSPAS  
Sbjct: 4   ETSESILIVDFGSQVTQLIARRVREAGVYSEIAPFTQAEAAFARMKPKGIILSGSPASVP 63

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
              SP+ P+ + +S +P+LGICYGQQ+M Q LGG+ +   + EFGRAF+ + + C L  G
Sbjct: 64  ADGSPRAPQVLFDSGLPILGICYGQQVMSQQLGGQVEPGDAGEFGRAFLTVTEPCVLFDG 123

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +W+ G + QVWMSHGD+V     GF ++A SD  PFA IAD+ RKYY  QFHPEVVHT  
Sbjct: 124 LWQVGERHQVWMSHGDKVTEFASGFRIVAVSDGAPFAVIADDTRKYYGTQFHPEVVHTPD 183

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +LI NFV HV G + +W M+ + K  ++ I+EQVG+ RVIC +SGGVDS VAA LI+E
Sbjct: 184 GGKLIANFVRHVCGCRGDWTMAEFRKTKIAEIREQVGDARVICGLSGGVDSAVAAVLIHE 243

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG MR  E E ++ LF+ + N PL   DAS  F++ L+ + DPE KRK
Sbjct: 244 AIGDQLTCVFVDHGLMRLGEAEQVVGLFRNHYNIPLVHRDASTLFLKGLEGVTDPEAKRK 303

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
            IG+ FI+VFEEEA+++GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+
Sbjct: 304 FIGKTFIDVFEEEARQVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMN 363

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           MKLVEPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIR  GE+T ER +ILR++DA
Sbjct: 364 MKLVEPLRELFKDEVRELGRELGLPDIFVGRHPFPGPGLAIRIPGEVTRERCDILRKADA 423

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY +EI KAG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTAD Y  D
Sbjct: 424 IYLDEIRKAGLYDAIWQAFAVLLPVRTVGVMGDFRTYDSVCALRAVTSTDGMTADIYPFD 483

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FLS+VA RIVNEVKGINRVVYD TSKPP TIEWE
Sbjct: 484 AGFLSRVATRIVNEVKGINRVVYDYTSKPPGTIEWE 519


>gi|148255024|ref|YP_001239609.1| GMP synthase [Bradyrhizobium sp. BTAi1]
 gi|146407197|gb|ABQ35703.1| GMP synthase (glutamine-hydrolyzing) [Bradyrhizobium sp. BTAi1]
          Length = 534

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/512 (62%), Positives = 389/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F+ A   F++  P+A+ILSG P S  +  S
Sbjct: 23  KILIVDFGSQVTQLIARRVREDGVYCEIVPFQKAEAAFRQMQPKAVILSGGPESVHEAGS 82

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ I +S +P++GICYGQ  M   LGG  +    REFGRA +E+K +  L  G+W+ 
Sbjct: 83  PRAPQLIFDSGVPVMGICYGQMTMAAQLGGTVEGGHHREFGRADVEVKTSSRLFDGVWQP 142

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G + QVWMSHGD++  +P GF V   S + PFA I DE RKYY + FHPEVVHT  G++L
Sbjct: 143 GEQHQVWMSHGDRITQMPPGFSVAGVSPNAPFAVIQDETRKYYGLMFHPEVVHTPDGAKL 202

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV ++AG+  +W M ++  E + +I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 203 IRNFVRNIAGLGGDWTMHAFRAEEIKKIRAQVGKGKVICGLSGGVDSAVAAVLIHEAIGD 262

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R NE E ++ LF+ + N PL  VDAS+ F+ +L  + DPE KRK IG+
Sbjct: 263 QLTCVFVDHGLLRLNEAETVVDLFRHHYNIPLVHVDASKLFLGELAGVTDPEQKRKTIGR 322

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M+MKLV
Sbjct: 323 LFIDVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPARMNMKLV 382

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL LPD FV RHP PGPGLAIRC GEIT ++++ILR++DAIY +
Sbjct: 383 EPLRELFKDEVRVLGRELGLPDVFVGRHPFPGPGLAIRCPGEITVDKLDILRKADAIYID 442

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF VLLPV+TVGVMGD RTY+YV  LRAVTS DGMTADFY  DM FL
Sbjct: 443 EIRKAGLYDTIWQAFAVLLPVKTVGVMGDGRTYDYVVGLRAVTSTDGMTADFYPFDMKFL 502

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 503 GNTATRIINEVKGVNRVVYDVTSKPPGTIEWE 534


>gi|209967210|ref|YP_002300125.1| GMP synthase (glutamine-hydrolyzing) [Rhodospirillum centenum SW]
 gi|209960676|gb|ACJ01313.1| GMP synthase (glutamine-hydrolyzing) [Rhodospirillum centenum SW]
          Length = 525

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/514 (60%), Positives = 397/514 (77%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + +VLI+DFGSQ TQLIARR+RE+ VYCE++ F    +  +   P+A+ILSG PAS  + 
Sbjct: 12  TDRVLILDFGSQVTQLIARRIREAGVYCEILPFSVGDERVRAFAPRAVILSGGPASVTEA 71

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P+ +    +P+LGICYGQQ MC+ LGGK +   +REFGRAF+++++ C+L +G+W
Sbjct: 72  GSPRAPEAVWTLGVPVLGICYGQQTMCEQLGGKVEPGDTREFGRAFVDVREPCALFEGVW 131

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G+++QVWMSHGD+V  +P+GF  +A+S+  PFA +AD+ R++Y VQFHPEVVHT  G 
Sbjct: 132 TPGAREQVWMSHGDRVARLPDGFRTVATSEGAPFAIVADDVRRFYGVQFHPEVVHTPHGD 191

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            LI NF+  V+G+   W M++Y  + V +I+ QVG  +VIC +SGGVDS+VAA LI+EA+
Sbjct: 192 ALIRNFLFGVSGLSGGWTMAAYRAQSVEKIRAQVGTGKVICGLSGGVDSSVAAVLIHEAV 251

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VD G MR  E + +++LF+ + N PL  VDA++ F+ +L+ + DPE KRK I
Sbjct: 252 GEQLTCIFVDTGLMRAGEAQEVVTLFRDHYNIPLVHVDAADLFLGELEGVSDPEVKRKTI 311

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFIEVF+ EA KIGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 312 GRLFIEVFDREAAKIGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKLK 371

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP SFV RHP PGPGLAIR  GEIT E++ ILR++D IY
Sbjct: 372 LVEPLRELFKDEVRALGRELGLPHSFVGRHPFPGPGLAIRVPGEITREKLEILRKADQIY 431

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y  D  
Sbjct: 432 LEEIRNAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFDHG 491

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +VA RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 492 FLGRVATRIINEVRGINRVTYDITSKPPGTIEWE 525


>gi|332186867|ref|ZP_08388609.1| GMP synthase (glutamine-hydrolyzing) [Sphingomonas sp. S17]
 gi|332013200|gb|EGI55263.1| GMP synthase (glutamine-hydrolyzing) [Sphingomonas sp. S17]
          Length = 517

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/516 (62%), Positives = 397/516 (76%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E    +LI+DFGSQ TQLIARRVRE+ VY EV+ F++A   F    P A+ILSG PAS +
Sbjct: 2   EHPDSILIVDFGSQVTQLIARRVREAGVYSEVVPFQSAEAAFARIKPAAVILSGGPASVV 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           D +SP+IP+ IL+S +P+LGICYGQQ + Q LGGK +   S EFG AFI ++  C+L  G
Sbjct: 62  DAESPRIPQGILDSGLPMLGICYGQQALTQQLGGKVEKGDSGEFGEAFITVEDGCALFDG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +W +G + QVWMSHGD+V  +  GF V+A+S   P+A IA+++R+ YA+QFHPEVVHT  
Sbjct: 122 LWAQGERHQVWMSHGDKVTALAPGFRVVATSPGAPYAIIANDERRIYAMQFHPEVVHTPD 181

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++LI NF  HV G+  +W M+ + +  ++ I+EQVG+ RVIC +SGGVDS+VAA LI+E
Sbjct: 182 GAKLIANFARHVVGLTGDWTMAEFREAKIAEIREQVGSGRVICGLSGGVDSSVAALLIHE 241

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VD G +R+ E E ++SLF+G+ N PL  VDA E F+  L  + DPE KRK
Sbjct: 242 AIGDQLTCVFVDGGILRQGEAEQVVSLFRGHYNIPLVHVDAQELFMGGLAGVTDPEAKRK 301

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
            IG+ FI+VFE EAKKIGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+
Sbjct: 302 FIGKTFIDVFEAEAKKIGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMN 361

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           MKLVEPL+ELFKDEVR+LG+EL LPD FV RHP PGPGLAIR  GE+T+ER +ILR++DA
Sbjct: 362 MKLVEPLRELFKDEVRVLGRELGLPDVFVGRHPFPGPGLAIRIPGEVTKERCDILRKADA 421

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY EEI KAG+Y  IWQAF VLLPV++VGVMGD RTY+ V +LRAVTS+DGMTA  +   
Sbjct: 422 IYLEEIRKAGLYDAIWQAFAVLLPVRSVGVMGDGRTYDSVLALRAVTSVDGMTAQAFDFP 481

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL +V  RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 482 GDFLPRVTTRIINEVKGINRVVYDYTSKPPGTIEWE 517


>gi|58040378|ref|YP_192342.1| GMP synthase [Gluconobacter oxydans 621H]
 gi|81351534|sp|Q5FPL0|GUAA_GLUOX RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|58002792|gb|AAW61686.1| GMP synthase [glutamine-hydrolyzing] [Gluconobacter oxydans 621H]
          Length = 533

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/512 (62%), Positives = 398/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARRVRES VYCE+  F    +  +  NP+ IILSGSPAS  D ++
Sbjct: 22  RILILDFGSQVTQLIARRVRESGVYCEIWPFTATEEKIRAFNPRGIILSGSPASVHDENA 81

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P IP  +   N P+LGICYGQQ MCQ LGGK ++ + REFGRA+I+I ++CSL +G+W +
Sbjct: 82  PPIPNVVFALNRPVLGICYGQQAMCQMLGGKVESHEHREFGRAYIDIAEDCSLFRGVWAR 141

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G ++QVWMSHGD+V  +P GF  +A S+  PFA IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 142 GKREQVWMSHGDRVTQLPPGFRAVAHSEGAPFAIIADEGRRLYGVQFHPEVVHTPHGAAL 201

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NF H+VAG    W M+ + +  ++RI++QVG+ RVIC +SGGVDS+VAA LI++AIG 
Sbjct: 202 IRNFTHNVAGCSGTWTMAGFRELEIARIRKQVGSGRVICGLSGGVDSSVAAKLIHDAIGD 261

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD G MR  E + ++  F+G  N  L   DASE F+++L  + DPETKRK IG+
Sbjct: 262 QLTCIFVDPGIMRTGEADEVVKTFRGRFNIRLVHRDASELFLKELAGVTDPETKRKTIGR 321

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIEVFEEEA K+GGAQFL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M+M+LV
Sbjct: 322 LFIEVFEEEAAKLGGAQFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPDRMNMELV 381

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL +P+S V RHP PGPGLAIR  G++T+E++++LR+ DAIY E
Sbjct: 382 EPLRELFKDEVRMLGRELGIPESIVGRHPFPGPGLAIRIPGDVTKEKLDLLRKVDAIYLE 441

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF VLLPV+TVGVMGD RTY+  C+LRAVTS DGMTA+ Y  D  FL
Sbjct: 442 EIRRAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDQACALRAVTSTDGMTAEVYPFDFAFL 501

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 502 NRVAGRIVNEVRGINRVTYDITSKPPGTIEWE 533


>gi|294010559|ref|YP_003544019.1| GMP synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
 gi|292673889|dbj|BAI95407.1| GMP synthase (glutamine-hydrolyzing) [Sphingobium japonicum UT26S]
          Length = 519

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/511 (62%), Positives = 391/511 (76%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LI+DFGSQ TQLIARRVRE+ VY E+  F NA + F+   P+ IILSG P+S +  DSP
Sbjct: 9   ILIVDFGSQVTQLIARRVREAGVYSEIAPFNNAAEAFERLKPKGIILSGGPSSVMWEDSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+   ++ +P+LGICYGQQ M Q LGG  +  +S EFGRAFIE+KK C+L  G+W +G
Sbjct: 69  RAPQHFFDAGVPVLGICYGQQTMMQQLGGNVEGGESGEFGRAFIEVKKGCALFDGLWSEG 128

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K QVWMSHGD+V  +  GFEV+A S+  P+A  A+E++++YA QFHPEVVHT  G++L+
Sbjct: 129 EKHQVWMSHGDKVTRLAPGFEVVAVSEGAPYAITANEEKRFYATQFHPEVVHTPDGAKLL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV HV G++ +W M+ +    ++ I+ QVG  RVIC +SGGVDS VAA LI+EAIG  
Sbjct: 189 ANFVRHVCGLKGDWTMAEFRATKIADIRAQVGEGRVICGLSGGVDSAVAAVLIHEAIGDQ 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MR  E E ++SLF+ +    L  V+A ERF+  L  + DPE KRK IG  
Sbjct: 249 LTCVFVDHGLMRLGEAEQVVSLFREHYGIKLVHVNAEERFLGGLAGLTDPEKKRKFIGGE 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 309 FIAVFEEEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVE 368

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR+LG+EL LP+ FV RHP PGPGLAIR  GE+++ER +ILR++DA+Y EE
Sbjct: 369 PLRELFKDEVRVLGRELGLPEIFVGRHPFPGPGLAIRIPGEVSKERCDILRKADAVYLEE 428

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTAD Y  D  FLS
Sbjct: 429 IRNAGLYDAIWQAFAVLLPVRTVGVMGDYRTYDSVCALRAVTSTDGMTADIYPFDAAFLS 488

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +VA RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 489 RVATRIINEVKGINRVVYDYTSKPPGTIEWE 519


>gi|296446290|ref|ZP_06888236.1| GMP synthase, large subunit [Methylosinus trichosporium OB3b]
 gi|296256191|gb|EFH03272.1| GMP synthase, large subunit [Methylosinus trichosporium OB3b]
          Length = 531

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/521 (60%), Positives = 395/521 (75%), Gaps = 5/521 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           +R  K+LI+DFGSQ TQLIARRVRE+ VYCE+  F++A   F E  P+A+ILSG P S  
Sbjct: 11  DRHDKLLIVDFGSQVTQLIARRVREAGVYCEIAPFQSAERAFTEIRPKAVILSGGPCSVT 70

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           D  SP+ P+ I ++ +P+L ICYG+Q++   LGG  +    REFGRA I + +   L  G
Sbjct: 71  DEGSPRAPQSIFDAGVPVLAICYGEQLLAAQLGGAVEGGHHREFGRAEIGVIEESPLFAG 130

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +WEKG +  VWMSHGD+V  +PEGF  IA+S++ P A IADE R+YY VQFH EV HT  
Sbjct: 131 VWEKGGRHPVWMSHGDRVTRLPEGFRAIAASENAPMAAIADEARRYYGVQFHLEVAHTPD 190

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++LI NFVH+VAG++ +W M+++  E +  ++ QVG  RV+C +SGGVDS VAA LI+E
Sbjct: 191 GAKLISNFVHNVAGLKSDWTMAAFRGEAIDAVRRQVGAGRVLCGLSGGVDSAVAAVLIHE 250

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +R  E E ++SLF+ + N PL  V+A E F+  L  + DPE KRK
Sbjct: 251 AIGDALTCVFVDHGLLRAGEAEEVVSLFRDHYNIPLVHVEAQEMFLSALSGVEDPEVKRK 310

Query: 305 VIGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGL 359
            IG+LFIE FEEEAK+I     G  QFL QGTLYPDVIES+SF GGPS  IKSHHNVGGL
Sbjct: 311 TIGRLFIETFEEEAKRIAADGRGAPQFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGL 370

Query: 360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINIL 419
           PE M+M+LVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIRC G IT E++ IL
Sbjct: 371 PERMNMQLVEPLRELFKDEVRALGRELGLPEAFVGRHPFPGPGLAIRCPGAITPEKLEIL 430

Query: 420 RESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTAD 479
           R++DAIY +EI KAG+Y +IWQAF VLLPV+TVGVMGD R+Y++VC+LRAVTS DGMTAD
Sbjct: 431 RKADAIYLDEIRKAGLYDEIWQAFAVLLPVRTVGVMGDGRSYDHVCALRAVTSTDGMTAD 490

Query: 480 FYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FY  DM FL + A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 491 FYAFDMGFLGRAATRIINEVRGVNRVVYDVTSKPPGTIEWE 531


>gi|307294927|ref|ZP_07574769.1| GMP synthase, large subunit [Sphingobium chlorophenolicum L-1]
 gi|306879401|gb|EFN10619.1| GMP synthase, large subunit [Sphingobium chlorophenolicum L-1]
          Length = 519

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/511 (62%), Positives = 390/511 (76%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LI+DFGSQ TQLIARRVRE+ VY E+  F NA + F+   P+ IILSG P+S +  DSP
Sbjct: 9   ILIVDFGSQVTQLIARRVREAGVYSEIAPFNNAAEAFERLKPKGIILSGGPSSVMWEDSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+   ++ IP+LGICYGQQ M Q LGG  +  +S EFGRAFIE+KK C+L  G+W +G
Sbjct: 69  RAPQHFFDAGIPILGICYGQQTMMQQLGGNVEGGESGEFGRAFIEVKKGCALFDGLWSEG 128

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K QVWMSHGD+V  +  GFEV+A S+  P+A  A+E++++YA QFHPEVVHT  G++L+
Sbjct: 129 EKHQVWMSHGDKVTQLAPGFEVVAVSEGAPYAITANEEKRFYATQFHPEVVHTPDGAKLL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV HV G+  +W M+ +    ++ I+ QVG  RVIC +SGGVDS VAA LI+EAIG  
Sbjct: 189 ANFVRHVCGLAGDWTMAEFRATKIADIRAQVGEGRVICGLSGGVDSAVAAVLIHEAIGDQ 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MR  E E ++SLF+ +    L  V+A ERF+  L  + DPE KRK IG  
Sbjct: 249 LTCVFVDHGLMRLGEAEQVVSLFREHYGIKLVHVNAEERFLGGLAGLTDPEKKRKFIGGE 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI +FEEEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 309 FIALFEEEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVE 368

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR+LG+EL LP+ FV RHP PGPGLAIR  GE+++ER +ILR++DA+Y EE
Sbjct: 369 PLRELFKDEVRVLGRELGLPEIFVGRHPFPGPGLAIRIPGEVSKERCDILRKADAVYLEE 428

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTAD Y  D  FLS
Sbjct: 429 IRNAGLYDAIWQAFAVLLPVRTVGVMGDHRTYDSVCALRAVTSTDGMTADIYPFDAAFLS 488

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +VA RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 489 RVATRIINEVKGINRVVYDYTSKPPGTIEWE 519


>gi|240139683|ref|YP_002964160.1| GMP synthetase (glutamine aminotransferase) [Methylobacterium
           extorquens AM1]
 gi|254562094|ref|YP_003069189.1| GMP synthetase [Methylobacterium extorquens DM4]
 gi|240009657|gb|ACS40883.1| GMP synthetase (glutamine aminotransferase) [Methylobacterium
           extorquens AM1]
 gi|254269372|emb|CAX25338.1| GMP synthetase (glutamine aminotransferase) [Methylobacterium
           extorquens DM4]
          Length = 521

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 388/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A   F+   P+ +ILSG P S     S
Sbjct: 10  KILIVDFGSQVTQLIARRVREEGVYCEIVPFTKAEAAFEAHRPKGVILSGGPESVTTDLS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P++I ES +P+ GICYGQQ M   LGG+ +     EFGRA +EI  +  L +G+W  
Sbjct: 70  PRAPQKIFESGVPVFGICYGQQTMAAQLGGEVEGGHHAEFGRAEVEIVSDSPLFRGVWHA 129

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P+GF  IA S + PFA +ADE R YYAVQFHPEV HT  G+ L
Sbjct: 130 GEKYPVWMSHGDRVTKLPDGFATIAMSRNAPFAAVADEARHYYAVQFHPEVHHTPHGALL 189

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +AG   +W M +Y +E +++I+EQVG E+VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 190 IRNFVRDIAGCSGDWTMGTYREEAIAKIREQVGKEKVICGLSGGVDSSVAAVLIHEAIGD 249

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR  E + ++ LF+ + N PL  V A + FI  L+ + DPE KRK IG+
Sbjct: 250 QLTCVFVDHGLMRLGEGDEVVRLFRDHYNIPLVHVQAQDLFIGALEGVDDPEVKRKTIGR 309

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 310 LFIDVFEAEAGKIGGAAFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMKLV 369

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVRLLGKEL LP+SFV RHP PGPGLAIRC G IT E++  LR++DAIY +
Sbjct: 370 EPLRELFKDEVRLLGKELGLPESFVGRHPFPGPGLAIRCPGMITREKLEALRKADAIYLD 429

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 430 EIRQAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMAFL 489

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 490 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 521


>gi|163852348|ref|YP_001640391.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Methylobacterium extorquens PA1]
 gi|163663953|gb|ABY31320.1| GMP synthase, large subunit [Methylobacterium extorquens PA1]
          Length = 521

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 388/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A   F+   P+ +ILSG P S     S
Sbjct: 10  KILIVDFGSQVTQLIARRVREEGVYCEIVPFTKADAAFEAHRPKGVILSGGPESVTTDLS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P++I ES +P+ GICYGQQ M   LGG+ +     EFGRA +EI  +  L +G+W  
Sbjct: 70  PRAPQKIFESGVPVFGICYGQQTMAAQLGGEVEGGHHAEFGRAEVEIVSDSPLFRGVWHA 129

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P+GF  IA S + PFA +ADE R YYAVQFHPEV HT  G+ L
Sbjct: 130 GEKYPVWMSHGDRVTKLPDGFATIAMSRNAPFAAVADEARHYYAVQFHPEVHHTPHGALL 189

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +AG   +W M +Y +E +++I+EQVG E+VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 190 IRNFVRDIAGCSGDWTMGTYREEAIAKIREQVGKEKVICGLSGGVDSSVAAVLIHEAIGD 249

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR  E + ++ LF+ + N PL  V A + FI  L+ + DPE KRK IG+
Sbjct: 250 QLTCVFVDHGLMRLGEGDEVVRLFRDHYNIPLVHVQAQDLFIGALEGVDDPEVKRKTIGR 309

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 310 LFIDVFEAEAGKIGGAAFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMKLV 369

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVRLLGKEL LP+SFV RHP PGPGLAIRC G IT E++  LR++DAIY +
Sbjct: 370 EPLRELFKDEVRLLGKELGLPESFVGRHPFPGPGLAIRCPGMITREKLEALRKADAIYLD 429

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 430 EIRQAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMAFL 489

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 490 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 521


>gi|218531106|ref|YP_002421922.1| GMP synthase [Methylobacterium chloromethanicum CM4]
 gi|218523409|gb|ACK83994.1| GMP synthase, large subunit [Methylobacterium chloromethanicum CM4]
          Length = 521

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 388/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VYCE++ F  A   F+   P+ +ILSG P S     S
Sbjct: 10  KILIVDFGSQVTQLIARRVREEGVYCEIVPFTKAEAAFEAHRPKGVILSGGPESVTTDLS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P++I ES +P+ GICYGQQ M   LGG+ +     EFGRA +EI  +  L +G+W  
Sbjct: 70  PRAPQKIFESGVPVFGICYGQQTMAAQLGGEVEGGHHAEFGRAEVEIVSDSPLFRGVWHA 129

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +P+GF  IA S + PFA +ADE R YYAVQFHPEV HT  G+ L
Sbjct: 130 GEKYPVWMSHGDRVTKLPDGFATIAMSRNAPFAAVADEGRHYYAVQFHPEVHHTPHGALL 189

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +AG   +W M +Y +E +++I+EQVG E+VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 190 IRNFVRDIAGCSGDWTMGTYREEAIAKIREQVGKEKVICGLSGGVDSSVAAVLIHEAIGD 249

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR  E + ++ LF+ + N PL  V A + FI  L+ + DPE KRK IG+
Sbjct: 250 QLTCVFVDHGLMRLGEGDEVVRLFRDHYNIPLIHVQAQDLFIGALEGVDDPEVKRKTIGR 309

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 310 LFIDVFEAEAGKIGGAAFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMNMKLV 369

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVRLLGKEL LP+SFV RHP PGPGLAIRC G IT E++  LR++DAIY +
Sbjct: 370 EPLRELFKDEVRLLGKELGLPESFVGRHPFPGPGLAIRCPGMITREKLEALRKADAIYLD 429

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 430 EIRQAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMAFL 489

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 490 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 521


>gi|144898006|emb|CAM74870.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 517

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/516 (61%), Positives = 397/516 (76%), Gaps = 2/516 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNA-LDYFKEQNPQAIILSGSPASSLD 65
           S +VLI+DFGSQ TQLIARRVRES VYCE+  F     +   +  P+AIILSG P+S  +
Sbjct: 2   SDRVLILDFGSQVTQLIARRVRESGVYCEIHPFNRVNAESLAQFAPKAIILSGGPSSVAE 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             SP+ P+ +    +P+LGICYGQQ MC+ LGGK +    REFGRA+++I  +C+L  G+
Sbjct: 62  ASSPRAPEAVFTLGVPVLGICYGQQTMCEQLGGKVEPGDHREFGRAYVDIIDDCALFTGV 121

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W KG K+QVWMSHGD+V  +P+GF V+ +S+  PFA IA+++R++YAVQFHPEVVHT  G
Sbjct: 122 WAKGGKEQVWMSHGDRVTALPDGFRVVGTSEGAPFAAIANDQRRFYAVQFHPEVVHTPHG 181

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           +QL+ NF H+VAG   +W M+++  + +++I++QVG  +VIC +SGGVDS+V A LI+EA
Sbjct: 182 AQLLKNFTHNVAGCTGDWTMAAFKDQAIAKIRQQVGKGKVICGLSGGVDSSVVAALIHEA 241

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MR  E E ++S+F+   N  L   DAS+ F+ +L  + DPE KRK 
Sbjct: 242 IGDQLTCVYVDHGLMRLGESEQVVSVFRDRFNINLVHKDASDLFLGRLAGMTDPEQKRKT 301

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG LFI+VFEEEAK+IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M
Sbjct: 302 IGGLFIDVFEEEAKRIGGADFLAQGTLYPDVIESVSFIGGPSVTIKSHHNVGGLPERMNM 361

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIG-EITEERINILRESDA 424
           KLVEPL+ELFKDEVR LG+EL LPD  V RHP PGPGLAIR  G EIT +++ IL+++DA
Sbjct: 362 KLVEPLRELFKDEVRELGRELGLPDEMVGRHPFPGPGLAIRIPGQEITRDKLEILKKADA 421

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY EEI  AG+Y  IWQAFTVLLPV+TVGVMGD R+Y+Y C+LRAVTS DGMTADFY  D
Sbjct: 422 IYLEEIRNAGLYDAIWQAFTVLLPVRTVGVMGDSRSYDYACALRAVTSTDGMTADFYPFD 481

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           M FL +VA RI+NE KGINRV YD+TSKPP TIEWE
Sbjct: 482 MAFLGRVANRIINECKGINRVTYDVTSKPPGTIEWE 517


>gi|56552163|ref|YP_163002.1| GMP synthase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|81354934|sp|Q5NN19|GUAA_ZYMMO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|56543737|gb|AAV89891.1| GMP synthase, large subunit [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 526

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/515 (62%), Positives = 393/515 (76%), Gaps = 1/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S  +LI+DFGSQ TQLIARRVRE+ VY E++ F  A + F+   P+ IILSGSPAS +  
Sbjct: 12  SESILIVDFGSQVTQLIARRVREAGVYSEIVPFNRAEEAFQRLQPKGIILSGSPASVVAE 71

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGK-TKNSQSREFGRAFIEIKKNCSLLKGM 125
            SP+ P+   ++ IP+ GICYGQQ+MC  LGGK T N    EFGRAFI++     L + +
Sbjct: 72  GSPRAPESFFQAGIPIFGICYGQQVMCHQLGGKVTANDVDGEFGRAFIDVIAPSPLFENL 131

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W+ G K QVWMSH D+VE +PEGF+ IA SD  PFA IADEKR++Y +QFHPEVVHT  G
Sbjct: 132 WKVGEKHQVWMSHADRVEALPEGFKPIAVSDGAPFALIADEKRRFYGMQFHPEVVHTPDG 191

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            +LI +FVH + G+  +W M+ + +  ++ I++QVG+ RVIC +SGGVDS+V A L++EA
Sbjct: 192 GKLIAHFVHDICGLAGDWTMAEFRQTKIAEIRKQVGDGRVICGLSGGVDSSVTAVLVHEA 251

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MR+ E E ++SLF+ +    L  V+A +RF+  LK + DPETKRK 
Sbjct: 252 IGDQLTCVFVDHGLMRQGEAEQVVSLFREHYGIKLVHVNAEDRFLAGLKGVTDPETKRKF 311

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FIE+FEEEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M
Sbjct: 312 IGKTFIEIFEEEAKKIGGADFLAQGTLYPDVIESVSFLGGPSVTIKSHHNVGGLPERMNM 371

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL +PD FV+RHP PGPGLAIR  GE+T+ER +ILR++DA+
Sbjct: 372 KLVEPLRELFKDEVRDLGRELGMPDVFVDRHPFPGPGLAIRIPGEVTKERCDILRKADAV 431

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTA+ Y    
Sbjct: 432 YLEEIRNAGLYNAIWQAFAVLLPVRTVGVMGDGRTYDSVCALRAVTSTDGMTAEIYPFQP 491

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL+ VA RIVNEV+GINRV YD TSKPP TIEWE
Sbjct: 492 EFLANVATRIVNEVRGINRVTYDFTSKPPGTIEWE 526


>gi|260752318|ref|YP_003225211.1| GMP synthase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258551681|gb|ACV74627.1| GMP synthase, large subunit [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 526

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/515 (62%), Positives = 393/515 (76%), Gaps = 1/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S  +LI+DFGSQ TQLIARRVRE+ VY E++ F  A + F+   P+ IILSGSPAS +  
Sbjct: 12  SESILIVDFGSQVTQLIARRVREAGVYSEIVPFNRAEEAFQRLQPKGIILSGSPASVVAE 71

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGK-TKNSQSREFGRAFIEIKKNCSLLKGM 125
            SP+ P+   ++ IP+ GICYGQQ+MC  LGGK T N    EFGRAFI++     L + +
Sbjct: 72  GSPRAPESFFQAGIPIFGICYGQQVMCHQLGGKVTANDVDGEFGRAFIDVIAPSPLFENL 131

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W+ G K QVWMSH D+VE +PEGF+ IA SD  PFA IADEKR++Y +QFHPEVVHT  G
Sbjct: 132 WKVGEKHQVWMSHADRVEALPEGFKPIAVSDGAPFALIADEKRRFYGMQFHPEVVHTPDG 191

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            +LI +FVH + G+  +W M+ + +  ++ I++QVG+ RVIC +SGGVDS+V A L++EA
Sbjct: 192 GKLIAHFVHDICGLAGDWTMAEFRQTKIAEIRKQVGDGRVICGLSGGVDSSVTAVLVHEA 251

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MR+ E E ++SLF+ +    L  V+A +RF+  LK + DPETKRK 
Sbjct: 252 IGDQLTCVFVDHGLMRQGEAEQVVSLFREHYGIKLVHVNAEDRFLAGLKGVTDPETKRKF 311

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FIE+FEEEAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M
Sbjct: 312 IGKTFIEIFEEEAKKIGGADFLAQGTLYPDVIESVSFLGGPSVTIKSHHNVGGLPERMNM 371

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL +PD FV+RHP PGPGLAIR  GE+T+ER +ILR++DA+
Sbjct: 372 KLVEPLRELFKDEVRDLGRELGMPDIFVDRHPFPGPGLAIRIPGEVTKERCDILRKADAV 431

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTA+ Y    
Sbjct: 432 YLEEIRNAGLYNAIWQAFAVLLPVRTVGVMGDGRTYDSVCALRAVTSTDGMTAEIYPFQP 491

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL+ VA RIVNEV+GINRV YD TSKPP TIEWE
Sbjct: 492 EFLANVATRIVNEVRGINRVTYDFTSKPPGTIEWE 526


>gi|103486127|ref|YP_615688.1| GMP synthase [Sphingopyxis alaskensis RB2256]
 gi|98976204|gb|ABF52355.1| GMP synthase (glutamine-hydrolyzing) [Sphingopyxis alaskensis
           RB2256]
          Length = 537

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/517 (62%), Positives = 387/517 (74%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
            +LIIDFGSQ TQLIARRVRE+ VY E++ F  A        P+ +ILSGSPAS     S
Sbjct: 21  SILIIDFGSQVTQLIARRVREAGVYSEIVPFSAAEAALARMRPKGVILSGSPASVPAEGS 80

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTK-----NSQSREFGRAFIEIKKNCSLLK 123
           P+ P+ I +S +P+LGICYGQQ+M Q LGGK +       +  EFGRAF+ + + C L  
Sbjct: 81  PRAPRSIFDSGLPILGICYGQQVMSQQLGGKVEPGGIDGERDGEFGRAFLTVTEPCVLFD 140

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G+W+ G + QVWMSHGD+V     GF ++A SD  PFA IA+++R+YY  QFHPEVVHT 
Sbjct: 141 GLWQVGERHQVWMSHGDRVTRFAPGFRIVAVSDGAPFAVIANDERRYYGTQFHPEVVHTP 200

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G++LI NFV HV G   +W M+ +    ++ I+ QVG++RV+C +SGGVDS VAA LI+
Sbjct: 201 DGAKLIANFVRHVCGCSGDWTMAEFRTTKIAEIRAQVGDQRVLCGLSGGVDSAVAAVLIH 260

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R NE E +  LF+ + N PL VVDA ERF+  L  I DPE KR
Sbjct: 261 EAIGEQLTCVFVDHGLLRMNEREQVERLFRDHYNIPLVVVDAEERFMAGLAGITDPEQKR 320

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG  FI VFEEEA+KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 321 KFIGAEFINVFEEEARKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERM 380

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           +MKLVEPL+ELFKDEVRLLGKEL LPD FV RHP PGPGLAIR  GE+++ER +ILR++D
Sbjct: 381 NMKLVEPLRELFKDEVRLLGKELGLPDIFVGRHPFPGPGLAIRIPGEVSKERCDILRKAD 440

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY++VC+LRAVTS DGMTAD Y  
Sbjct: 441 AVYLEEIRNAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDHVCALRAVTSTDGMTADIYPF 500

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           D +FLS+ A RI+NEV+GINRVVYD TSKPP TIEWE
Sbjct: 501 DASFLSRCATRIINEVQGINRVVYDYTSKPPGTIEWE 537


>gi|182679806|ref|YP_001833952.1| GMP synthase, large subunit [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635689|gb|ACB96463.1| GMP synthase, large subunit [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 533

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/520 (61%), Positives = 392/520 (75%), Gaps = 5/520 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           R  KVLI+DFGSQ TQLIARRVRE+ VYCE+  F++A   F+   P+A+ILSG PAS LD
Sbjct: 14  RHDKVLIVDFGSQVTQLIARRVREAGVYCEIAPFQSAERAFETLAPKAVILSGGPASVLD 73

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             SP++P  I  S +P+LGICYG+Q+M   LGGK    ++REFGRA +EI    +L   +
Sbjct: 74  QGSPRVPDVIFSSKVPVLGICYGEQVMALQLGGKVAAGKTREFGRADVEILAESALFDNV 133

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           WEKG    VWMSHGD V  +P GF   A+S     A +ADE R YY VQFH EVVHT  G
Sbjct: 134 WEKGQSYPVWMSHGDAVIDLPPGFVRAATSRQEAVAVMADEARHYYGVQFHLEVVHTPQG 193

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++LI+NFVH VAG+  +W M ++ +E ++ I+ +VG  RV+C +SGGVDS VAA LI+EA
Sbjct: 194 ARLIENFVHKVAGLSRDWTMRAFRQEAIAAIQAKVGTGRVLCGLSGGVDSAVAALLIHEA 253

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R  E E I+SLF+G+ N PL    A + F+  L  + DPE KR++
Sbjct: 254 IGDRLTCVFVDHGLLRHGEAEEIVSLFRGHYNIPLIHAQAQDLFLDALAGVSDPEEKRRI 313

Query: 306 IGQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           IG+LFIE FE EAK I     G  +FLGQGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 314 IGRLFIETFEAEAKTIASDGKGVPEFLGQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLP 373

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M+MKLVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIRC G +T E++ ILR
Sbjct: 374 ERMNMKLVEPLRELFKDEVRELGRELGLPEAFVSRHPFPGPGLAIRCPGGVTREKLAILR 433

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DAIY +EI KAG+Y KIWQAF VLLPVQTVGVMGD RTYE+VC+LRAVTS+DGMTADF
Sbjct: 434 QADAIYLDEIRKAGLYDKIWQAFAVLLPVQTVGVMGDGRTYEFVCALRAVTSVDGMTADF 493

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y  +M+FL + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 494 YSFEMDFLGRAATRIINEVQGINRVVYDVTSKPPGTIEWE 533


>gi|148554242|ref|YP_001261824.1| GMP synthase [Sphingomonas wittichii RW1]
 gi|148499432|gb|ABQ67686.1| GMP synthase (glutamine-hydrolyzing) [Sphingomonas wittichii RW1]
          Length = 530

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/512 (62%), Positives = 385/512 (75%), Gaps = 1/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LI+DFGSQ TQLIARRVRE+ VY E+  F  A   F    P+ IILSG PAS  ++ SP
Sbjct: 19  ILIVDFGSQVTQLIARRVREAGVYSEIAPFNAADAAFDRLQPKGIILSGGPASVAEMGSP 78

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGK-TKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           + P+   E+ +P+LGICYGQQ MCQ LGG  T +  SREFGRAFIEIK   +L  G+W++
Sbjct: 79  RAPQRFFEAGVPILGICYGQQTMCQQLGGSVTPSHDSREFGRAFIEIKTRSALFDGLWKE 138

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G   QVWMSHGD+V+ +P GF  +A S+  P+A  +DEKR++Y VQFHPEVVHT  G +L
Sbjct: 139 GEHHQVWMSHGDKVDALPPGFSPVAVSEGAPYAVTSDEKRRFYGVQFHPEVVHTPDGGKL 198

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NF  HV G+  +W M+ +    +  I++QVG+ RVIC +SGGVDS VAA LI+EAIG 
Sbjct: 199 IANFARHVCGLTGDWTMAEFRATKIEEIRQQVGDGRVICGLSGGVDSAVAAVLIHEAIGD 258

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG MR  E + ++ LF+ +   PL  V+A   F+  LK + DPE KRK IG+
Sbjct: 259 QLTCVFVDHGLMRMGEADQVVGLFREHYGIPLVHVNAETLFLNGLKGVTDPEAKRKFIGK 318

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 319 TFIEVFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 378

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIR  GE+T+ER +ILR++DA+Y +
Sbjct: 379 EPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRIPGEVTKERCDILRKADAVYLD 438

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI +AG+Y  IWQAF VLLPV++VGVMGD RTY+ VC+LRAVTS DGMTAD Y  D  FL
Sbjct: 439 EIRRAGLYDAIWQAFAVLLPVRSVGVMGDGRTYDSVCALRAVTSTDGMTADVYPFDAAFL 498

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           S+VA RIVNEV+GINRV YD TSKPP TIEWE
Sbjct: 499 SRVATRIVNEVQGINRVTYDYTSKPPGTIEWE 530


>gi|149185056|ref|ZP_01863373.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Erythrobacter sp. SD-21]
 gi|148831167|gb|EDL49601.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Erythrobacter sp. SD-21]
          Length = 524

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/524 (61%), Positives = 388/524 (74%), Gaps = 4/524 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +      +LI+DFGSQ TQLIARRVRE+ VY E+  F  A + F    P+ +ILSGSP
Sbjct: 1   MDQAHLPDSILIVDFGSQVTQLIARRVREAGVYSEIAPFTQAEEAFHRLKPRGVILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK----NSQSREFGRAFIEIK 116
           AS  D DSP+ P+ I +S +P+LGICYGQQ+M   LGG+ +      +  EFGRAF E+ 
Sbjct: 61  ASVPDADSPRAPEVIFDSKVPILGICYGQQVMTDQLGGEVRPGHETGEGGEFGRAFCEVT 120

Query: 117 KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH 176
           + C L  G+W+ G   QVWMSHGD+V  I EGF ++A+S   PFA IAD++R+YY  QFH
Sbjct: 121 EKCVLFDGLWKPGETHQVWMSHGDKVTRIAEGFRIVATSPGAPFALIADDERRYYGTQFH 180

Query: 177 PEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST 236
           PEVVHT  G +L+ NFV HV G+  +W M+ + K  +  I+ QVG+ +VIC +SGGVDS 
Sbjct: 181 PEVVHTPDGGKLLANFVRHVCGLTSDWTMAEFRKTKIEEIRAQVGDGKVICGLSGGVDSA 240

Query: 237 VAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI 296
           VAA LI+EAIG  LTCV VDHG MR NE E +++LF+ + N PL  V+A E F+  L+  
Sbjct: 241 VAAVLIHEAIGDQLTCVFVDHGLMRMNEAEQVVTLFRDHYNIPLVHVNAEEMFLGGLEGQ 300

Query: 297 VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
            DPE KRK IG  FI++FE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNV
Sbjct: 301 TDPEKKRKFIGGAFIDLFEAEAKKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV 360

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLPE M+M+LVEPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIR  GE+T+ER 
Sbjct: 361 GGLPERMNMELVEPLRELFKDEVRDLGRELGLPEVFVGRHPFPGPGLAIRIPGEVTKERC 420

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           +ILR++DAIY EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC LRAVTS DGM
Sbjct: 421 DILRKADAIYLEEIRNAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDSVCGLRAVTSTDGM 480

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TAD Y  D  FLS+VA RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 481 TADIYPFDAAFLSRVATRIINEVKGINRVVYDYTSKPPGTIEWE 524


>gi|86750300|ref|YP_486796.1| GMP synthase [Rhodopseudomonas palustris HaA2]
 gi|123292405|sp|Q2IV75|GUAA_RHOP2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|86573328|gb|ABD07885.1| GMP synthase (glutamine-hydrolyzing) [Rhodopseudomonas palustris
           HaA2]
          Length = 540

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/512 (61%), Positives = 393/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE  VY E++ F+ A   F E  P+A+ILSG PAS LD D+
Sbjct: 29  KILIVDFGSQVTQLIARRVREEGVYSEIVPFQKAEAAFAEMKPKAVILSGGPASVLDADA 88

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P  ILE+ +P+LGICYG+Q + + LGG  +    REFGRA IEI  +C+L  G+W+K
Sbjct: 89  PAAPMAILEAGVPVLGICYGEQTLAKQLGGTVEAGHHREFGRATIEITDDCALFDGVWQK 148

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G    VWMSHGD+V  +P+GF  +A +  +P + IAD+KRK+YA QFH EVVHT  G+++
Sbjct: 149 GGTYDVWMSHGDRVTKLPDGFRGVAKAPGSPISVIADDKRKFYATQFHLEVVHTPDGAKI 208

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  VAG+  +W M ++ +E + +I+ QVG  +VIC +SGGVDS VAA LI+EAIG 
Sbjct: 209 LRNFVRKVAGLTGDWTMRAFREEAIEKIRAQVGTGKVICGLSGGVDSAVAAVLIHEAIGD 268

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RK+E + ++ LF+ + N PL  VDASE F+  L  + DPE KRK+IG+
Sbjct: 269 QLTCVFVDHGMLRKDEAKTVVDLFRHHYNIPLVHVDASETFLGALSGVTDPEQKRKIIGK 328

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VF+ EAK +GGA +L QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 329 LFIDVFDAEAKVVGGADYLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 388

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIRC GEIT E+++ILR +DA+Y +
Sbjct: 389 EPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRCPGEITAEKLDILRNADAVYID 448

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           +I KAG+Y  IWQAF VLLPV+TVGVMGD RTYEYV  LRAVTS DGMTAD+Y  DM FL
Sbjct: 449 QIRKAGLYDAIWQAFAVLLPVKTVGVMGDGRTYEYVVGLRAVTSTDGMTADYYPFDMAFL 508

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 509 GATATRIINEVKGVNRVVYDVTSKPPGTIEWE 540


>gi|296282204|ref|ZP_06860202.1| GMP synthase [Citromicrobium bathyomarinum JL354]
          Length = 524

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/524 (61%), Positives = 389/524 (74%), Gaps = 4/524 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M        +LI+DFGSQ TQLIARRVRE+ VY E+  F  A + F+   P+ IILSGSP
Sbjct: 1   MQPDHLPDSILIVDFGSQVTQLIARRVREAGVYSEIAPFTQAAEAFERMKPKGIILSGSP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK----NSQSREFGRAFIEIK 116
           AS  D  SP+ P+ + +S +P+LGICYGQQ+M   LGG+ K      +  EFGRAF+ + 
Sbjct: 61  ASVCDEGSPRAPQVLFDSGLPILGICYGQQVMTTQLGGEVKPGHETGEGGEFGRAFLTVT 120

Query: 117 KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH 176
           + C L +G+WE G + QVWMSHGD+V    +GF ++A+SD  PFA IAD++R+YY  QFH
Sbjct: 121 EPCVLFEGLWEVGERHQVWMSHGDKVTQFADGFRIVATSDGAPFALIADDERRYYGTQFH 180

Query: 177 PEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST 236
           PEV HT  G++L+ NF  HV G+  +W M+ Y    ++ I+EQVG+ +VIC +SGGVDS+
Sbjct: 181 PEVFHTPDGAKLLANFARHVCGLSGDWTMAEYRATKIAEIREQVGDAKVICGLSGGVDSS 240

Query: 237 VAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI 296
           VAA LI+EAIG  LTCV VDHG +R+ E E + ++F+ + N PL VVDA ERF+  L   
Sbjct: 241 VAAILIHEAIGEQLTCVFVDHGLLRQGEREQVETMFRDHYNIPLVVVDAEERFMAGLAGE 300

Query: 297 VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
            DPE KRK IG  FI VFEEEA +IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNV
Sbjct: 301 TDPEKKRKFIGGEFINVFEEEANRIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV 360

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLPE M+M+LVEPL+ELFKDEVR LG+EL LPD FV RHP PGPGLAIR  GE+T+ER 
Sbjct: 361 GGLPERMNMQLVEPLRELFKDEVRDLGRELGLPDMFVGRHPFPGPGLAIRIPGEVTKERC 420

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           +ILR++DAIY EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGM
Sbjct: 421 DILRKADAIYLEEIRNAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDSVCALRAVTSTDGM 480

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TAD Y  D  FL +VA RIVNEV+GINRVVYD TSKPP TIEWE
Sbjct: 481 TADVYPFDGAFLGRVATRIVNEVRGINRVVYDYTSKPPGTIEWE 524


>gi|87198574|ref|YP_495831.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87134255|gb|ABD24997.1| GMP synthase (glutamine-hydrolyzing) [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 540

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/514 (62%), Positives = 383/514 (74%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S  +LI+DFGSQ TQLIARRVRE+ VY E+  F  A   F    P+ IILSGSPAS    
Sbjct: 27  SESILIVDFGSQVTQLIARRVREAGVYSEIAPFSQAEAAFHRMKPKGIILSGSPASVPAD 86

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P+ + +S +P+LGICYGQQ+M + LGGK +   S EFGRAF+ + + C L  G+W
Sbjct: 87  GSPRAPQVLFDSGLPILGICYGQQVMSEQLGGKVEPGDSGEFGRAFLTVTEPCVLFDGLW 146

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G + QVWMSHGD+V     GF ++A SD  PFA IA++++KYY  QFHPEVVHT  G 
Sbjct: 147 AVGERHQVWMSHGDKVTQFAPGFRIVAVSDGAPFAVIANDEKKYYGTQFHPEVVHTPDGG 206

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +LI NFV HV G   +W M+ + +  ++ I+EQVG+ RVIC +SGGVDS VAA LI+EAI
Sbjct: 207 KLIANFVRHVCGCAGDWSMAEFRRTKIAEIREQVGDSRVICGLSGGVDSAVAAVLIHEAI 266

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG MR  E E ++SLF+ + N PL   D S  F+  L  + DPE KRK I
Sbjct: 267 GDQLTCVFVDHGLMRMGEAEQVVSLFRNHYNIPLVHKDVSALFLGGLAGVTDPEAKRKFI 326

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+ FI+VFE EA+++GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MK
Sbjct: 327 GKTFIDVFEAEARQVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMK 386

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIR  GE+T+ER +ILR++DAIY
Sbjct: 387 LVEPLRELFKDEVRALGRELGLPEIFVGRHPFPGPGLAIRIPGEVTKERCDILRKADAIY 446

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTAD Y  D  
Sbjct: 447 LEEIRNAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDSVCALRAVTSTDGMTADIYPFDAG 506

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FLS+VA RIVNEVKGINRVVYD TSKPP TIEWE
Sbjct: 507 FLSRVATRIVNEVKGINRVVYDYTSKPPGTIEWE 540


>gi|258543332|ref|YP_003188765.1| GMP synthase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634410|dbj|BAI00386.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637468|dbj|BAI03437.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640520|dbj|BAI06482.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643577|dbj|BAI09532.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646632|dbj|BAI12580.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649685|dbj|BAI15626.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652673|dbj|BAI18607.1| glutamine amidotransferase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655729|dbj|BAI21656.1| glutamine amidotransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 533

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/512 (60%), Positives = 395/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARRVRES VYCE+  F    +  ++ +P+ IILSG PAS  + D+
Sbjct: 22  RILILDFGSQVTQLIARRVRESGVYCEIWPFTADAERIRQFSPRGIILSGGPASVNNPDA 81

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P++P  + E  +P+LGICYGQQ MC+ LGG+ ++   REFGRAF++I ++C+L +G W +
Sbjct: 82  PRVPDVVFEMAVPVLGICYGQQAMCKQLGGQVESGDHREFGRAFVDIVEDCALFRGAWAR 141

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G ++QVWMSHGD+V  +P GF  +A S+  PFA IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 142 GGREQVWMSHGDRVVELPPGFRTVAVSEGAPFAVIADEGRRLYGVQFHPEVVHTPHGAAL 201

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H+VAG    W M+ + +  ++RI+EQVG+ +VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 202 LKNFTHNVAGCSGTWTMAGFREMEIARIREQVGDGKVICGLSGGVDSSVAAVLIHEAIGD 261

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG +R  E +++I  F+G  N  L   DAS+ F+++L  + DPE KRK IG+
Sbjct: 262 QLTCIFVDHGMLRAGEADDVIKTFRGQFNIQLVHRDASDIFLKELDGVTDPEIKRKTIGR 321

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LF+EVFEEEA K+GGAQFL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M+MKLV
Sbjct: 322 LFVEVFEEEATKLGGAQFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMNMKLV 381

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P+  V RHP PGPGLAIR  G IT E++++LR+ D+++ E
Sbjct: 382 EPLRELFKDEVRDLGRELGIPEIIVGRHPFPGPGLAIRIPGNITREKLDLLRKVDSVFLE 441

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+  C+LRAVTS DGMTAD Y  DM FL
Sbjct: 442 EIRAAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDQACALRAVTSTDGMTADVYPFDMGFL 501

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 502 TRVAGRIVNEVRGINRVTYDITSKPPGTIEWE 533


>gi|329114013|ref|ZP_08242780.1| GMP synthase [Acetobacter pomorum DM001]
 gi|326696760|gb|EGE48434.1| GMP synthase [Acetobacter pomorum DM001]
          Length = 533

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/512 (60%), Positives = 395/512 (77%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARRVRES VYCE+  F    +  ++ +P+ IILSG PAS  + D+
Sbjct: 22  RILILDFGSQVTQLIARRVRESGVYCEIWPFTADAERIRQFSPRGIILSGGPASVNNPDA 81

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P++P  + E  +P++GICYGQQ MC+ LGG+ ++   REFGRAF++I ++C+L +G W +
Sbjct: 82  PRVPDVVFEMAVPVMGICYGQQAMCKRLGGQVESGDHREFGRAFVDIVEDCALFRGAWAR 141

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G ++QVWMSHGD+V  +P GF  +A S+  PFA IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 142 GGREQVWMSHGDRVVELPPGFRTVAVSEGAPFAVIADEGRRLYGVQFHPEVVHTPHGAAL 201

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H+VAG    W M+ + +  ++RI+EQVG+ +VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 202 LKNFTHNVAGCSGTWTMAGFREMEIARIREQVGDGKVICGLSGGVDSSVAAVLIHEAIGD 261

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG +R  E +++I  F+G  N  L   DAS+ F++ L+ + DPE KRK IG+
Sbjct: 262 QLTCIFVDHGMLRAGEADDVIKTFRGQFNIQLVHRDASDIFLKALEGVTDPEIKRKTIGR 321

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LF+EVFEEEA K+GGAQFL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M+MKLV
Sbjct: 322 LFVEVFEEEATKLGGAQFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMNMKLV 381

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P+  V RHP PGPGLAIR  G IT E++++LR+ D+++ E
Sbjct: 382 EPLRELFKDEVRDLGRELDIPEIIVGRHPFPGPGLAIRIPGNITREKLDLLRKVDSVFLE 441

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+  C+LRAVTS DGMTAD Y  DM FL
Sbjct: 442 EIRAAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDQACALRAVTSTDGMTADVYPFDMGFL 501

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 502 TRVAGRIVNEVRGINRVTYDITSKPPGTIEWE 533


>gi|298290963|ref|YP_003692902.1| GMP synthase, large subunit [Starkeya novella DSM 506]
 gi|296927474|gb|ADH88283.1| GMP synthase, large subunit [Starkeya novella DSM 506]
          Length = 533

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/511 (61%), Positives = 388/511 (75%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ TQLIARRVRE  VY E++ +++A +  +  NP  II SG PAS  D  SP
Sbjct: 23  ILIIDFGSQVTQLIARRVREEGVYSEIVPYQSAAEAVRRLNPVGIIFSGGPASVTDEGSP 82

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+E  ++ +P+  ICYGQQ     LGG+ +   + EFGRA + + K  +L  G+WE G
Sbjct: 83  RAPQEAFDAGVPIFAICYGQQTAALQLGGEVEGGHAAEFGRAEVTVNKPSALYDGVWEVG 142

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSHGD+V  +P+GFEV+A+S++ P A   DE+R+ Y   FHPEVVHT  G+ LI
Sbjct: 143 GRYPVWMSHGDRVTRLPDGFEVVATSENAPCAVAVDEERRIYTTMFHPEVVHTPHGAALI 202

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV  ++G + +W M +Y +E + RI+EQVGNE+VIC +SGGVDS+VAA LI+EAIG  
Sbjct: 203 RNFVRRISGARGDWGMKAYREEAIRRIREQVGNEKVICGLSGGVDSSVAAVLIHEAIGDQ 262

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +R  E E +++LF+   N PL  VDA E F+  L+ + DPE KRK IG+L
Sbjct: 263 LTCVFVDHGLLRLGEAEKVVTLFRDAYNIPLVHVDAEELFLGALEGVTDPEVKRKTIGKL 322

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLVE
Sbjct: 323 FIDVFEAEAKKIGGAAFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLVE 382

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG+EL LP+ FV RHP PGPGLAIRC GEIT E+++ILR +D IY EE
Sbjct: 383 PLRELFKDEVRALGRELGLPEVFVGRHPFPGPGLAIRCPGEITREKLDILRLADEIYLEE 442

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I + G+Y +IWQAF V+LPV+TVGVMGD RTY+YV  LRAVTS+DGMTADFY  DM FL 
Sbjct: 443 IRRHGLYDEIWQAFAVILPVKTVGVMGDYRTYDYVVGLRAVTSVDGMTADFYPFDMAFLG 502

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +VA RIVNEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 503 RVATRIVNEVKGVNRVVYDVTSKPPGTIEWE 533


>gi|296536614|ref|ZP_06898691.1| GMP synthase (glutamine-hydrolyzing) [Roseomonas cervicalis ATCC
           49957]
 gi|296263060|gb|EFH09608.1| GMP synthase (glutamine-hydrolyzing) [Roseomonas cervicalis ATCC
           49957]
          Length = 520

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/512 (60%), Positives = 392/512 (76%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARR+RES VYCE+  F       +   P+ IILSG PAS++D  S
Sbjct: 9   RILILDFGSQVTQLIARRLRESGVYCEIWPFTADAARIQLFAPKGIILSGGPASTVDEGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E  IP+LGICYGQQ MC  LGG+ + S  +E+GRA++E+K+ C+L + +W  
Sbjct: 69  PRAPQVVFEMGIPVLGICYGQQTMCMQLGGRVEKSDHQEYGRAYVEVKEACALTQALWAP 128

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G+++QVWMSHGD+V  +PEGF ++A+S+  P+A +AD+ RK+Y +QFHPEVVHT  G+ L
Sbjct: 129 GAREQVWMSHGDRVAALPEGFRIVATSEGAPYAMVADDDRKFYGIQFHPEVVHTPHGAAL 188

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H V G Q +W M+++  E ++RI+ QVG+ +VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 189 LKNFTHAVCGCQGDWTMAAFRAEAIARIRAQVGDGKVICGLSGGVDSSVAAVLIHEAIGD 248

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG MR  E E +++ F+   N  L   DAS+ F+ +L  + DPE KRK IG+
Sbjct: 249 QLTCIYVDHGVMRAGETEQVVATFRDRFNIKLVHRDASDLFLGQLAGVTDPELKRKTIGR 308

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIEVFEEE +KIGGA FL QGTLYPDVIES+S  GGPS  IKSHHNVGGLPE M MKLV
Sbjct: 309 LFIEVFEEEQEKIGGADFLAQGTLYPDVIESVSATGGPSVTIKSHHNVGGLPEDMRMKLV 368

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG+EL LP+  V RHP PGPGLAIR  GE+T E++ IL+++D+IY E
Sbjct: 369 EPLRDLFKDEVRALGRELGLPEEIVGRHPFPGPGLAIRIPGEVTREKVQILQKADSIYLE 428

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTAD Y   M FL
Sbjct: 429 EIRAAGLYDAIWQAFAVLLPVKTVGVMGDGRTYDSVCALRAVTSTDGMTADVYPFSMEFL 488

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 489 TRVAGRIVNEVRGINRVTYDITSKPPGTIEWE 520


>gi|94496230|ref|ZP_01302808.1| GMP synthase [Sphingomonas sp. SKA58]
 gi|94424409|gb|EAT09432.1| GMP synthase [Sphingomonas sp. SKA58]
          Length = 523

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/515 (62%), Positives = 384/515 (74%), Gaps = 4/515 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LI+DFGSQ TQLIARRVRE+ VY E+  F  A + F+   P+ IILSGSPA   D  SP
Sbjct: 9   ILIVDFGSQVTQLIARRVREAGVYSEIAPFTAAAEAFERLKPKGIILSGSPAGVPDEGSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTK----NSQSREFGRAFIEIKKNCSLLKGM 125
           + P+ + ++ +P+LGICYGQQ+M   LGG+ +      +  EFGRAF+ + + C+L  G+
Sbjct: 69  RAPQALFDAGVPILGICYGQQVMSHQLGGEVRPGHETGEGGEFGRAFLTVTEPCALFDGL 128

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           WE G + QVWMSHGD+V     GF ++A SD  PFA IADE RK+Y  QFHPEVVHT  G
Sbjct: 129 WEVGERHQVWMSHGDKVTQFAPGFRIVAVSDGAPFAVIADEDRKFYGTQFHPEVVHTPDG 188

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            +LI NFV HV G+  +W M+ + +  ++ I+ QVG+ RVIC +SGGVDS VAA LI+EA
Sbjct: 189 GKLIANFVRHVCGLAGDWTMAEFRQVKIAEIRSQVGDGRVICGLSGGVDSAVAAVLIHEA 248

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MR  E E ++SLF+ +    L  V+A +RF+  L  + DPE KRK 
Sbjct: 249 IGDQLTCVFVDHGLMRLGEAEQVVSLFREHYGIKLVHVNAEDRFLGGLAGLTDPEKKRKF 308

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG  FI VFEEEA KIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+M
Sbjct: 309 IGGEFIAVFEEEAAKIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNM 368

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR+LGKEL LPD FV RHP PGPGLAIR  GE+T+ER +ILR++DAI
Sbjct: 369 KLVEPLRELFKDEVRVLGKELGLPDIFVGRHPFPGPGLAIRIPGEVTKERCDILRKADAI 428

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y EEI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC++RAVTS DGMTAD Y  D 
Sbjct: 429 YLEEIRSAGLYDAIWQAFAVLLPVRTVGVMGDHRTYDSVCAVRAVTSTDGMTADIYPFDA 488

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FLS+VA RI+NEVKGINRVVYD TSKPP TIEWE
Sbjct: 489 AFLSRVATRIINEVKGINRVVYDYTSKPPGTIEWE 523


>gi|220921297|ref|YP_002496598.1| GMP synthase [Methylobacterium nodulans ORS 2060]
 gi|219945903|gb|ACL56295.1| GMP synthase, large subunit [Methylobacterium nodulans ORS 2060]
          Length = 518

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/512 (62%), Positives = 387/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LIIDFGSQ TQLIARRVRE  VY E++ ++ A   F    P+A+ILSG P S     S
Sbjct: 7   KILIIDFGSQVTQLIARRVREEGVYSEIVPYQAAEAAFAALKPKAVILSGGPESVTIETS 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+LGICYG+Q M   LGG+ +     EFGRA IE+  + +L KG+W  
Sbjct: 67  PRAPQGVFEAGVPVLGICYGEQTMAAQLGGEVEGGHHAEFGRAEIEVIADSALFKGIWHV 126

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD+V  +PEGF  IA S + PFA +ADE R++YAVQFHPEV HT  G+ L
Sbjct: 127 GEKYPVWMSHGDRVTKLPEGFSTIAISPNAPFAAVADEARRFYAVQFHPEVAHTPHGALL 186

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  +AG   +W M ++ +E + RI+ QVG  +V+C +SGGVDS VAA LI+EAIG 
Sbjct: 187 LRNFVRDIAGCSGDWSMRAFREEAIERIRAQVGTGKVLCGLSGGVDSAVAAVLIHEAIGE 246

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R  E E ++ LF+ + N PL  V A + F+  L  + DPE KRK IG+
Sbjct: 247 QLTCVFVDHGLLRLGEAEEVVRLFRDHYNIPLVHVQAQDLFLGALAGVTDPEVKRKTIGR 306

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EAKKIGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 307 LFIDVFEAEAKKIGGAAFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 366

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL LPD+FV RHP PGPGLAIRC GEIT E+++ LR++DAIY E
Sbjct: 367 EPLRELFKDEVRVLGRELGLPDAFVGRHPFPGPGLAIRCPGEITAEKLDALRKADAIYLE 426

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KA +Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 427 EIRKADLYDAIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMTFL 486

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 487 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 518


>gi|296116400|ref|ZP_06835014.1| GMP synthase [Gluconacetobacter hansenii ATCC 23769]
 gi|295976993|gb|EFG83757.1| GMP synthase [Gluconacetobacter hansenii ATCC 23769]
          Length = 532

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/512 (61%), Positives = 387/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARRVRES VYCE+  F +     +   P+ IILSGSPAS+LD  +
Sbjct: 21  RILILDFGSQVTQLIARRVRESGVYCEIWPFSSDEAKIRAFAPRGIILSGSPASTLDEGA 80

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+IP  +   N+P+LGICYGQQ MC  LGG  ++ + REFGRA IEI K+C+L +G W +
Sbjct: 81  PRIPDVVFALNVPVLGICYGQQAMCLQLGGAVEHHEHREFGRAHIEIVKDCALFRGTWAR 140

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           GS++QVWMSHGD+V  +P GF+ +A S+  P+A IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 141 GSREQVWMSHGDRVTKLPPGFQAVAISEGAPYAIIADEGRRLYGVQFHPEVVHTPHGAAL 200

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H VAG +  W M+ +    ++RI+EQVG  RVIC +SGGVDS+VAA LI++AIG 
Sbjct: 201 LRNFTHDVAGCRGTWTMAGFRDMEIARIREQVGKGRVICGLSGGVDSSVAAVLIHQAIGE 260

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD G +R  E + +I  F+   N  L   DAS+ F+  L+ + DPE KRK IG+
Sbjct: 261 QLTCIFVDPGILRAGEADEVIKTFRDRFNIHLIHRDASDLFLSALEGVSDPEIKRKTIGR 320

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIEVFEEEA K+GGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M MKLV
Sbjct: 321 LFIEVFEEEAAKLGGAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKMKLV 380

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P++ V RHP PGPGLAIR  G IT E++ +LR  D ++ E
Sbjct: 381 EPLRELFKDEVRALGRELDIPEAIVGRHPFPGPGLAIRIPGAITREKLALLRRVDTVFLE 440

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+Y C+LRAVTS DGMTAD Y  DM FL
Sbjct: 441 EIRAAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDYACALRAVTSTDGMTADVYPFDMGFL 500

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNE++GINRV YDITSKPP TIEWE
Sbjct: 501 NRVAGRIVNEIRGINRVTYDITSKPPGTIEWE 532


>gi|312114447|ref|YP_004012043.1| GMP synthase, large subunit [Rhodomicrobium vannielii ATCC 17100]
 gi|311219576|gb|ADP70944.1| GMP synthase, large subunit [Rhodomicrobium vannielii ATCC 17100]
          Length = 525

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/519 (60%), Positives = 392/519 (75%), Gaps = 5/519 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +  VLI+DFGSQ TQLIARRVRE+ VYCE+  +++A   F+   P+ +ILSG P +    
Sbjct: 7   TDAVLIVDFGSQVTQLIARRVREAGVYCEIHPYQSAAAAFETLKPKGVILSGGPDTVTRE 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P+ + ++ +P+L ICYGQQ +   LGG  +   + EFGRA +EI K   L  G+W
Sbjct: 67  GSPRAPQAVFDAGVPILAICYGQQTLALQLGGDVEGGHAAEFGRADVEILKPSPLFDGIW 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           + G +  VWMSHGD+V   PEGFEVI  S++ PFA + +E ++YY   FHPEVVHT  G+
Sbjct: 127 QVGQRYPVWMSHGDRVTRAPEGFEVIGVSENAPFAILVNEAKRYYTTMFHPEVVHTPDGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NFVH + G++ +W MS+Y  E++ +I+EQVGNERVIC +SGGVDS+VAA LI+EAI
Sbjct: 187 KLLSNFVHKIVGLKSDWTMSAYRAEMIRKIREQVGNERVICGLSGGVDSSVAAVLIHEAI 246

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ VDHG MR  E E ++ +F+ + N PL  VDAS+ FI +L+   DPE KRK I
Sbjct: 247 GDQLTCIYVDHGLMRLGESEQVVGMFRDHYNIPLVHVDASDLFIDQLEGEADPEKKRKTI 306

Query: 307 GQLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE 361
           G+LFIEVFE EAKKI     G  +FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE
Sbjct: 307 GRLFIEVFEAEAKKIAADGRGAPRFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPE 366

Query: 362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRE 421
            M MKLVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIR  G +T E+++ILR+
Sbjct: 367 RMHMKLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRLPGGVTREKLDILRK 426

Query: 422 SDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFY 481
           +DAIY +EI KAG+Y  IWQAF+VLLPVQTVGVMGD RTY+ V +LRAVTS+DGMTADF+
Sbjct: 427 ADAIYLDEIRKAGLYDHIWQAFSVLLPVQTVGVMGDGRTYDRVLALRAVTSVDGMTADFF 486

Query: 482 HHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             DM FL + A RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 487 PFDMGFLGRTATRIINEVKGVNRVVYDVTSKPPGTIEWE 525


>gi|114797176|ref|YP_760512.1| GMP synthase [Hyphomonas neptunium ATCC 15444]
 gi|114737350|gb|ABI75475.1| GMP synthase [Hyphomonas neptunium ATCC 15444]
          Length = 526

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/514 (62%), Positives = 391/514 (76%), Gaps = 3/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD--YFKEQNPQAIILSGSPASSLDI 66
           +VLI+DFGSQ TQLIARR+RES VYCE+  F N +D  +     PQA+ILSG PAS    
Sbjct: 14  RVLIVDFGSQVTQLIARRLRESGVYCEIHPF-NKVDGAFLAAFGPQALILSGGPASVTWK 72

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P   + I +S +P+LGICYGQQ+M   LGGK ++  SREFGRAFIE  +   +L+G++
Sbjct: 73  DAPLADQAIFDSGLPILGICYGQQVMMHQLGGKVESGTSREFGRAFIEQVEADPILEGLF 132

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E  + +QVWMSHGD V  +  GF VIA S   P+A IAD +RK+Y  QFHPEVVHT  G+
Sbjct: 133 EGDNSEQVWMSHGDHVAEMAPGFGVIARSPGAPYAVIADPERKFYGTQFHPEVVHTTHGA 192

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NF H VAG++ +W M++Y  E + +I+ QVG  RVIC +SGGVDS+VAA LI+EAI
Sbjct: 193 RLLRNFTHGVAGLKGDWTMAAYRAEAIQKIRNQVGKGRVICGLSGGVDSSVAAVLIHEAI 252

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG MR  E E ++SLF+ + N PL  VDASE F+ +L  + DPE KRK+I
Sbjct: 253 GDQLTCVYVDHGLMRAGESEQVVSLFREHYNIPLVHVDASELFLGQLDGVTDPEKKRKII 312

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFI+VF+ EA KIGGA FL QGTLYPDVIES+S  GGPS  IKSHHNVGGLP  M MK
Sbjct: 313 GGLFIDVFDAEANKIGGADFLAQGTLYPDVIESVSAIGGPSVTIKSHHNVGGLPARMKMK 372

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP++FV RHP PGPGLAIR  G IT E+ + LR++DAIY
Sbjct: 373 LVEPLRELFKDEVRALGRELGLPEAFVGRHPFPGPGLAIRIPGAITREKADTLRKADAIY 432

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y +IWQAF+VLLPV TVGVMGDERTYE V +LRAVTS DGMTAD+Y  +  
Sbjct: 433 IDEIRKAGLYDEIWQAFSVLLPVNTVGVMGDERTYEAVLALRAVTSTDGMTADYYPFEHA 492

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +VA RI+NEVKG+NRVVYD+TSKPP TIEWE
Sbjct: 493 FLGRVATRIINEVKGVNRVVYDVTSKPPGTIEWE 526


>gi|170739288|ref|YP_001767943.1| GMP synthase [Methylobacterium sp. 4-46]
 gi|168193562|gb|ACA15509.1| GMP synthase, large subunit [Methylobacterium sp. 4-46]
          Length = 518

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/512 (60%), Positives = 386/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LIIDFGSQ TQLIARRVRE  VY E++ ++ A   F    P+ +ILSG P S     S
Sbjct: 7   KILIIDFGSQVTQLIARRVREEGVYSEIVPYQAAEAAFAALKPKGVILSGGPESVTIETS 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+LGICYG+Q M   LGG+ +     EFGRA +E+  + +L +G+W  
Sbjct: 67  PRAPQAVFEAGVPVLGICYGEQTMAAQLGGEVEGGHHAEFGRAEVEVIADSALFRGIWHV 126

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSHGD+V  +P+GF  IA S + PFA +ADE R++YAVQFHPEV HT  G+ L
Sbjct: 127 GERYPVWMSHGDRVTKLPDGFSTIAISPNAPFAAVADEGRRFYAVQFHPEVAHTPHGALL 186

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  + G   +W M ++ +E + RI+ QVG E+V+C +SGGVDS VAA LI+EAIG 
Sbjct: 187 LRNFVRDIVGCAGDWSMRAFREEAIERIRRQVGGEKVLCGLSGGVDSAVAAVLIHEAIGE 246

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +R  E E ++ LF+ + N PL  V A + F+  L  + DPE KRK IG+
Sbjct: 247 QLTCVFVDHGLLRLGEAEEVVRLFRDHYNIPLVHVQAQDLFLGALAGVTDPEVKRKTIGR 306

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFE EA+K GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 307 LFIDVFEAEARKSGGAAFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 366

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL LPD+FV RHP PGPGLAIRC GEIT E+++ LR++DAIY E
Sbjct: 367 EPLRELFKDEVRVLGRELGLPDAFVGRHPFPGPGLAIRCPGEITAEKLDALRKADAIYLE 426

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF V+LPV+TVGVMGD RTY++VC+LRAVTS+DGMTADFY  DM FL
Sbjct: 427 EIRKAGLYDTIWQAFAVILPVKTVGVMGDGRTYDHVCALRAVTSVDGMTADFYPFDMGFL 486

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 487 GRVATRIINEVKGINRVTYDITSKPPGTIEWE 518


>gi|114327814|ref|YP_744971.1| GMP synthase [Granulibacter bethesdensis CGDNIH1]
 gi|114315988|gb|ABI62048.1| GMP synthase (glutamine-hydrolyzing) [Granulibacter bethesdensis
           CGDNIH1]
          Length = 522

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/512 (61%), Positives = 384/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ TQLIARRVRES VYCE+  F    +  +   PQ IILSG P+S     S
Sbjct: 11  RVLILDFGSQVTQLIARRVRESGVYCEIWPFTADAERIRTYAPQGIILSGGPSSVALAGS 70

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P  +   +IP+LGICYGQQ MC  LGG  + +  +EFGRA +++ +NC +  G+WEK
Sbjct: 71  PRAPDVVFSMDIPVLGICYGQQTMCVQLGGSVEGNDHQEFGRAHVDVVENCRITDGLWEK 130

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G+++QVWMSHGD+V  +P GF  +A S+  PFA IAD+ R++Y VQFHPEV+HT  G+QL
Sbjct: 131 GAREQVWMSHGDRVTALPPGFRAVAVSEGAPFAMIADDDRRFYGVQFHPEVIHTPHGTQL 190

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H V G    W M+++    + RI+E VG  RVIC +SGGVDSTVAA LI+EAIG 
Sbjct: 191 LRNFTHAVCGCSGGWSMAAFRPAEIKRIREIVGEGRVICGLSGGVDSTVAAVLIHEAIGD 250

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG +R++E E ++++F+   N  L   DAS+ F+  L+ + DPE KRK IG+
Sbjct: 251 QLTCIFVDHGLLRQSEAEQVLAMFRDRFNIKLVHRDASDLFLGALEGVSDPEVKRKTIGK 310

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI+VFEEEA KIGGA FL QGTLYPDVIESISF GGPS  IKSHHNVGGLPE M MKLV
Sbjct: 311 LFIDVFEEEAAKIGGADFLAQGTLYPDVIESISFTGGPSVTIKSHHNVGGLPERMRMKLV 370

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG EL LP   V RHP PGPGLAIR  G I+++R+ ILR +DAIY E
Sbjct: 371 EPLRELFKDEVRALGLELGLPKEMVGRHPFPGPGLAIRIPGAISKDRLEILRRADAIYLE 430

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y +IWQAF VLLPV+TVGVMGD RTY++ C+LRAVTS DGMTAD Y  D+ F+
Sbjct: 431 EIRNAGLYDEIWQAFAVLLPVRTVGVMGDGRTYDFACALRAVTSTDGMTADVYPFDIKFI 490

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 491 ARVANRIVNEVRGINRVAYDITSKPPGTIEWE 522


>gi|315499649|ref|YP_004088452.1| gmp synthase, large subunit [Asticcacaulis excentricus CB 48]
 gi|315417661|gb|ADU14301.1| GMP synthase, large subunit [Asticcacaulis excentricus CB 48]
          Length = 516

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/512 (61%), Positives = 395/512 (77%), Gaps = 1/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           KVLIIDFGSQ TQLIARRVRE  VYCE+  F  A +  K   P A+ILSGSP S ++   
Sbjct: 6   KVLIIDFGSQVTQLIARRVRECGVYCEIHPFTKAAEAIKSVAPNAVILSGSPHSVVEA-G 64

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P + K + +  +P+ GICYG+Q+MC  LGGK ++   REFGRA IEI  +  L +G+ + 
Sbjct: 65  PTVDKALFDMGLPVFGICYGEQLMCDLLGGKVESGHDREFGRAEIEIAADTPLFRGLGKP 124

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K+ VWMSHGD+V  IPE F+VIA S+  PFA IADE R++YAVQFHPEVVHTV G+Q+
Sbjct: 125 GDKEIVWMSHGDRVTAIPERFKVIAVSEGAPFAAIADEARRFYAVQFHPEVVHTVRGTQM 184

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NF+  VAG++ +W M+++ +E++ +I+ QVG+ RVIC +SGGVDS+VAA LI+EAIG 
Sbjct: 185 IRNFLFEVAGLKGDWTMAAFRQEMIEKIRAQVGSGRVICGLSGGVDSSVAAVLIHEAIGE 244

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VD G +RKNE E ++SLF+ + N PL  V A ++F+  LK + DPE KRK IG+
Sbjct: 245 QLTCVFVDTGLLRKNEGEQVVSLFRDHYNIPLIHVQAQDKFLGALKGLSDPEQKRKTIGR 304

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIEVF+EEA KI GA+FL QGTLYPDV+ES+S  GGPS++IKSHHNVGGLP++M +KLV
Sbjct: 305 LFIEVFDEEAAKIDGAEFLAQGTLYPDVVESVSPHGGPSTVIKSHHNVGGLPDYMKLKLV 364

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL L ++FV RHP PGPGLAIR  GE+T E++  L+++DAIY +
Sbjct: 365 EPLRELFKDEVRALGRELGLSEAFVGRHPFPGPGLAIRIPGEVTPEKVRTLQDADAIYLD 424

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADFY      L
Sbjct: 425 EIRKAGLYNDIWQAFAVLLPVKTVGVMGDARTYEDVLALRAVTSSDGMTADFYEFPWPVL 484

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RIVNEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 485 GRCATRIVNEVRGVNRVVYDVTSKPPGTIEWE 516


>gi|114569735|ref|YP_756415.1| GMP synthase [Maricaulis maris MCS10]
 gi|114340197|gb|ABI65477.1| GMP synthase (glutamine-hydrolyzing) [Maricaulis maris MCS10]
          Length = 519

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/517 (59%), Positives = 404/517 (78%), Gaps = 1/517 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ-NPQAIILSGSPASS 63
           ++  K+LIIDFGSQ TQLIARRVRES V+CE+  +  A   F +  +P+AIILSGSP S+
Sbjct: 3   DQHDKLLIIDFGSQVTQLIARRVRESGVFCEIHPYNRADAAFIDAYDPKAIILSGSPHST 62

Query: 64  LDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK 123
              +SP+    +    IP+LGICYG+Q MC  LGG+ + S+ REFGRA I++ ++  L  
Sbjct: 63  HWDNSPRADASVFTRGIPVLGICYGEQTMCAQLGGRVEASEEREFGRADIKLVEDSPLFA 122

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G    G +++VWMSHGD+V  +PEGF+VIA+S + P+A IADE RK+Y VQFHPEVVHT 
Sbjct: 123 GFGPVGHEERVWMSHGDRVAALPEGFKVIATSGNAPYAAIADETRKFYGVQFHPEVVHTP 182

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G+ L++NF H +AG+  +W M+++  E +++I+EQVG++RV+C +SGGVDS+VAA L++
Sbjct: 183 RGAALLENFTHKIAGLTGDWSMANFKDEAIAKIREQVGDKRVLCGLSGGVDSSVAAVLLH 242

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  L CV VD G MR+ E + +++LF+ + N PL   +A + F+  LK + DPE KR
Sbjct: 243 EAIGDQLVCVFVDTGLMRQGEADEVVTLFREHYNIPLVHAEAEDLFLTALKGVDDPEKKR 302

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG LFI+VF+E+AK+ GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M
Sbjct: 303 KIIGSLFIDVFDEKAKEAGGADFLAQGTLYPDVIESVSFDGGPSVTIKSHHNVGGLPARM 362

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            MKLVEPL+ELFKDEVR LG+EL LPD+FV RHP PGPGLAIR  G +++E+ +ILR++D
Sbjct: 363 KMKLVEPLRELFKDEVRALGRELGLPDAFVGRHPFPGPGLAIRIPGAVSKEKADILRKAD 422

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AIY EEI KAG+Y +IWQAF+VLLPV TVGVMGDERTY+ V +LRAVTS+DGMTAD+Y +
Sbjct: 423 AIYIEEIKKAGLYDEIWQAFSVLLPVNTVGVMGDERTYDAVLALRAVTSVDGMTADYYPY 482

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + +FLS+VA RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 483 EHDFLSRVATRIINEVRGVNRVVYDVTSKPPGTIEWE 519


>gi|83309831|ref|YP_420095.1| GMP synthase [Magnetospirillum magneticum AMB-1]
 gi|82944672|dbj|BAE49536.1| GMP synthase [Magnetospirillum magneticum AMB-1]
          Length = 518

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/517 (60%), Positives = 392/517 (75%), Gaps = 3/517 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLD 65
           S ++LI+DFGSQ TQLIARRVRE+ VYCE+  F   ++D  +E  P+ +ILSG PAS  D
Sbjct: 2   SERILIVDFGSQVTQLIARRVREAGVYCEIHPFNRVSVDSIREFGPKGVILSGGPASVAD 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             SP+ P+ + E  +P+LGICYGQQ MC+ LGGK +    REFGRA +++  + C+L  G
Sbjct: 62  FGSPRAPQGLFEMGLPILGICYGQQTMCEQLGGKVEPGDHREFGRAMLQVSGEPCALFDG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +  KG + QVWMSHGD+V  IP GF+V+A+S+  PFA IA+  +++Y VQFHPEVVHT  
Sbjct: 122 IAAKGDEVQVWMSHGDRVTAIPPGFKVVATSEGAPFAAIANADKRFYGVQFHPEVVHTPI 181

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G QL+ NFVH + G   +W M ++  + +++++ QVG+ RVIC +SGGVDS+V A L++E
Sbjct: 182 GKQLLSNFVHKIVGCAGDWTMKAFRAQEIAKVRAQVGSGRVICGLSGGVDSSVVAALLHE 241

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VD GFMR  E E ++S+F+   N  L   DAS  F+ KL ++ DPE KRK
Sbjct: 242 AIGDQLTCVFVDTGFMRAGESEQVVSVFRDRFNIKLVHKDASGLFLDKLASLTDPEKKRK 301

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FI+VFEEEAK +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+
Sbjct: 302 IIGATFIDVFEEEAKAVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMN 361

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGE-ITEERINILRESD 423
           MKLVEPL+ELFKDEVR LG+EL LP   V RHP PGPGLAIR  G+ +T E ++ILR++D
Sbjct: 362 MKLVEPLRELFKDEVRALGRELGLPADMVGRHPFPGPGLAIRIPGQPLTRENLDILRKAD 421

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           +IY +EI KAG+Y +IWQAF VLLPV+TVGVMGD R+Y+Y C+LRAVTS DGMTADFY  
Sbjct: 422 SIYLDEIRKAGLYDEIWQAFAVLLPVRTVGVMGDSRSYDYACALRAVTSTDGMTADFYPF 481

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           DM F+ +VA RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 482 DMAFIGRVANRIINEVKGINRVTYDITSKPPGTIEWE 518


>gi|197104883|ref|YP_002130260.1| GMP synthase [Phenylobacterium zucineum HLK1]
 gi|254800109|sp|B4R9R7|GUAA_PHEZH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|196478303|gb|ACG77831.1| GMP synthase [Phenylobacterium zucineum HLK1]
          Length = 520

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/511 (60%), Positives = 388/511 (75%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLI+DFGSQ TQLIARR+RES VYCE+  +           P+A+ILSG PAS  + +SP
Sbjct: 10  VLIVDFGSQVTQLIARRLRESGVYCEIHPYDKVDAVLDSFRPKAVILSGGPASVHEAESP 69

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              K + E ++P+LGICYG+Q MC  LGGK +   +REFGRA IEI +   LL G+   G
Sbjct: 70  AASKRLFELDVPVLGICYGEQTMCDVLGGKVEPGTTREFGRAEIEIVRESPLLDGLGGAG 129

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             + VWMSHGD+V  +P GFE +A S+ +PFA IADE R++Y +QFHPEV HT  G+ ++
Sbjct: 130 HFEPVWMSHGDKVTALPMGFETVAVSEGSPFAVIADEGRRFYGIQFHPEVAHTPRGALIL 189

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF H +AG++ +W M ++ +E ++RI++QVG+ R+IC +SGGVDS+VAA LI+EAIG  
Sbjct: 190 RNFTHKIAGLKGDWTMKAFREEAIARIRDQVGDGRIICGLSGGVDSSVAAVLIHEAIGDQ 249

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +R NE E ++++F+ + N PL  VDA+E F+  L  + DPETKRK IG+L
Sbjct: 250 LTCVFVDHGLLRLNEAEQVVTMFRDHYNIPLVHVDAAEEFLGALAGVTDPETKRKTIGRL 309

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           F+EVF+ EA KI GA FL QGTLYPDVIES+S  GGPS++IKSHHNVGGLP++M +KLVE
Sbjct: 310 FVEVFDREAAKIEGAAFLAQGTLYPDVIESVSARGGPSAVIKSHHNVGGLPDYMKLKLVE 369

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG EL LP  FV RHP PGPGLAIR  GE+T ER+ IL+++DAIY +E
Sbjct: 370 PLRELFKDEVRALGVELGLPPQFVGRHPFPGPGLAIRIPGEVTPERVAILQKADAIYLDE 429

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y  IWQAF VLLPV+TVGVMGD RTY+ VC+LRAVTS DGMTADF+      LS
Sbjct: 430 IRKAGLYDSIWQAFAVLLPVRTVGVMGDARTYDEVCALRAVTSTDGMTADFFEFPWEVLS 489

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 490 RAATRIINEVRGINRVVYDVTSKPPGTIEWE 520


>gi|154251625|ref|YP_001412449.1| GMP synthase [Parvibaculum lavamentivorans DS-1]
 gi|154155575|gb|ABS62792.1| GMP synthase, large subunit [Parvibaculum lavamentivorans DS-1]
          Length = 526

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/512 (60%), Positives = 385/512 (75%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ TQLIARRVRES VYCE++ F  A +      P+AIILSG PAS      
Sbjct: 15  RILIVDFGSQVTQLIARRVRESGVYCEIVPFNKADEMLDTFEPKAIILSGGPASVTVETG 74

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+    + E  +P+LGICYG+Q MC  LGGK + S  +EFGRA IEI + C+L +G+ + 
Sbjct: 75  PRASLRVFELGVPVLGICYGEQTMCVELGGKVEGSDHQEFGRASIEIVEECALFEGLMKV 134

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G  + VWMSHGD+V  +PEGF+V+A S   PFA IADE R++Y VQFHPEV+HT  G  +
Sbjct: 135 GDTEPVWMSHGDRVVALPEGFKVVAISRGAPFAAIADETRRFYGVQFHPEVMHTPRGRDM 194

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H +AG   +W M+++ +  +++++ QVG  RVIC +SGGVDS+V A L++EAIG 
Sbjct: 195 LWNFTHKIAGCSGDWTMAAFRETEIAKVRAQVGKGRVICGLSGGVDSSVVAVLLHEAIGD 254

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L CV VD G MR  E E ++SLF+ + N PL   DAS+ F+ KL+ + DPE KRK+IG 
Sbjct: 255 QLQCVFVDTGMMRAGEAEQVVSLFRNHYNIPLVHRDASDLFLGKLEGVSDPEKKRKIIGA 314

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI+VFEEEA+ IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKLV
Sbjct: 315 TFIDVFEEEARNIGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNMKLV 374

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP  FV RHP PGPGLAIR  GEIT E++ ILR++D +Y E
Sbjct: 375 EPLRELFKDEVRELGRELGLPPDFVGRHPFPGPGLAIRIPGEITREKLEILRKADTVYLE 434

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y +IWQAF VLLPV+TVGVMGD RTY+YVC+LRAVTS DGMTAD+Y     FL
Sbjct: 435 EIRSAGLYDEIWQAFAVLLPVRTVGVMGDGRTYDYVCALRAVTSTDGMTADYYPFSHEFL 494

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            QV+ RI+NEV+GINRVVYD+TSKPP TIEWE
Sbjct: 495 GQVSTRIINEVRGINRVVYDVTSKPPGTIEWE 526


>gi|83591695|ref|YP_425447.1| GMP synthase [Rhodospirillum rubrum ATCC 11170]
 gi|91206825|sp|Q2RXI5|GUAA_RHORT RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|83574609|gb|ABC21160.1| GMP synthase (glutamine-hydrolyzing) [Rhodospirillum rubrum ATCC
           11170]
          Length = 525

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/516 (60%), Positives = 382/516 (74%), Gaps = 2/516 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLD 65
           + ++LIIDFGSQ TQLIARRVRES VY E+  F            P+ +ILSG PAS   
Sbjct: 10  TDRILIIDFGSQVTQLIARRVRESGVYSEIQPFNTVTAASIAAFAPKGVILSGGPASVTA 69

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
            D+P+ P E+    +P+LGICYGQQ M   LGG+ +    REFGRAF+E+   C+L  G+
Sbjct: 70  ADTPRAPIELFTMGLPVLGICYGQQTMVAQLGGRVEAPDHREFGRAFVEVTAGCALFDGV 129

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W  G + QVWMSHGD+V+ IPEGF V+A S+  P+A IADE R +Y VQFHPEVVHT  G
Sbjct: 130 WTPGERDQVWMSHGDRVDAIPEGFSVVAVSEGAPYAAIADEARHFYGVQFHPEVVHTPKG 189

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           + L+ NF H + G   +W M+++  + ++R++EQVG+ RVIC +SGGVDS+V A LI+EA
Sbjct: 190 AALLRNFTHGICGCGGDWTMAAFKDQAIARVREQVGSGRVICGLSGGVDSSVVAALIHEA 249

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L CVLVDHG MR+ E E ++ +F+   N  L   DASE F+ KL  +VDPE KRK+
Sbjct: 250 IGEQLVCVLVDHGMMRQGETEQVVRVFRDRFNITLVHRDASELFLGKLDGVVDPEAKRKI 309

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG  FI+VF+EEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M M
Sbjct: 310 IGATFIDVFDEEARKVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKM 369

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGE-ITEERINILRESDA 424
            LVEPL+ELFKDEVR LG+EL LPD  V RHP PGPGLAIR  G+ +T E+++ILR +DA
Sbjct: 370 ALVEPLRELFKDEVRDLGRELGLPDEMVGRHPFPGPGLAIRIPGQPLTREKLDILRRADA 429

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY EEI  AG+Y  IWQAF VLLPV+TVGVMGD R+Y++  +LRAVTS DGMTAD+Y  D
Sbjct: 430 IYLEEIRNAGLYDVIWQAFAVLLPVRTVGVMGDARSYDFALALRAVTSTDGMTADYYPFD 489

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +VA RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 490 HTFLGRVANRIINEVKGVNRVVYDITSKPPGTIEWE 525


>gi|295689966|ref|YP_003593659.1| GMP synthase large subunit [Caulobacter segnis ATCC 21756]
 gi|295431869|gb|ADG11041.1| GMP synthase, large subunit [Caulobacter segnis ATCC 21756]
          Length = 520

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/520 (59%), Positives = 396/520 (76%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M       +VLI+DFGSQ TQLIARRVRE+ VYCE+  F  A     E  P AIILSG P
Sbjct: 1   MTPEPNHQRVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAVVDEYKPSAIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS L+ DSP+I +++ +  +PLL ICYGQQ++C  LGGK +   + EFGRA + + K+  
Sbjct: 61  ASVLEADSPRIGRKLFDLGLPLLAICYGQQLLCDVLGGKVEGGHAGEFGRAELTVGKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + +G+   G  + VWMSHGD+V  IP+GFEVIA+S   PFA IA++ +K YA+QFHPEV 
Sbjct: 121 MFQGLAGVGGVETVWMSHGDRVTAIPDGFEVIATSTGAPFAAIANDAKKIYALQFHPEVY 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HTV G+++  NF+ ++AG++ +W M+++ +E+V +I++QVG  +VIC +SGGVDS+VAA 
Sbjct: 181 HTVNGAKMYRNFLFNIAGLKGDWTMAAFRQEMVQKIRDQVGTGKVICGLSGGVDSSVAAV 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VD G +RKNE E +++LF+ + N PL  VDA + F+ +L  + DPE
Sbjct: 241 LIHEAIGDQLTCVFVDTGLLRKNEAEQVVTLFRDHYNIPLVHVDAGDLFLGELAGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK IG+LFI+VF++EA KI GAQFL QGTLYPDV+ES+S  GGPS++IKSHHNVGGLP
Sbjct: 301 TKRKTIGRLFIDVFDKEAAKIDGAQFLAQGTLYPDVVESVSARGGPSAVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           ++M +KLVEPL+ELFKDEVR LG EL L  +FV RHP PGPGLAIR  GEIT E++ +L+
Sbjct: 361 DYMKLKLVEPLRELFKDEVRALGVELGLAPAFVGRHPFPGPGLAIRIPGEITPEKVKVLQ 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DAIY EEI  AG+Y +IWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADF
Sbjct: 421 EADAIYLEEIRNAGLYDQIWQAFAVLLPVKTVGVMGDARTYENVLALRAVTSTDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +      L + A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 481 FEFPWPVLGKTATRIINEVRGVNRVVYDVTSKPPGTIEWE 520


>gi|329889248|ref|ZP_08267591.1| GMP synthase glutamine-hydrolyzing [Brevundimonas diminuta ATCC
           11568]
 gi|328844549|gb|EGF94113.1| GMP synthase glutamine-hydrolyzing [Brevundimonas diminuta ATCC
           11568]
          Length = 520

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/520 (60%), Positives = 390/520 (75%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +  +  KVLI+DFGSQ TQLIARR+RE+ VYCE+  +  A +  K   PQAIILSG P
Sbjct: 1   MTQPTQHQKVLIVDFGSQVTQLIARRLREAGVYCEIHPYNKAGEALKAMQPQAIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ + DSP++   + +   P+LGICYG+Q++C  LGGK ++    EFGRA I I K+  
Sbjct: 61  NSTTEADSPRVDHAVFDYGAPILGICYGEQLICAELGGKVESGHHAEFGRAEIVITKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L  G+     ++ VWMSHGD+V  +PEGF VIA+S+  PFA IADE RK Y VQFHPEVV
Sbjct: 121 LFAGIGALDHREPVWMSHGDRVTALPEGFHVIATSEGAPFAAIADETRKIYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G+QL+ NF H VAG+  +W M++Y  E +++I+EQVG+ +VIC +SGGVDS+VAA 
Sbjct: 181 HTPRGAQLLKNFTHGVAGLTGDWTMAAYRDEQIAKIREQVGDAKVICGLSGGVDSSVAAV 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VD G +RK+E + +  LF+ + N PL  VDAS+ F+ +L  I DPE
Sbjct: 241 LIHEAIGDQLTCVFVDTGLLRKDEAKQVTELFREHYNIPLVHVDASKEFLGELAGISDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK IG++FIEVF+ EA KI GA FL QGTLYPDVIES+S  GGPS +IKSHHNVGGLP
Sbjct: 301 TKRKTIGRVFIEVFDREAVKIEGAAFLAQGTLYPDVIESVSPTGGPSHVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M +KLVEPL+ELFKDEVR LG+EL L D+FV RHP PGPGLAIR  GEIT + +  L+
Sbjct: 361 DFMKLKLVEPLRELFKDEVRALGRELGLTDAFVGRHPFPGPGLAIRIPGEITPDAVATLQ 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DAIY +EI KAG+Y  IWQAF VLLPV+TVGV GD RTYE V +LRAVTS DGMTADF
Sbjct: 421 DADAIYLDEIRKAGLYDDIWQAFAVLLPVKTVGVQGDARTYEKVLALRAVTSTDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y    + L++ A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 481 YQFPWDILAKTATRIINEVRGVNRVVYDVTSKPPGTIEWE 520


>gi|83945246|ref|ZP_00957595.1| GMP synthase [Oceanicaulis alexandrii HTCC2633]
 gi|83851416|gb|EAP89272.1| GMP synthase [Oceanicaulis alexandrii HTCC2633]
          Length = 522

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/513 (60%), Positives = 391/513 (76%), Gaps = 1/513 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ-NPQAIILSGSPASSLDID 67
           K L+IDFGSQ TQLIARR+RES VYCEV  F    D F +   P+AIILSG P S     
Sbjct: 10  KALVIDFGSQVTQLIARRLRESGVYCEVHPFNRVDDAFLDAFAPKAIILSGGPNSVHGEG 69

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P+  + + E  +P+LGICYG+Q MC  LGG  + ++ REFGRA IEI  +  L  G+ E
Sbjct: 70  TPRATQSVFERGLPVLGICYGEQTMCAQLGGSVEAAEEREFGRADIEIVADSPLFDGIGE 129

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
            G  ++VWMSHGD+V  IP+GF  IA++   PFA IADE R++Y VQFHPEVV+T  G+ 
Sbjct: 130 VGHLERVWMSHGDRVNAIPQGFHPIAATTHAPFAAIADEGRRFYGVQFHPEVVNTPRGAL 189

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF H +AG++ +W M+++ +E +++I+EQVG+ RVIC +SGGVDS+VAA LI+EAIG
Sbjct: 190 ILRNFTHKIAGMKGDWTMAAFKEEAIAKIREQVGSGRVICGLSGGVDSSVAAVLIHEAIG 249

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             LTCV VD G MR  E + +++LF+ + N PL   D  ERF+  L    DPE KRK IG
Sbjct: 250 DQLTCVFVDTGLMRSGEADQVVTLFREHYNIPLVAADEEERFLSALAGESDPEKKRKTIG 309

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
           +LFI+VFE++AK +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+MKL
Sbjct: 310 KLFIDVFEDKAKGVGGADFLAQGTLYPDVIESVSFDGGPSVTIKSHHNVGGLPERMNMKL 369

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIR  GE+T+++ +ILR++D+IY 
Sbjct: 370 VEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRIPGEVTKDKADILRKADSIYI 429

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EEI KAG+Y  IWQAF VLLPVQTVGVMGD RTY+ V +LRAVTS DGMTAD++  D +F
Sbjct: 430 EEIRKAGLYDSIWQAFAVLLPVQTVGVMGDARTYDNVLALRAVTSTDGMTADYFPFDHDF 489

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L +VA RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 490 LGRVATRIINEVRGVNRVVYDVTSKPPGTIEWE 522


>gi|16125867|ref|NP_420431.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Caulobacter crescentus CB15]
 gi|221234629|ref|YP_002517065.1| GMP synthase [Caulobacter crescentus NA1000]
 gi|24211765|sp|Q9A7U9|GUAA_CAUCR RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|254800091|sp|B8GVI7|GUAA_CAUCN RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|13423021|gb|AAK23599.1| GMP synthase [Caulobacter crescentus CB15]
 gi|220963801|gb|ACL95157.1| GMP synthase (glutamine-hydrolyzing) [Caulobacter crescentus
           NA1000]
          Length = 520

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/520 (58%), Positives = 394/520 (75%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M ++    +VLI+DFGSQ TQLIARRVRE+ VYCE+  F  A     E  P AIILSG P
Sbjct: 1   MTQKTDHQRVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAIVDEYAPSAIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS L+ DSP+I +++ +  +PLL ICYGQQ++C  L GK +   + EFGRA + I K+  
Sbjct: 61  ASVLEADSPRIGRKLFDLGLPLLAICYGQQLLCDVLSGKVEGGHAGEFGRAELTIGKDSP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + +G+   G  + VWMSHGD+V  IPEGFEVI +S   PFA IA++ +K YA+QFHPEV 
Sbjct: 121 MFQGLAGVGGVETVWMSHGDRVTAIPEGFEVIGTSTGAPFAAIANDAKKIYALQFHPEVY 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HTV G  +  NF+ ++AG++ +W M+++ +E+V +I++QVG+ +VIC +SGGVDS+VAA 
Sbjct: 181 HTVNGPAMYRNFLFNIAGLKGDWTMAAFRQEMVQKIRDQVGDGKVICGLSGGVDSSVAAV 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VD G +RKNE + +++LF+ + N PL  VDA + F+ +L  + DPE
Sbjct: 241 LIHEAIGDQLTCVFVDTGLLRKNEADQVVTLFRDHYNIPLVHVDAGDLFLGELAGVSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK IG+LFI+VF++EA KI GA FL QGTLYPDV+ES+S  GGPS++IKSHHNVGGLP
Sbjct: 301 TKRKTIGRLFIDVFDKEAAKIEGATFLAQGTLYPDVVESVSARGGPSAVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           ++M +KLVEPL+ELFKDEVR LG EL L  +FV RHP PGPGLAIR  GEIT E++ +L+
Sbjct: 361 DYMKLKLVEPLRELFKDEVRALGVELGLAPAFVGRHPFPGPGLAIRIPGEITPEKVKVLQ 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DAIY EEI  AG+Y +IWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADF
Sbjct: 421 DADAIYLEEIRNAGLYDQIWQAFAVLLPVKTVGVMGDARTYENVLALRAVTSTDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +      L + A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 481 FEFPWPVLGKTATRIINEVRGVNRVVYDVTSKPPGTIEWE 520


>gi|254420777|ref|ZP_05034501.1| ExsB family [Brevundimonas sp. BAL3]
 gi|196186954|gb|EDX81930.1| ExsB family [Brevundimonas sp. BAL3]
          Length = 520

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/520 (58%), Positives = 393/520 (75%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M   +   KVLI+DFGSQ TQLIARR+RE+ VYCE+  F+ A       NP AIILSG P
Sbjct: 1   MTTPQDHQKVLIVDFGSQVTQLIARRLREASVYCEIHPFQKAEAALAGMNPAAIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  +  SP+ P+ + E+ +P+LGICYG+  MC+ LGGK +   +REFGRA I ++K   
Sbjct: 61  ESVHEEGSPRAPQAVFEAGVPVLGICYGEMTMCEQLGGKVEGGHTREFGRAEITVEKASP 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LL  +   G ++ VWMSHGD++  IP GF+V+ASS  +P+A IADE R++Y VQFHPEV+
Sbjct: 121 LLADLAPVGEEETVWMSHGDKIVAIPAGFDVVASSAGSPYAVIADETRRFYGVQFHPEVM 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q++ NF H +AG++ +W M++Y  E +++I+EQVG+ +VIC +SGGVDS+VAA 
Sbjct: 181 HTPRGHQMLKNFTHGIAGLKGDWTMAAYRDEKIAQIREQVGDAKVICGLSGGVDSSVAAV 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VD G +RK+E + + +LF+ + N PL  VDAS+ F+ +L    DPE
Sbjct: 241 LIHEAIGDQLTCVFVDTGLLRKDEAKQVTTLFREHYNIPLVHVDASKEFLGELAGQSDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG++FIE+F+ EA K+ GA+FL QGTLYPDVIES+S   G + +IKSHHNVGGLP
Sbjct: 301 TKRKIIGRVFIEIFDREANKVEGAEFLAQGTLYPDVIESVSSSSGKAHVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           ++M +KLVEPL+ELFKDEVR LG+EL L D+FV RHP PGPGLAIR  GEIT E +  L+
Sbjct: 361 DYMKLKLVEPLRELFKDEVRALGRELGLSDAFVGRHPFPGPGLAIRIPGEITPEAVETLQ 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DAIY +EI KAG+Y  IWQAF VLLPV+TVGVMGD RTYE V +LRAV+S DGMTADF
Sbjct: 421 QADAIYLDEIRKAGLYDSIWQAFAVLLPVKTVGVMGDARTYEKVLALRAVSSTDGMTADF 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y    + L++ A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 481 YQFPWDVLAKTATRIINEVRGVNRVVYDVTSKPPGTIEWE 520


>gi|167043534|gb|ABZ08230.1| putative GMP synthase C terminal domain protein [uncultured marine
           microorganism HF4000_APKG2J17]
          Length = 537

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/515 (58%), Positives = 391/515 (75%), Gaps = 1/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLD 65
           + +VLI+DFGSQ TQLIARRVRES VY E+  F   + +  +   P+A+ILSG PAS+ D
Sbjct: 23  AERVLIVDFGSQVTQLIARRVRESGVYSEIHPFNQVSEESIRAFQPKAVILSGGPASAGD 82

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
           I++P+ P  + E  +P+LGICYG+  M Q LGG+   S+ +EFGR  +EI  NC+L  G+
Sbjct: 83  IETPRAPDGLWEMGLPVLGICYGEMTMAQQLGGRVTASEHQEFGRTDVEITSNCALFDGV 142

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W+ G   QVWMSHGD++E IP+GF+ +A + + PFA IADE+RK+Y VQFHPEVVHT  G
Sbjct: 143 WKPGQTHQVWMSHGDRIEAIPDGFKAVAITPTAPFAAIADEERKFYGVQFHPEVVHTPDG 202

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L+ NF H +AG   +W M+++    +++I+EQVG  +V+  +SGGVDS+V A L++EA
Sbjct: 203 AKLLKNFTHAIAGCGGDWTMAAFKDMEIAKIREQVGAGQVVLGLSGGVDSSVTAALLHEA 262

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VD G MR+ E + ++ LF+ + N PL   DA + F+ KL  + DPE KRK+
Sbjct: 263 IGEQLTCVFVDTGLMREGEGDQVVELFRDHYNIPLIHRDAGDLFLDKLDGVTDPEEKRKI 322

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG  FI+VFEEEA K+G A+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 323 IGSTFIDVFEEEAAKVGDAEFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKL 382

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP+  V RHP PGPGLAIR +G ++ E++ ILR++DAI
Sbjct: 383 KLVEPLRELFKDEVRALGRELGLPEEMVGRHPFPGPGLAIRLLGGVSREKVEILRQADAI 442

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y +EI  AG+Y +IWQAF VLLPVQTVGVMGD RTY+YV +LRAVTS DGMTAD Y  D 
Sbjct: 443 YLDEIRAAGLYDEIWQAFCVLLPVQTVGVMGDARTYDYVLTLRAVTSTDGMTADSYPFDH 502

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL+ V+ RI+N+V+G+NRVVYD+TSKPP TIEWE
Sbjct: 503 DFLTHVSGRIINQVRGVNRVVYDVTSKPPGTIEWE 537


>gi|148259910|ref|YP_001234037.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Acidiphilium cryptum JF-5]
 gi|326403136|ref|YP_004283217.1| GMP synthase [Acidiphilium multivorum AIU301]
 gi|146401591|gb|ABQ30118.1| GMP synthase (glutamine-hydrolyzing) [Acidiphilium cryptum JF-5]
 gi|325049997|dbj|BAJ80335.1| GMP synthase [Acidiphilium multivorum AIU301]
          Length = 520

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/520 (57%), Positives = 383/520 (73%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M     + ++LI+DFGSQ TQLIARR+RE+ VYCE+  F           P+ IILSG P
Sbjct: 1   MSDAPSADRILILDFGSQVTQLIARRLRETGVYCEIWPFDADPARMAAFAPKGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS ++  +P+ P ++  + +P+LGICYG+Q +C +LGG  + S  REFGRAFI++  +C+
Sbjct: 61  ASVIEEVAPKPPADVFGAGVPVLGICYGEQAICDALGGAVEGSDHREFGRAFIDVTADCA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L +G+W +G + QVWMSHGD+V  +P GF  +A S+  PFA IAD+ R+ Y VQFHPEVV
Sbjct: 121 LFEGVWARGQRAQVWMSHGDRVTALPPGFRAVAVSEGAPFAAIADDARRIYGVQFHPEVV 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L+ NF H V G+   W M+++ +     I+ QVG  RVIC +SGGVDS+VAA 
Sbjct: 181 HTPDGARLLANFAHKVCGLAGGWTMANFRETARDAIRAQVGTGRVICGLSGGVDSSVAAA 240

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  L C+ VDHG +R  E + ++ +F+   N  L   DAS+ F   L+ + DPE
Sbjct: 241 LIHEAIGDQLVCIFVDHGLLRAGEADEVVRVFRDRFNIRLVHRDASDLFFAALEGVTDPE 300

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFIEVFEEEAK +GGA FL QGTLYPDVIES+S  GGPS++IKSHHNVGGLP
Sbjct: 301 VKRKTIGRLFIEVFEEEAKNLGGADFLAQGTLYPDVIESVSARGGPSAVIKSHHNVGGLP 360

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M MKLVEPL+ELFKDEVR LG+EL LP++ V RHP PGPGLAIR  G +  E++ IL+
Sbjct: 361 DRMRMKLVEPLRELFKDEVRELGRELGLPETIVGRHPFPGPGLAIRIPGPVDREKVRILQ 420

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DAIY EEI  AG+Y  IWQAF  LLPV++VGVMGD RTY++ C+LRAVTS DGMTAD 
Sbjct: 421 KADAIYLEEIRNAGLYDAIWQAFVALLPVRSVGVMGDGRTYDFACALRAVTSTDGMTADV 480

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y  DM+FL++VA RIVNEV+GINRV YDITSKPP TIEWE
Sbjct: 481 YPFDMSFLTRVAGRIVNEVRGINRVTYDITSKPPGTIEWE 520


>gi|163797472|ref|ZP_02191423.1| GMP synthase (glutamine-hydrolyzing) [alpha proteobacterium BAL199]
 gi|159177221|gb|EDP61780.1| GMP synthase (glutamine-hydrolyzing) [alpha proteobacterium BAL199]
          Length = 515

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 387/514 (75%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + +VLI+DFGSQFTQLIARRVRE+ VYCE+           E   +A+ILSG PAS    
Sbjct: 2   TDRVLILDFGSQFTQLIARRVRENGVYCEIFPCTVDPSRITEFGAKAVILSGGPASVFGE 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SPQ P  + E  +P+LGICYGQQ+MC  LGG+   S  +EFGRA + +  +C+L  G+ 
Sbjct: 62  GSPQAPMLVFELGVPVLGICYGQQLMCHQLGGRVDPSDEQEFGRAELTVTGDCALFDGLL 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G+ + VWM+HGD+V  +P GF V+ +S + PFA IAD+ R++Y VQFHPEVVHT  G+
Sbjct: 122 APGTVEPVWMNHGDRVMALPPGFRVVGTSGNAPFAAIADDGRRFYGVQFHPEVVHTPSGA 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NF H VAG+  +W M+++  + ++RI+EQVG+ RVIC +SGGVDS+VAA LI+EAI
Sbjct: 182 KLLRNFTHGVAGLAGDWTMAAFKDQAIARIREQVGSGRVICGLSGGVDSSVAAVLIHEAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +R  E ++++ +F+ + N PL   DASE F+ +L+ + DPE KRK I
Sbjct: 242 GDQLTCVFVDHGLLRAGEADDVVRMFRDHYNIPLIARDASELFLGELEGVDDPELKRKTI 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++EA KI  A+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M++K
Sbjct: 302 GRLFIDVFQQEADKIKDARFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMNLK 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG EL LP+  V RHP PGPGLAIR  G IT +++ ILR++D IY
Sbjct: 362 LVEPLRELFKDEVRELGCELGLPEILVGRHPFPGPGLAIRVPGAITRDKLEILRKADTIY 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y  IWQAFTVLLPV+TVGV GD R+Y+Y C+LRAVTS DGMTAD+Y  + +
Sbjct: 422 LDEIRKAGLYDVIWQAFTVLLPVRTVGVKGDARSYDYACALRAVTSTDGMTADYYPFEHD 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +V+ RI NEV+GINRV YDITSKPP TIEWE
Sbjct: 482 FLRRVSTRIANEVRGINRVTYDITSKPPGTIEWE 515


>gi|167646179|ref|YP_001683842.1| GMP synthase [Caulobacter sp. K31]
 gi|167348609|gb|ABZ71344.1| GMP synthase, large subunit [Caulobacter sp. K31]
          Length = 528

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/512 (59%), Positives = 390/512 (76%), Gaps = 1/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ TQLIARRVRE+ VYCE+  F  A     +  P AIILSG PAS L+ DS
Sbjct: 18  RVLIVDFGSQVTQLIARRVREAGVYCEIHPFDKAEAMVDDYAPSAIILSGGPASVLEADS 77

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+I K++ E  +PLL +CYGQQ++C  LGG+ +   + EFGRA + I K   L +G+ + 
Sbjct: 78  PRIGKKLFELGVPLLAVCYGQQLLCDLLGGQVEGGHAGEFGRAELTIGKASPLFEGLADV 137

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G  + VWMSHGD+V  IPEGFEVIA+S   PFA IAD+ RK Y VQFHPEVVHT+ G+Q+
Sbjct: 138 GGLETVWMSHGDRVTAIPEGFEVIATSVGAPFAAIADDARKIYGVQFHPEVVHTINGAQI 197

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
             NF+  +AG++ +W M+++ +E+V +I++QVG  +VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 198 YRNFLK-LAGLKGDWTMAAFRQEMVQKIRDQVGTGKVICGLSGGVDSSVAAVLIHEAIGD 256

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VD G +R NE + +++LF+ + N PL  VDA   F+  L  + DPETKRK+IG 
Sbjct: 257 QLTCVFVDTGLLRLNEADQVVTLFRDHYNIPLIHVDAGAEFLGALAGVSDPETKRKIIGG 316

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI++F+ EA KI GA FL QGTLYPDV+ES+S  GGPS++IKSHHNVGGLP+ M +KLV
Sbjct: 317 KFIDIFDREAAKIDGADFLAQGTLYPDVVESVSARGGPSAVIKSHHNVGGLPDFMKLKLV 376

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG EL L  +FV RHP PGPGLAIR  G+IT E++++L+++DAIY +
Sbjct: 377 EPLRELFKDEVRALGVELGLAPAFVGRHPFPGPGLAIRIPGDITPEKVDVLQQADAIYLD 436

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y KIWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADF+    + L
Sbjct: 437 EIRKAGLYDKIWQAFAVLLPVKTVGVMGDARTYENVLALRAVTSTDGMTADFFEFPWDVL 496

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RI+NEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 497 GKTATRIINEVRGVNRVVYDVTSKPPGTIEWE 528


>gi|209545327|ref|YP_002277556.1| GMP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533004|gb|ACI52941.1| GMP synthase, large subunit [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 541

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/512 (59%), Positives = 378/512 (73%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ TQLIARRVRES VYCE+  F       +   P+ IILSG PAS LD  +
Sbjct: 30  RVLILDFGSQVTQLIARRVRESGVYCEIWPFSTDEAKIRAFAPRGIILSGGPASVLDEKA 89

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+IP  +    +P+LGICYGQQ +C  LGG  +  + REFGRA I+I ++C+L +G W +
Sbjct: 90  PRIPDVVFALGVPVLGICYGQQALCHQLGGAVETHEHREFGRAHIDIIEDCALFRGTWAR 149

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G ++QVWMSHGD+V  +P GF  +A S+  PFA IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 150 GGREQVWMSHGDRVTKLPPGFRSVAVSEGAPFAIIADEGRRLYGVQFHPEVVHTPHGAAL 209

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H V G +  W M+ +    ++RI+EQVG+  VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 210 LRNFTHDVVGCRGIWTMAGFRDMEIARIREQVGSGHVICGLSGGVDSSVAAVLIHEAIGD 269

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD G +R  E E ++  F+G  N  L   DAS+ F+  L+ + DPE KRK IG+
Sbjct: 270 QLTCIFVDPGILRAGEAEEVVKTFRGRFNIKLVHRDASDLFLSALEGVTDPEIKRKTIGR 329

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LF+EVFEEEA K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M M+LV
Sbjct: 330 LFVEVFEEEAAKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMKMQLV 389

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P++ V RHP PGPGLAIR  G +  +++ +LR  D I+ E
Sbjct: 390 EPLRELFKDEVRELGRELGIPEAIVGRHPFPGPGLAIRIPGAVDRDKLALLRRVDTIFLE 449

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+Y C+LRAVTS DGMTAD +  D+ FL
Sbjct: 450 EIRGAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDYACALRAVTSTDGMTADVFPFDIGFL 509

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+G+NRV YDITSKPP TIEWE
Sbjct: 510 NRVASRIVNEVQGVNRVTYDITSKPPGTIEWE 541


>gi|162148917|ref|YP_001603378.1| GMP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787494|emb|CAP57090.1| gmp synthase [glutamine-hydrolyzing] (glutamin amidotransferase)
           (gmp synthetase) [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 562

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/512 (59%), Positives = 378/512 (73%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ TQLIARRVRES VYCE+  F       +   P+ IILSG PAS LD  +
Sbjct: 51  RVLILDFGSQVTQLIARRVRESGVYCEIWPFSTDEAKIRAFAPRGIILSGGPASVLDEKA 110

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+IP  +    +P+LGICYGQQ +C  LGG  +  + REFGRA I+I ++C+L +G W +
Sbjct: 111 PRIPDVVFALGVPVLGICYGQQALCHQLGGAVETHEHREFGRAHIDIIEDCALFRGTWAR 170

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G ++QVWMSHGD+V  +P GF  +A S+  PFA IADE R+ Y VQFHPEVVHT  G+ L
Sbjct: 171 GGREQVWMSHGDRVTKLPPGFRSVAVSEGAPFAIIADEGRRLYGVQFHPEVVHTPHGAAL 230

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF H V G +  W M+ +    ++RI+EQVG+  VIC +SGGVDS+VAA LI+EAIG 
Sbjct: 231 LRNFTHDVVGCRGIWTMAGFRDMEIARIREQVGSGHVICGLSGGVDSSVAAVLIHEAIGD 290

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD G +R  E E ++  F+G  N  L   DAS+ F+  L+ + DPE KRK IG+
Sbjct: 291 QLTCIFVDPGILRAGEAEEVVKTFRGRFNIKLVHRDASDLFLSALEGVTDPEIKRKTIGR 350

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LF+EVFEE+A K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP+ M M+LV
Sbjct: 351 LFVEVFEEQAAKLGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPDRMKMQLV 410

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P++ V RHP PGPGLAIR  G +  +++ +LR  D I+ E
Sbjct: 411 EPLRELFKDEVRELGRELGIPEAIVGRHPFPGPGLAIRIPGAVDRDKLALLRRVDTIFLE 470

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y  IWQAF VLLPV+TVGVMGD RTY+Y C+LRAVTS DGMTAD +  D+ FL
Sbjct: 471 EIRGAGLYDAIWQAFAVLLPVRTVGVMGDGRTYDYACALRAVTSTDGMTADVFPFDIGFL 530

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++VA RIVNEV+G+NRV YDITSKPP TIEWE
Sbjct: 531 NRVASRIVNEVQGVNRVTYDITSKPPGTIEWE 562


>gi|294086052|ref|YP_003552812.1| GMP synthase - glutamine amidotransferase protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665627|gb|ADE40728.1| GMP synthase - glutamine amidotransferase protein [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 515

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/514 (58%), Positives = 374/514 (72%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +  +LIIDFGSQ TQLIARR+RE+ VY E++      +  K   P  IILSG P S    
Sbjct: 2   ADTILIIDFGSQVTQLIARRLREAGVYTEILPCTTDPENIKNAAPNGIILSGGPNSVAMA 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P+ P+ + +  IP+LGICYGQQ MCQ LGG+ +   SREFGRA +++ + C+L  G+W
Sbjct: 62  DTPRAPQIVFDMQIPVLGICYGQQTMCQQLGGRVEPGTSREFGRAELDVTEECALFDGLW 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            +G+   VWMSHGD V  +P+GF V+  SD  PFA +ADE R YY VQFHPEVVHT  G 
Sbjct: 122 AQGTAHTVWMSHGDHVAALPDGFRVVGKSDGAPFAAVADESRHYYGVQFHPEVVHTKDGD 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+  F   + G   +W M++Y    +  I++QVG+ +VIC +SGGVDS+V A LI+EAI
Sbjct: 182 KLLSRFALDICGCSGSWSMAAYRARAIDAIRKQVGDAKVICGLSGGVDSSVTAVLIHEAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RK E E ++ LF G+ N PL   D SE F+ +L  + DPE KRK+I
Sbjct: 242 GDQLTCVFVDHGLLRKGEAEEVVRLFGGHYNIPLIHRDVSEMFLERLSGVSDPEQKRKII 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FIEVF+EEA+KI GA+FL QGTLYPDVIESIS  GG    IKSHHNVGGLP+ M + 
Sbjct: 302 GGSFIEVFDEEAQKIDGARFLAQGTLYPDVIESISAAGGSDVTIKSHHNVGGLPDDMKLD 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP+  V RHP PGPGLAIR  G+IT E++ ILRE+DA+Y
Sbjct: 362 LVEPLRELFKDEVRNLGRELGLPEVLVSRHPFPGPGLAIRIPGDITPEKLAILREADAVY 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+Y  IWQAF VLLPV+TVGVMGD R+YEYVC+LRAVTS DGMTA+ Y     
Sbjct: 422 LDEIRKAGLYDDIWQAFAVLLPVKTVGVMGDARSYEYVCALRAVTSSDGMTAESYGFSHE 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL++ A RI+N VKG+NRVVYD+TSKPP TIEWE
Sbjct: 482 FLARTATRIINAVKGVNRVVYDVTSKPPGTIEWE 515


>gi|260433934|ref|ZP_05787905.1| GMP synthase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417762|gb|EEX11021.1| GMP synthase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 519

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/514 (59%), Positives = 389/514 (75%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ ++  P+AII SG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVRDMAPRAIIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP++P+EI E  +P+LGICYGQQ+M Q LGG  ++   + EFGRAF+  +    LL+G W
Sbjct: 68  SPRVPQEIFEYGVPILGICYGQQVMMQQLGGNVESGHGTAEFGRAFVTPRGKLDLLEG-W 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
                +QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  G+
Sbjct: 127 FTDGNEQVWMSHGDHVSQIAPGFEVFGTSPNAPFAITADTSRHFYAVQFHPEVHHTPKGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV+ +AG + +W M +Y  E++ +I+EQVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 187 KLFENFVN-LAGFKGDWTMGAYRDEMIRKIREQVGDKKVICGLSGGVDSSVAAILIHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RKNE + ++S+F+   N  L   D SE F+ +L+ + DPETKRK+I
Sbjct: 246 GDQLTCVFVDHGLLRKNEAQEVVSMFRDNYNIQLIHADESELFLGELEGVSDPETKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 306 GKLFIDVFQKHADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 365

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DAI+
Sbjct: 366 LVEPLRELFKDEVRALGRELGLPPSFIGRHPFPGPGLAIRCPGEITREKLEILREADAIF 425

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y     
Sbjct: 426 IDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTHE 485

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 486 FLGETATRIINEVKGINRCTYDITSKPPGTIEWE 519


>gi|119386404|ref|YP_917459.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Paracoccus denitrificans PD1222]
 gi|119376999|gb|ABL71763.1| GMP synthase (glutamine-hydrolyzing) [Paracoccus denitrificans
           PD1222]
          Length = 519

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/517 (58%), Positives = 394/517 (76%), Gaps = 8/517 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD--YFKEQNPQAIILSGSPASSLDI 66
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F NA+D  + K+  PQA+ILSG PAS    
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPF-NAVDDAFLKDFAPQAVILSGGPASVTQA 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFI---EIKKNCSLLK 123
           DSP+ P+ + +  +P+ GICYGQQ+M + LGG+ ++    E+GRAFI   +  K   +  
Sbjct: 65  DSPRAPQSLFDMQVPVFGICYGQQVMMEQLGGRVESGHHAEYGRAFIAPADGHKGDGIFA 124

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G+++ G +++VWMSHGD+V  +  GFEVI +S + PFA IADE RK++AVQFHPEV HT 
Sbjct: 125 GLFDTG-REEVWMSHGDRVTRLAPGFEVIGTSPNAPFAMIADEARKFFAVQFHPEVHHTP 183

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++NFV  +AG   +W M+SY +E + +I+EQVG++RVIC +SGGVDS+VAA LI+
Sbjct: 184 NGRRMLENFVR-MAGFAGDWTMASYRQEAIRKIREQVGSKRVICGLSGGVDSSVAAVLIH 242

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R NE E ++++F+   N PL   D SE F+  L+ + DPE KR
Sbjct: 243 EAIGDQLTCVFVDHGLLRLNEAEEVVTMFRDNYNIPLIHADESELFLSALEGVSDPEVKR 302

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 303 KTIGKLFIDVFQKYASEIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 362

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG+EL LP+ F+ RHP PGPGLAIRC GEIT +++ ILR++D
Sbjct: 363 GLKLVEPLRELFKDEVRALGRELGLPEKFIGRHPFPGPGLAIRCPGEITRDKLEILRKAD 422

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A++ ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y  
Sbjct: 423 AVFIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPF 482

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 483 SHEFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 519


>gi|302382750|ref|YP_003818573.1| GMP synthase, large subunit [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193378|gb|ADL00950.1| GMP synthase, large subunit [Brevundimonas subvibrioides ATCC
           15264]
          Length = 519

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/516 (58%), Positives = 389/516 (75%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E   KVLI+DFGSQ TQLIARR+RE+ VYCE+  +  A        P AIILSG P S  
Sbjct: 4   ETHQKVLIVDFGSQVTQLIARRLREASVYCEIHPYAKAEAALAALKPAAIILSGGPESVH 63

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           +  SP+ P+ + E+ +P+LGICYG+  MC+ LGGK +   +REFGRA I ++K   LL  
Sbjct: 64  EEGSPRAPQAVFEAGVPVLGICYGEMTMCEQLGGKVEGGHTREFGRAEITVQKASPLLAD 123

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +   G  + VWMSHGD++  IPEGF+V+A+S  +P+A IADE R++Y VQFHPEV+HT  
Sbjct: 124 LAPVGEDETVWMSHGDKIVAIPEGFDVVATSAGSPYAVIADETRRFYGVQFHPEVMHTPR 183

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G Q++ NF H +AG++ +W M++Y  E +++I+EQVG+ +VIC +SGGVDS+VAA LI+E
Sbjct: 184 GHQMLKNFTHGIAGLKGDWTMAAYRDEKIAQIREQVGSAKVICGLSGGVDSSVAAVLIHE 243

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VD G +RK+E   + +LF+ + N PL  VDAS+ F+ +L    DPETKRK
Sbjct: 244 AIGDQLTCVFVDTGLLRKDEATQVTTLFREHYNIPLIHVDASKEFLGELAGQSDPETKRK 303

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG++FIEVF+ EA KI GA+FL QGTLYPDVIES+S   G + +IKSHHNVGGLP++M 
Sbjct: 304 IIGRVFIEVFDREAGKIDGAEFLAQGTLYPDVIESVSSSSGKAHVIKSHHNVGGLPDYMK 363

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL L D+FV RHP PGPGLAIR  GEIT + +  L+++DA
Sbjct: 364 LKLVEPLRELFKDEVRALGRELGLTDAFVGRHPFPGPGLAIRIPGEITPDAVETLQQADA 423

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY +EI KAG+Y KIWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADF+   
Sbjct: 424 IYLDEIRKAGLYDKIWQAFAVLLPVKTVGVMGDARTYEKVLALRAVTSTDGMTADFFEFP 483

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + L + A RIVNEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 484 WDVLGKCATRIVNEVRGVNRVVYDVTSKPPGTIEWE 519


>gi|329850812|ref|ZP_08265657.1| GMP synthase, C-terminal domain-containing protein [Asticcacaulis
           biprosthecum C19]
 gi|328841127|gb|EGF90698.1| GMP synthase, C-terminal domain-containing protein [Asticcacaulis
           biprosthecum C19]
          Length = 514

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/511 (60%), Positives = 382/511 (74%), Gaps = 4/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ TQLIARRVRE  VYCE+  F  A D      P+A+ILSGSP S +    P
Sbjct: 8   LLIIDFGSQVTQLIARRVRECGVYCEIHPFTKAADAIDSLRPKAVILSGSPHSVIH-QGP 66

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            I  ++   N+P+ GICYG+Q+MC  LGGK +    REFGRA I+I K   + KG+    
Sbjct: 67  TIDAKLFAMNLPVFGICYGEQLMCDLLGGKVEAGHDREFGRASIDIIKPSPIFKGL---N 123

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             + VWMSHGD+V  IPEGFEVIA S+  P+A IADEKRK+YAVQFHPEVVHT  G+ +I
Sbjct: 124 DNETVWMSHGDRVTAIPEGFEVIAVSEGAPYAAIADEKRKFYAVQFHPEVVHTARGTDII 183

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +AG   +W M+S+  E V++I+ QVG  +VIC +SGGVDS+VAA LI+EAIG  
Sbjct: 184 RNFLFEIAGFTGDWSMASFRDEQVAKIRAQVGTGKVICGLSGGVDSSVAAVLIHEAIGEQ 243

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VD G +RK E   +++LF+ + N PL  V+A E F+  L  I DPETKRK IG+L
Sbjct: 244 LTCVFVDTGLLRKEEGAQVVALFRDHYNIPLIHVEAQELFLGALAGIDDPETKRKTIGKL 303

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VF+ EA KI GAQFL QGTLYPDV+ES+S  GGPS++IKSHHNVGGLP++M++KLVE
Sbjct: 304 FIDVFDAEAAKIDGAQFLAQGTLYPDVVESVSPSGGPSAVIKSHHNVGGLPDYMELKLVE 363

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG+EL L + FV RHP PGPGLAIR  G +T E++  L+E+DAIY +E
Sbjct: 364 PLRELFKDEVRALGRELGLSEQFVGRHPFPGPGLAIRIPGAVTPEKVKTLQEADAIYLDE 423

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y +IWQAF VLLPV+TVGVMGD RTYE V +LRAVTS DGMTADF+      L 
Sbjct: 424 IRKAGLYDQIWQAFAVLLPVKTVGVMGDARTYEDVLALRAVTSSDGMTADFFEFPWAVLG 483

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + A RIVNEV+G+NRVVYD+TSKPP TIEWE
Sbjct: 484 RCATRIVNEVRGVNRVVYDVTSKPPGTIEWE 514


>gi|330994458|ref|ZP_08318383.1| GMP synthase [Gluconacetobacter sp. SXCC-1]
 gi|329758458|gb|EGG74977.1| GMP synthase [Gluconacetobacter sp. SXCC-1]
          Length = 494

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 296/494 (59%), Positives = 371/494 (75%)

Query: 27  VRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGIC 86
           +RES VYCE+  +    +  +   P+ IILSGSPAS LD ++P IP  +   N+P+LGIC
Sbjct: 1   MRESGVYCEIWPYSATAEKIRAFAPKGIILSGSPASVLDANAPTIPDVVFALNVPVLGIC 60

Query: 87  YGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIP 146
           YGQQ MC+ LGG  ++S+ REFGRA I+I K+C+L +G W +G ++QVWMSHGD+V  +P
Sbjct: 61  YGQQAMCRQLGGAVESSEHREFGRAHIDIVKDCALFRGTWARGGREQVWMSHGDRVTKLP 120

Query: 147 EGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGIQDNWVMS 206
            GF+ +A S+  P+A IADE R+ Y +QFHPEVVHT  G+ L+ NF H VAG +  W M+
Sbjct: 121 PGFQAVAVSEGAPYAIIADEGRRLYGMQFHPEVVHTPHGAALLRNFTHDVAGCRGTWTMA 180

Query: 207 SYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVE 266
            +    ++RI++QVG  RVIC +SGGVDS+VAA LI++AIG  LTC+ VD G +R  E +
Sbjct: 181 GFRDMEIARIRQQVGKGRVICGLSGGVDSSVAAVLIHQAIGDQLTCIFVDPGILRAGEAD 240

Query: 267 NIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQF 326
            +I  F+   N  L   DAS+ F+  L+ + DPE KRK IG+LFIEVFEEEA K+GGA F
Sbjct: 241 EVIRTFRDRFNIHLIHRDASDLFLNALEGVSDPEIKRKTIGRLFIEVFEEEAAKLGGADF 300

Query: 327 LGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKEL 386
           L QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M M+LVEPL+ELFKDEVR LG+E+
Sbjct: 301 LAQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVEPLRELFKDEVRELGREM 360

Query: 387 RLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVL 446
            +P++ V RHP PGPGLAIR  G IT E++ +LR  DAI+ EEI  AG+Y  IWQAF VL
Sbjct: 361 DIPEAIVGRHPFPGPGLAIRIPGAITREKLALLRRVDAIFLEEIRSAGLYDAIWQAFAVL 420

Query: 447 LPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVV 506
           LPV+TVGVMGD RTY+Y C+LRAVTS DGMTAD Y  DM+FL++VA RIVNEV+G+NRV 
Sbjct: 421 LPVRTVGVMGDGRTYDYACALRAVTSTDGMTADIYPFDMSFLNRVAGRIVNEVRGVNRVT 480

Query: 507 YDITSKPPATIEWE 520
           YDITSKPP TIEWE
Sbjct: 481 YDITSKPPGTIEWE 494


>gi|163731722|ref|ZP_02139169.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseobacter litoralis Och 149]
 gi|161395176|gb|EDQ19498.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseobacter litoralis Och 149]
          Length = 522

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 307/516 (59%), Positives = 386/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ-NPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F    D F +   P+A+ILSG P+S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFNLVDDSFLDTFKPKAVILSGGPSSVFAQG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           +P  P  + E  +P+LGICYGQQ+M   LGGK +    + EFGRA++    +   +L+G 
Sbjct: 68  APMPPATVFELGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAYVTPTARRLDILQGW 127

Query: 126 WEKG-SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +E    ++QVWMSHGD V  I  GF+V  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 128 FETDQDREQVWMSHGDHVSQIAPGFDVFGTSPNAPFAITADTTRHFYAVQFHPEVHHTPN 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG + +W M +Y +E +++I+EQVG+ RVICA+SGGVDS+VAA LI+E
Sbjct: 188 GAKLYENFVR-LAGFKGDWTMGAYREEAIAKIREQVGSGRVICALSGGVDSSVAAVLIHE 246

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG MRK+E   ++ +F+ + N PL   D S+ F+ KL  + DPETKRK
Sbjct: 247 AIGDQLTCVYVDHGLMRKDESAQVVGMFREHYNLPLIHADESDLFLGKLNGVSDPETKRK 306

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG LFIEVFE+ AK+IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+
Sbjct: 307 IIGGLFIEVFEKYAKEIGGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMN 366

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           M+LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E+++ILRE+DA
Sbjct: 367 MQLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILREADA 426

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y   
Sbjct: 427 VYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFS 486

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 487 HDFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 522


>gi|89068296|ref|ZP_01155706.1| GMP synthase (glutamine-hydrolyzing) [Oceanicola granulosus
           HTCC2516]
 gi|89046213|gb|EAR52271.1| GMP synthase (glutamine-hydrolyzing) [Oceanicola granulosus
           HTCC2516]
          Length = 519

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 306/520 (58%), Positives = 384/520 (73%), Gaps = 6/520 (1%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASS 63
           ++   +LIIDFGSQ TQLIARR+RE  VYCE+  F+N       E  P+A+ILSG PAS 
Sbjct: 2   DQHDTLLIIDFGSQVTQLIARRLRELNVYCEIHPFQNVTPALLAETAPKAVILSGGPASV 61

Query: 64  LDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKT-KNSQSREFGRAFIEIK--KNCS 120
           +D  SP+ P E+ E  +P+LGICYGQQ+M + LGG+  +   + EFGRA++E K  K+  
Sbjct: 62  IDAGSPRPPAEVFELGVPVLGICYGQQVMMEMLGGRVERGDGTSEFGRAWVERKGDKHPD 121

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LL G W   +++QVWMSHGD V  +  GFEV+ +S   PFA   D  R +YAVQFHPEV 
Sbjct: 122 LLTG-WFLEAREQVWMSHGDHVAKLAPGFEVLGTSPGAPFAITGDRARHFYAVQFHPEVH 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G   ++NFV  +AG   +W M++Y  E +  I+EQVG+ RVIC +SGGVDS+VAA 
Sbjct: 181 HTPNGRTFLENFVK-IAGFTGDWTMAAYKDEAIRLIREQVGDARVICGLSGGVDSSVAAV 239

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG +R+NE E ++ +F+   N PL   D ++ F+ +L+ + DPE
Sbjct: 240 LIHEAIGDQLTCVFVDHGLLRQNEAEEVVGMFRDAYNIPLIHADEADLFLGELEGVSDPE 299

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG+LFI+VF+ EA KI GA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 300 VKRKTIGRLFIDVFQREANKIEGASFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP 359

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M +KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT +++ ILR
Sbjct: 360 EKMGLKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRDKLEILR 419

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DA+Y ++I K G+Y +IWQAF  LLPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+
Sbjct: 420 KADAVYIDQIRKHGLYDEIWQAFVALLPVRTVGVMGDGRTYDYACALRAVTSVDGMTADY 479

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y    +FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 480 YPFSHDFLGETATRIINEVRGINRVTYDITSKPPGTIEWE 519


>gi|159044136|ref|YP_001532930.1| GMP synthase [Dinoroseobacter shibae DFL 12]
 gi|226738439|sp|A8LKW5|GUAA_DINSH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|157911896|gb|ABV93329.1| GMP synthase [Dinoroseobacter shibae DFL 12]
          Length = 520

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 381/514 (74%), Gaps = 3/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  V+CE+  F+N  D F  +  P+A+I SG PAS +D +
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVFCEIHPFQNVTDAFLADFAPKAVIFSGGPASVIDAN 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP+ P  + E  +P+LGICYGQQ+M Q LGG  +    + EFGRA++  + +   L   W
Sbjct: 68  SPRPPASVFELGVPILGICYGQQVMMQMLGGMVERGHGTAEFGRAYVTPQGDRPELLNGW 127

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R ++AVQFHPEV HT  G 
Sbjct: 128 FLDGREQVWMSHGDHVSRIAPGFEVYGTSPNAPFAITADLARNFFAVQFHPEVHHTPNGK 187

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            L +NFV  +AG   +W M +Y ++ ++ I+ QVG+ +VICA+SGGVDS+VAA LI+EAI
Sbjct: 188 TLYENFVR-LAGFTGDWTMDAYREQAIAEIRAQVGDGKVICALSGGVDSSVAAVLIHEAI 246

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RKNE + ++++F+ + N PL   D +E F+  L    DPETKRK+I
Sbjct: 247 GEQLTCVFVDHGLLRKNEAQEVVTMFREHYNLPLIHADETELFLSALDGQSDPETKRKII 306

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VFE +AK+IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M MK
Sbjct: 307 GKLFIDVFEAKAKEIGGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGMK 366

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT  ++ ILRE+DA+Y
Sbjct: 367 LVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRPKLEILREADAVY 426

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y +IWQA+  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y     
Sbjct: 427 IDQIRKYGLYDEIWQAYVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTHE 486

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 487 FLGETATRIINEVQGINRVTYDITSKPPGTIEWE 520


>gi|56696977|ref|YP_167339.1| GMP synthase [Ruegeria pomeroyi DSS-3]
 gi|81349738|sp|Q5LRL6|GUAA_SILPO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|56678714|gb|AAV95380.1| GMP synthase [Ruegeria pomeroyi DSS-3]
          Length = 519

 Score =  634 bits (1636), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 381/514 (74%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPRAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP+ P+EI +  +P+LGICYGQQ M   LGG+ ++   + EFGRA++  K    +L G W
Sbjct: 68  SPRAPQEIFDYGVPILGICYGQQTMMTQLGGRVESGHGTAEFGRAYVTPKGTLDILDG-W 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               ++QVWMSHGD V  I  GFEV  +S   PFA  AD  R +YAVQFHPEV HT  G+
Sbjct: 127 FTDGREQVWMSHGDHVAEIAPGFEVYGTSPGAPFAITADTSRHFYAVQFHPEVHHTPNGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV  +AG + +W M +Y +E++  I+EQVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 187 KLYENFVR-LAGFKGDWTMGAYREEMIRTIREQVGDKKVICGLSGGVDSSVAAILIHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RKNE   ++ +F+   N  L   D S+ F+ +L    DPETKRK+I
Sbjct: 246 GDQLTCVFVDHGLLRKNEATEVVGMFRDNYNIQLIHADESDLFLGELDGQSDPETKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 306 GKLFIDVFQKHADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 365

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DAIY
Sbjct: 366 LVEPLRELFKDEVRALGRELGLPQSFIGRHPFPGPGLAIRCPGEITREKLEILREADAIY 425

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y     
Sbjct: 426 IDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTHE 485

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 486 FLGETATRIINEVKGINRCTYDITSKPPGTIEWE 519


>gi|83952132|ref|ZP_00960864.1| GMP synthase [Roseovarius nubinhibens ISM]
 gi|83837138|gb|EAP76435.1| GMP synthase [Roseovarius nubinhibens ISM]
          Length = 523

 Score =  634 bits (1636), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/522 (58%), Positives = 387/522 (74%), Gaps = 6/522 (1%)

Query: 4   RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPAS 62
           ++   ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  E  P+A+I SG P S
Sbjct: 3   QDTHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLAEFAPKAVIFSGGPDS 62

Query: 63  SLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIEIKKN-C 119
            +   SP+ PK + +  +P+LGICYGQQ+M   LGG+ +  +  + EFGRAF+   ++  
Sbjct: 63  VMRDGSPRPPKSVYDLGVPILGICYGQQVMMHDLGGRVEAGEHATAEFGRAFVTPSEDRI 122

Query: 120 SLLKGMWEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPE 178
            LL G +  GS ++QVWMSHGD V  I  GF V  +S   PFA  ADE RK+YAVQFHPE
Sbjct: 123 DLLTGWFMDGSGREQVWMSHGDHVAEIAPGFSVYGTSPGAPFAITADEDRKFYAVQFHPE 182

Query: 179 VVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVA 238
           V HT  G  + +NFV   AG   +W M +Y +E + +I+EQVG+++VIC +SGGVDS+VA
Sbjct: 183 VHHTPNGKTIYENFVR-AAGFSGDWTMGAYREEAIRKIREQVGDKQVICGLSGGVDSSVA 241

Query: 239 AFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVD 298
           A LI+EAIG  LTCV VDHG +R NE + ++ +F+ + N PL   D SE F+ +L  + D
Sbjct: 242 AVLIHEAIGDQLTCVFVDHGLLRLNEADEVVKMFRDHYNIPLIHADESELFLGELDGVSD 301

Query: 299 PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG 358
           PETKRK+IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGG
Sbjct: 302 PETKRKIIGRLFIDVFQKHANSIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGG 361

Query: 359 LPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINI 418
           LPE M +KLVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT E++ I
Sbjct: 362 LPEKMGLKLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGEITREKLEI 421

Query: 419 LRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTA 478
           LR++DA+Y ++I K G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTA
Sbjct: 422 LRKADAVYIDQIRKHGLYDDIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTA 481

Query: 479 DFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           D+Y    +FL + A RI+NEV+GINRV YD+TSKPP TIEWE
Sbjct: 482 DYYPFSHDFLGETATRIINEVRGINRVTYDVTSKPPGTIEWE 523


>gi|110679988|ref|YP_682995.1| GMP synthase [Roseobacter denitrificans OCh 114]
 gi|123172371|sp|Q165N4|GUAA_ROSDO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|109456104|gb|ABG32309.1| GMP synthase putative [Roseobacter denitrificans OCh 114]
          Length = 522

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 306/516 (59%), Positives = 384/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ-NPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F    D F +    +A+I SG P+S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFNLVDDAFLDAFGAKAVIFSGGPSSVFADG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           +P  P  + E  +P+LGICYGQQ+M   LGGK +    + EFGRA++    +   +L+G 
Sbjct: 68  APMPPASVFERGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAYVTPTAQKLDMLQGW 127

Query: 126 WEKG-SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +E    ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 128 FETDQDREQVWMSHGDHVSQIAPGFEVFGTSPNAPFAITADTTRHFYAVQFHPEVHHTPN 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG + +W M +Y +E +++I+EQVG+ RVICA+SGGVDS+VAA LI+E
Sbjct: 188 GARLYENFVR-LAGFKGDWTMGAYREEAIAKIREQVGSGRVICALSGGVDSSVAAVLIHE 246

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG MRK+E   ++ +F+ + N PL   D S+ F+ KL+ + DPETKRK
Sbjct: 247 AIGDQLTCVYVDHGLMRKDESAQVVGMFREHYNLPLIHADESDLFLGKLEGVSDPETKRK 306

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG LFIEVFE+ AK+IGGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M+
Sbjct: 307 IIGGLFIEVFEKYAKEIGGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPERMN 366

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           M+LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E+++ILRE+DA
Sbjct: 367 MQLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILREADA 426

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y   
Sbjct: 427 VYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFT 486

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 487 HEFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 522


>gi|114771028|ref|ZP_01448468.1| GMP synthase [alpha proteobacterium HTCC2255]
 gi|114548310|gb|EAU51196.1| GMP synthase [alpha proteobacterium HTCC2255]
          Length = 519

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 307/515 (59%), Positives = 383/515 (74%), Gaps = 6/515 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNA-LDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F N    + KE NP+A+ILSG P+S    D
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFNNVDFTFLKEFNPKAVILSGGPSSVTKND 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKN-CSLLKGM 125
           SP+ PKE+    IPLLGICYGQQ+M   LGGK +    + EFGRA++    N  ++L+G 
Sbjct: 68  SPRAPKELFGMGIPLLGICYGQQVMMHQLGGKVETGHGTAEFGRAYVSQNSNQLNILEGW 127

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           +E G  +QVWMSHGD V  I +GFEV  +S + PFA  AD  R +YAVQFHPEV HT  G
Sbjct: 128 FESGD-EQVWMSHGDHVSEIADGFEVYGTSPNAPFAITADTNRNFYAVQFHPEVHHTPNG 186

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NF+  +AG   +W M +Y ++ ++ IKE VG+ +VIC +SGGVDS+VAA L++EA
Sbjct: 187 AKLYENFIK-IAGFTGDWTMGAYREQAIASIKETVGDNQVICGLSGGVDSSVAAVLLHEA 245

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R  E E ++++F+ + N  L   D  E F+ +L    DPETKRK+
Sbjct: 246 IGDQLTCVFVDHGLLRMGEAEEVVTMFRDHYNMKLIHADEQELFLGQLDGQSDPETKRKI 305

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ AK IG A+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE MDM
Sbjct: 306 IGKLFIDVFDKYAKPIG-AKFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMDM 364

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
            LVEPL+ELFKDEVR LGKEL LP SFV RHP PGPGLAIRC GEIT E++ ILR++DA+
Sbjct: 365 ALVEPLRELFKDEVRELGKELGLPSSFVGRHPFPGPGLAIRCPGEITREKLKILRKADAV 424

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K  +Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    
Sbjct: 425 YIDQIRKHNLYDDIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSH 484

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 485 EFLGETATRIINEVEGINRVTYDITSKPPGTIEWE 519


>gi|254509508|ref|ZP_05121575.1| GMP synthase [Rhodobacteraceae bacterium KLH11]
 gi|221533219|gb|EEE36207.1| GMP synthase [Rhodobacteraceae bacterium KLH11]
          Length = 519

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 301/514 (58%), Positives = 383/514 (74%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ ++  P+A+I SG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNITMDFVRDMAPRAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP++P+EI +   P+LGICYGQQ+M   LGGK ++   + EFGRA++       +L   +
Sbjct: 68  SPRVPQEIFDYGAPILGICYGQQVMMHQLGGKVESGHGTAEFGRAYVTPNAKLDILADWF 127

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            +G  +QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  G+
Sbjct: 128 GEGD-EQVWMSHGDHVSEIAPGFEVFGTSPNAPFAITADPSRHFYAVQFHPEVHHTPKGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV  +AG   +W M +Y ++++++I+EQVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 187 KLYENFVK-LAGFSGDWTMGAYREQMIAKIREQVGDKKVICGLSGGVDSSVAAILIHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RKNE   ++ +F+   N  L   D SE F+ +L    DPETKRK+I
Sbjct: 246 GDQLTCVFVDHGLLRKNEATEVVGMFRDNYNIRLIHADESELFLGELDGQSDPETKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 306 GKLFIDVFQKHADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 365

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT E++ ILRE+DAIY
Sbjct: 366 LIEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGEITREKLEILREADAIY 425

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y  IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y     
Sbjct: 426 IDQIRKHGLYDDIWQAFVAILPVRTVGVMGDSRTYDYACALRAVTSVDGMTADYYPFSHE 485

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 486 FLGETATRIINEVKGINRCTYDITSKPPGTIEWE 519


>gi|99081216|ref|YP_613370.1| GMP synthase [Ruegeria sp. TM1040]
 gi|123077651|sp|Q1GGV8|GUAA_SILST RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|99037496|gb|ABF64108.1| GMP synthase (glutamine-hydrolyzing) [Ruegeria sp. TM1040]
          Length = 520

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/516 (58%), Positives = 387/516 (75%), Gaps = 5/516 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDI 66
            ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S    
Sbjct: 7   DRLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREFAPKAVIFSGGPDSVTRE 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKG 124
            SP+ P+EI +  +P+LGICYGQQ+M   LGG  ++   + EFGRA++   ++   +L G
Sbjct: 67  GSPRAPQEIFDYGVPILGICYGQQVMMHQLGGTVQSGHGTAEFGRAYVTPTEERIDMLSG 126

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
            W     +QVWMSHGD V  I  GF+V  +S + PFA  AD +R +YAVQFHPEV HT  
Sbjct: 127 -WFLDQTEQVWMSHGDHVSEIAPGFKVYGTSPNAPFAITADLERNFYAVQFHPEVHHTPN 185

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  L +NFV  +AG   +W M +Y +++V  I+EQVG+++VICA+SGGVDS+VAA LI+E
Sbjct: 186 GKTLYENFVR-LAGFSGDWTMGAYREQMVETIREQVGDKKVICALSGGVDSSVAAALIHE 244

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RKNE E ++ +F+ + N  +   D +E F+ +L+   DPETKRK
Sbjct: 245 AIGDQLTCVFVDHGLLRKNEAEEVVGMFRDHMNLQVIHADETELFLGELEGQSDPETKRK 304

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 305 IIGKLFIDVFQKYADQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 364

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT ++++ILRE+DA
Sbjct: 365 LKLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGEITRDKLDILREADA 424

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 425 IYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 484

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 485 HEFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 520


>gi|259415755|ref|ZP_05739675.1| GMP synthase [Silicibacter sp. TrichCH4B]
 gi|259347194|gb|EEW58971.1| GMP synthase [Silicibacter sp. TrichCH4B]
          Length = 520

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/516 (58%), Positives = 386/516 (74%), Gaps = 5/516 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDI 66
            ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S    
Sbjct: 7   DRLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREFAPKAVIFSGGPDSVTRE 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKG 124
            SP+ P+EI +  +P+LGICYGQQ+M   LGG  ++   + EFGRA++    +   +L G
Sbjct: 67  GSPRAPQEIFDYGVPILGICYGQQVMMHQLGGTVQSGHGTAEFGRAYVTPTDERIDMLSG 126

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
            W     +QVWMSHGD V  I  GF+V  +S + PFA  AD +R +YAVQFHPEV HT  
Sbjct: 127 -WFLDQTEQVWMSHGDHVSEIAPGFKVYGTSPNAPFAITADLERNFYAVQFHPEVHHTPN 185

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  L +NFV  +AG   +W M +Y +++V  I+EQVG+++VICA+SGGVDS+VAA LI+E
Sbjct: 186 GKTLYENFVR-LAGFAGDWTMGAYREQMVDTIREQVGDKKVICALSGGVDSSVAAALIHE 244

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RKNE E ++ +F+ + N  +   D +E F+ +L+   DPETKRK
Sbjct: 245 AIGDQLTCVFVDHGLLRKNEAEEVVGMFRDHMNLQVIHADETELFLGELEGQSDPETKRK 304

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 305 IIGKLFIDVFQKYADQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 364

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT ++++ILRE+DA
Sbjct: 365 LKLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGEITRDKLDILREADA 424

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 425 IYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 484

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 485 HEFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 520


>gi|146277904|ref|YP_001168063.1| GMP synthase [Rhodobacter sphaeroides ATCC 17025]
 gi|226739713|sp|A4WTP4|GUAA_RHOS5 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|145556145|gb|ABP70758.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacter sphaeroides ATCC
           17025]
          Length = 518

 Score =  629 bits (1623), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 299/515 (58%), Positives = 384/515 (74%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  + F K   P+A+I SG P+S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKGFAPKAVIFSGGPSSVFAEG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           +P  P  + E  +P+LGICYGQQ+M   LGGK +    + EFGRAF+   +   ++L G 
Sbjct: 66  APMPPACVFEMGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAFVTPAEGRLAILDGW 125

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           +E G ++QVWMSHGD V  I  GF+V  +S + PFA  AD  R +YAVQFHPEV HT  G
Sbjct: 126 FEDG-REQVWMSHGDHVSQIAPGFQVFGTSPNAPFAITADPARHFYAVQFHPEVHHTPKG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG + +W M +Y +E +++I+ QVG+++VIC +SGGVDS+VAA LI+EA
Sbjct: 185 AKLYENFVK-LAGFKGDWTMGAYREEAIAKIRAQVGDQKVICGLSGGVDSSVAAVLIHEA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R  E E ++++F+ + N PL   D S+ F+  L+ + DPE KRK 
Sbjct: 244 IGDQLTCVFVDHGLLRLGEAEQVVTMFRDHYNMPLIHADESDLFLGALEGVSDPEVKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A  +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 304 IGRLFIDVFQKHAADVGGATFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT E++ ILR++DA+
Sbjct: 364 KLVEPLRELFKDEVRALGRELGLPDSFIGRHPFPGPGLAIRCPGEITREKLEILRQADAV 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I + G+Y +IWQAF  LLPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y    
Sbjct: 424 YIDQIRRHGLYDEIWQAFVALLPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTH 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 484 EFLGETATRIINEVQGINRVTYDITSKPPGTIEWE 518


>gi|255264616|ref|ZP_05343958.1| GMP synthase (glutamine-hydrolyzing) [Thalassiobium sp. R2A62]
 gi|255106951|gb|EET49625.1| GMP synthase (glutamine-hydrolyzing) [Thalassiobium sp. R2A62]
          Length = 520

 Score =  629 bits (1622), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 301/515 (58%), Positives = 384/515 (74%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F+N  D F  +  P+A+I SG PAS +D  
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFQNVTDAFLADFAPKAVIFSGGPASVIDEG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           SP+ P+ + +  +P+LGICYGQQ+M + LGGK +    + EFGRAF+        LLKG 
Sbjct: 68  SPRPPESVFDLGVPILGICYGQQVMMECLGGKVERGHGTAEFGRAFVTPTDDQVDLLKG- 126

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W    K+QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  G
Sbjct: 127 WFLEDKEQVWMSHGDHVAAIAPGFEVYGTSPNAPFAITADTSRNFYAVQFHPEVHHTPNG 186

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           + L +NF+  +AG+  +W M +Y ++ +  I+EQVGN++VIC +SGGVDS+VAA L++EA
Sbjct: 187 AALYENFIK-LAGLTGDWTMGAYREQAIDAIREQVGNKQVICGLSGGVDSSVAAVLLHEA 245

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +RK E + ++++F+   N  L   D  + F+ +L    DPETKRK+
Sbjct: 246 IGDQLTCVFVDHGLLRKGEADEVVTMFRDNYNMKLIHADEQDLFLGELDGQSDPETKRKI 305

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS+ IKSHHNVGGLPE M +
Sbjct: 306 IGKLFIDVFQKYANEIDGAEFLAQGTLYPDVIESVSFSGGPSATIKSHHNVGGLPEKMGL 365

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT ++++ILRE+DA+
Sbjct: 366 KLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITRQKLDILREADAV 425

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    
Sbjct: 426 YIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSH 485

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 486 EFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 520


>gi|254477701|ref|ZP_05091087.1| GMP synthase [Ruegeria sp. R11]
 gi|214031944|gb|EEB72779.1| GMP synthase [Ruegeria sp. R11]
          Length = 552

 Score =  628 bits (1619), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 381/516 (73%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 38  RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPKAVIFSGGPDSVTREG 97

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP+ P+EI +  +P+LGICYGQQ+M   LGGK  +   + EFGRA++    +   L   W
Sbjct: 98  SPRAPQEIFDLGVPILGICYGQQVMMHQLGGKVLSGHGTAEFGRAYVTPTVDSLPLLDGW 157

Query: 127 --EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
             +   ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 158 FADDSDREQVWMSHGDHVSEIAPGFEVYGTSPNAPFAITADVSRNFYAVQFHPEVHHTPN 217

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG   +W M +Y ++ +  I++QVG+++VIC +SGGVDS+VAA LI+E
Sbjct: 218 GAKLYENFVK-IAGFTGDWTMGAYREQAIQAIRDQVGDKKVICGLSGGVDSSVAAILIHE 276

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RKNE E ++++F+   N  L   D S+ F+ +L    DPETKRK
Sbjct: 277 AIGDQLTCVFVDHGLLRKNEAEEVVTMFRDNYNIQLIHADESDLFLGELDGQSDPETKRK 336

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 337 IIGKLFIDVFQKHADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 396

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DA
Sbjct: 397 LKLVEPLRELFKDEVRALGRELGLPQSFIGRHPFPGPGLAIRCPGEITREKLEILREADA 456

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 457 IYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 516

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 517 HEFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 552


>gi|254467291|ref|ZP_05080702.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacterales bacterium
           Y4I]
 gi|206688199|gb|EDZ48681.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacterales bacterium
           Y4I]
          Length = 520

 Score =  628 bits (1619), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 302/514 (58%), Positives = 380/514 (73%), Gaps = 3/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVRELAPKAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP++P+EI +  +P+LGICYGQQ+M   LGG+  +   + EFGRA++   +    L   W
Sbjct: 68  SPRVPQEIFDYGVPILGICYGQQVMMHQLGGEVVSGHGTAEFGRAYVTPSQERIPLLNGW 127

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +++QVWMSHGD V  I  GFEV  +S + PFA  AD +R +YAVQFHPEV HT  G 
Sbjct: 128 FLEAREQVWMSHGDHVSKIAPGFEVYGTSPNAPFAITADLERNFYAVQFHPEVHHTPNGK 187

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            L +NFV  +AG   +W M +Y  E +  I+EQVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 188 TLYENFVK-IAGFTGDWTMGAYKDEAIRLIREQVGDKKVICGLSGGVDSSVAAVLIHEAI 246

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +RKNE E ++ +F+   N  L   D SE F+ +L+   DPETKRK+I
Sbjct: 247 GDQLTCVFVDHGLLRKNEAEEVVKMFRDNYNIQLIHADESELFLGELEGQSDPETKRKII 306

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 307 GKLFIDVFQKHADTIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 366

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E+++ILRE+DA+Y
Sbjct: 367 LVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILREADAVY 426

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y     
Sbjct: 427 IDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTHE 486

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 487 FLGETATRIINEVKGINRCTYDITSKPPGTIEWE 520


>gi|126462403|ref|YP_001043517.1| GMP synthase [Rhodobacter sphaeroides ATCC 17029]
 gi|332558427|ref|ZP_08412749.1| GMP synthase [Rhodobacter sphaeroides WS8N]
 gi|226739712|sp|A3PK79|GUAA_RHOS1 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|126104067|gb|ABN76745.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacter sphaeroides ATCC
           17029]
 gi|332276139|gb|EGJ21454.1| GMP synthase [Rhodobacter sphaeroides WS8N]
          Length = 518

 Score =  627 bits (1618), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 297/515 (57%), Positives = 384/515 (74%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  + F K   P+A+I SG P+S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKGFAPKAVIFSGGPSSVFAEG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           +P  P  + +  +P+LGICYGQQ+M   LGGK +    + EFGRAF+    +  ++L G 
Sbjct: 66  APMPPAGVFDLGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAFVTPTAERLAILDGW 125

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           +E+G ++QVWMSHGD V  I  GF+V  +S + PFA   D  R +YAVQFHPEV HT  G
Sbjct: 126 FEEG-REQVWMSHGDHVSQIAPGFQVFGTSPNAPFAITGDPARHFYAVQFHPEVHHTPKG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG + +W M +Y +E ++RI+ QVG+++VIC +SGGVDS+VAA LI+EA
Sbjct: 185 AKLYENFVR-LAGFKGDWTMGAYREEAIARIRAQVGDQKVICGLSGGVDSSVAAVLIHEA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R  E E ++++F+ + N PL   D S+ F+  L+ + DPE KRK 
Sbjct: 244 IGDQLTCVFVDHGLLRLGEAEQVVTMFRDHYNMPLIHADESDLFLGALEGVSDPEVKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A  +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 304 IGRLFIDVFQKHAADVGGATFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC GEIT E++ ILR +DA+
Sbjct: 364 KLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGEITREKLEILRRADAV 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I + G+Y +IWQAF  LLPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y    
Sbjct: 424 YIDQIRRHGLYDEIWQAFVALLPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTH 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 484 DFLGETATRIINEVQGINRVTYDITSKPPGTIEWE 518


>gi|149915285|ref|ZP_01903813.1| GMP synthase [Roseobacter sp. AzwK-3b]
 gi|149811006|gb|EDM70845.1| GMP synthase [Roseobacter sp. AzwK-3b]
          Length = 520

 Score =  627 bits (1617), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/515 (58%), Positives = 387/515 (75%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F+N  + F  E  P+A+I SG PAS +D  
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFQNVTEAFLAEFAPKAVIFSGGPASVIDAG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKT-KNSQSREFGRAFIE-IKKNCSLLKGM 125
           SP+ P+++ +  +P+LGICYGQQ+M + LGGK  +   + EFGRA++   +    LL G 
Sbjct: 68  SPRPPEKVFDLGVPILGICYGQQVMMEMLGGKVERGDGTAEFGRAYVSPTEHRIDLLNG- 126

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W    ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R ++AVQFHPEV HT  G
Sbjct: 127 WFLEEREQVWMSHGDHVSRIAPGFEVYGTSPNAPFAITADLSRNFFAVQFHPEVHHTPNG 186

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
             L +NFV  +AG + +W M++Y +E +  I+EQVG+++VIC +SGGVDS+VAA LI+EA
Sbjct: 187 KTLYENFVR-LAGFKGDWTMAAYREEAIRLIREQVGDKQVICGLSGGVDSSVAAVLIHEA 245

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R NE + ++++F+ + N PL   D ++ F+ +L+ + DPE KRK 
Sbjct: 246 IGDQLTCVFVDHGLLRHNEADEVVTMFRDHYNIPLIHADEADLFLGELEGVSDPEAKRKT 305

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 306 IGRLFIDVFQKYASQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 365

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E+++ILR++DA+
Sbjct: 366 KLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILRKADAV 425

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    
Sbjct: 426 YIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSH 485

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NEVKGINRV YD+TSKPP TIEWE
Sbjct: 486 EFLGETATRIINEVKGINRVTYDVTSKPPGTIEWE 520


>gi|163741128|ref|ZP_02148520.1| GMP synthase [Phaeobacter gallaeciensis 2.10]
 gi|161385481|gb|EDQ09858.1| GMP synthase [Phaeobacter gallaeciensis 2.10]
          Length = 522

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 303/516 (58%), Positives = 382/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
            +LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 8   SLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPKAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           SP+ P+EI +  +P+LGICYGQQ+M   LGGK  +   + EFGRA++     +  LL G 
Sbjct: 68  SPRAPQEIFDLGVPILGICYGQQVMMHQLGGKVLSGHGTAEFGRAYVTPTVSSLPLLDGW 127

Query: 126 WEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +   S ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 128 FADDSDREQVWMSHGDHVSEIAPGFEVYGTSPNAPFAITADVSRNFYAVQFHPEVHHTPN 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG   +W M +Y ++ +  I++QVG+++VIC +SGGVDS+VAA LI+E
Sbjct: 188 GAKLYENFVK-IAGFTGDWTMGAYREQAIQAIRDQVGDKQVICGLSGGVDSSVAAILIHE 246

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RKNE E ++++F+   N  L   D  E F+ +L    DPETKRK
Sbjct: 247 AIGDQLTCVFVDHGLLRKNEAEEVVTMFRDNYNIQLIHADEQELFLGELDGQSDPETKRK 306

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 307 IIGKLFIDVFQKHANTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 366

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DA
Sbjct: 367 LKLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLEILREADA 426

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 427 IYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 486

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 487 HDFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 522


>gi|77463571|ref|YP_353075.1| GMP synthase [Rhodobacter sphaeroides 2.4.1]
 gi|221639412|ref|YP_002525674.1| GMP synthase [Rhodobacter sphaeroides KD131]
 gi|91206826|sp|Q3J210|GUAA_RHOS4 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|254800112|sp|B9KT27|GUAA_RHOSK RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|77387989|gb|ABA79174.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacter sphaeroides
           2.4.1]
 gi|221160193|gb|ACM01173.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhodobacter sphaeroides KD131]
          Length = 518

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 297/515 (57%), Positives = 383/515 (74%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  + F K   P+A+I SG P+S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTEAFLKGFAPKAVIFSGGPSSVFAEG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           +P  P  + +  +P+LGICYGQQ+M   LGGK +    + EFGRAF+    +  ++L G 
Sbjct: 66  APMPPAGVFDLGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAFVTPTAERLAILDGW 125

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           +E+G ++QVWMSHGD V  I  GF+V  +S + PFA   D  R +YAVQFHPEV HT  G
Sbjct: 126 FEEG-REQVWMSHGDHVSQIAPGFQVFGTSPNAPFAITGDPARHFYAVQFHPEVHHTPKG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG + +W M +Y +E ++RI+ QVG+++VIC +SGGVDS+VAA LI+EA
Sbjct: 185 AKLYENFVR-LAGFKGDWTMGAYREEAIARIRAQVGDQKVICGLSGGVDSSVAAVLIHEA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +R  E E ++ +F+ + N PL   D S+ F+  L+ + DPE KRK 
Sbjct: 244 IGDQLTCVFVDHGLLRLGEAEQVVKMFRDHYNMPLIHADESDLFLGALEGVSDPEVKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A  +GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 304 IGRLFIDVFQKHAADVGGATFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC GEIT E++ ILR +DA+
Sbjct: 364 KLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGEITREKLEILRRADAV 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I + G+Y +IWQAF  LLPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y    
Sbjct: 424 YIDQIRRHGLYDEIWQAFVALLPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFTH 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 484 DFLGETATRIINEVQGINRVTYDITSKPPGTIEWE 518


>gi|85702789|ref|ZP_01033893.1| GMP synthase [Roseovarius sp. 217]
 gi|85671717|gb|EAQ26574.1| GMP synthase [Roseovarius sp. 217]
          Length = 523

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 298/517 (57%), Positives = 386/517 (74%), Gaps = 6/517 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++   D F +E  P+AII SG P S +   
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQKVTDAFLQEMAPRAIIFSGGPDSVMREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIEIKKNCSLLKGM 125
           SP+ P+   +  +P+LGICYGQQ+M Q LGGK +  +  + EFGRA++   +  S     
Sbjct: 68  SPRPPQAAYDLGVPILGICYGQQVMMQDLGGKVEAGEHATAEFGRAYVTGAQIESDFVNG 127

Query: 126 W--EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           W  +   ++QVWMSHGD V  I  GFEV+ +S   PFA  AD  R++YAVQFHPEV HT 
Sbjct: 128 WFTDDTGREQVWMSHGDHVSEIAPGFEVLGTSPGAPFAITADRSRRFYAVQFHPEVHHTP 187

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G++L +NF+  +AG   +W M +Y +E +++I+ QVG+++VIC +SGGVDS+VAA LI+
Sbjct: 188 NGARLYENFIK-LAGFAGDWTMGAYREEAIAKIRAQVGDKQVICGLSGGVDSSVAAVLIH 246

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R NE ++++++F+   N PL   D S+ F+ +L  + DPETKR
Sbjct: 247 EAIGDQLTCVFVDHGLLRLNEAQDVVTMFRDNYNIPLIHADESDLFLGELDGVSDPETKR 306

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 307 KIIGRLFIDVFQKHANEIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 366

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC GEIT E++ ILR++D
Sbjct: 367 GLKLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGEITREKLEILRKAD 426

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y ++I K G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y  
Sbjct: 427 AVYIDQIRKHGLYDAIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPF 486

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL + A RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 487 THEFLGETATRIINEVKGINRVTYDITSKPPGTIEWE 523


>gi|163736337|ref|ZP_02143756.1| GMP synthase [Phaeobacter gallaeciensis BS107]
 gi|161390207|gb|EDQ14557.1| GMP synthase [Phaeobacter gallaeciensis BS107]
          Length = 522

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 303/516 (58%), Positives = 382/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
            +LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 8   SLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPKAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIK-KNCSLLKGM 125
           SP+ P+EI +  +P+LGICYGQQ+M   LGGK  +   + EFGRA++     +  LL G 
Sbjct: 68  SPRAPQEIFDLGVPILGICYGQQVMMHQLGGKVLSGHGTAEFGRAYVTPAVSSLPLLDGW 127

Query: 126 WEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +   S ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 128 FADDSDREQVWMSHGDHVSEIAPGFEVYGTSPNAPFAITADVSRNFYAVQFHPEVHHTPN 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG   +W M +Y ++ +  I++QVG+++VIC +SGGVDS+VAA LI+E
Sbjct: 188 GAKLYENFVK-IAGFTGDWTMGAYREQAIQAIRDQVGDKQVICGLSGGVDSSVAAILIHE 246

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RKNE E ++++F+   N  L   D  E F+ +L    DPETKRK
Sbjct: 247 AIGDQLTCVFVDHGLLRKNEAEEVVTMFRDNYNIQLIHADEQELFLGELDGQSDPETKRK 306

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 307 IIGKLFIDVFQKHANTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 366

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DA
Sbjct: 367 LKLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLEILREADA 426

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           IY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 427 IYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 486

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 487 HDFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 522


>gi|83942346|ref|ZP_00954807.1| GMP synthase (glutamine-hydrolyzing) [Sulfitobacter sp. EE-36]
 gi|83953565|ref|ZP_00962286.1| GMP synthase (glutamine-hydrolyzing) [Sulfitobacter sp. NAS-14.1]
 gi|83841510|gb|EAP80679.1| GMP synthase (glutamine-hydrolyzing) [Sulfitobacter sp. NAS-14.1]
 gi|83846439|gb|EAP84315.1| GMP synthase (glutamine-hydrolyzing) [Sulfitobacter sp. EE-36]
          Length = 520

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/515 (58%), Positives = 382/515 (74%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  V+CE+  F    D F K+  P+A+ILSG P+S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVFCEIHPFNTVDDAFLKDFAPKAVILSGGPSSVFAEG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKK-NCSLLKGM 125
           +P  P+ + E  +P+LGICYGQQ+M   LGGK +    + EFGRA++   +    LL+G 
Sbjct: 68  APMPPQSVFELGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAYVTPSEARLELLEG- 126

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W    K+QVWMSHGD V  I  GFEV  +S   PFA   D  R +YAVQFHPEV HT  G
Sbjct: 127 WFLTEKEQVWMSHGDHVSAIAPGFEVYGTSPHAPFAVTGDVSRNFYAVQFHPEVHHTPNG 186

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG + +W MS+Y  E ++ I+EQVG+++VIC +SGGVDS+VAA LI+EA
Sbjct: 187 ARLYENFVR-LAGFKGDWTMSAYRDEAIAAIREQVGDQKVICGLSGGVDSSVAAVLIHEA 245

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +RK E E ++++F+   N PL   D  E F+ +L  + DPETKRK+
Sbjct: 246 IGDQLTCVFVDHGLLRKGEAEEVVTMFRDNYNMPLIHADEQELFLGELDGVSDPETKRKI 305

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ AK++G A FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 306 IGKLFIDVFQKHAKEVGDATFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 365

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E+++ILRE+DA+
Sbjct: 366 KLVEPLRELFKDEVRELGRELGLPPSFIGRHPFPGPGLAIRCPGEITREKLDILREADAV 425

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    
Sbjct: 426 YIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFTH 485

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NE+ GINRV YDITSKPP TIEWE
Sbjct: 486 EFLGETATRIINEIPGINRVTYDITSKPPGTIEWE 520


>gi|126737665|ref|ZP_01753395.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseobacter sp. SK209-2-6]
 gi|126721058|gb|EBA17762.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseobacter sp. SK209-2-6]
          Length = 527

 Score =  626 bits (1615), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 301/521 (57%), Positives = 386/521 (74%), Gaps = 10/521 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +D+ +E  P+A+I SG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMDFVREMAPKAVIFSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIEIK-KNCS 120
           SP+ P+EI +  +P+LGICYGQQ+M + LGGK +  +      + EFGRA++     N  
Sbjct: 68  SPRAPQEIFDYGVPILGICYGQQVMMEQLGGKVEGGKISGGGGTAEFGRAYVAPSVANLD 127

Query: 121 LLKGMWEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV 179
            L G +   S ++QVWMSHGD V  +  GFEV  +S + P+A  AD  R +YAVQFHPEV
Sbjct: 128 FLDGWFADDSDREQVWMSHGDHVSKLAPGFEVYGTSPNAPYAITADVSRNFYAVQFHPEV 187

Query: 180 VHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAA 239
            HT  G++L +NFV  +AG   +W M +Y ++++ +I+EQVG+++VIC +SGGVDS+VAA
Sbjct: 188 HHTPNGAKLYENFVR-LAGFSGDWTMGAYREQMIEKIREQVGDKQVICGLSGGVDSSVAA 246

Query: 240 FLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDP 299
            LI+EAIG  LTCV VDHG +RKNE E ++++F+   N  L   D S+ F+ +L    DP
Sbjct: 247 ILIHEAIGDQLTCVFVDHGLLRKNEAEEVVAMFRDNYNIKLIHADESDLFLGELDGQSDP 306

Query: 300 ETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGL 359
           ETKRK+IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGL
Sbjct: 307 ETKRKIIGKLFIDVFQKHADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGL 366

Query: 360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINIL 419
           PE M +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ IL
Sbjct: 367 PEKMGLKLVEPLRELFKDEVRALGRELGLPQSFIGRHPFPGPGLAIRCPGEITREKLEIL 426

Query: 420 RESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTAD 479
           RE+DAIY ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD
Sbjct: 427 READAIYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTAD 486

Query: 480 FYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +Y     FL + A RI+NEV+GINR  YDITSKPP TIEWE
Sbjct: 487 YYPFSHEFLGETATRIINEVQGINRCTYDITSKPPGTIEWE 527


>gi|307947086|ref|ZP_07662421.1| GMP synthase [Roseibium sp. TrichSKD4]
 gi|307770750|gb|EFO29976.1| GMP synthase [Roseibium sp. TrichSKD4]
          Length = 516

 Score =  626 bits (1615), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/517 (57%), Positives = 388/517 (75%), Gaps = 5/517 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASSLD 65
           + ++LIIDFGSQ TQLIARR+RE  VYCE+  F+N  D +  E  P+AIILSG PAS  D
Sbjct: 2   TDRILIIDFGSQVTQLIARRLRELNVYCEIHPFQNVTDGFLAEYAPKAIILSGGPASVTD 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNS-QSREFGRAFIEI-KKNCSLLK 123
             SP+ P  I E+ IP+LGICYGQQ+M   LGG+ ++  ++ EFGRA++    ++  LL+
Sbjct: 62  EGSPRPPYSIFETGIPVLGICYGQQVMMHMLGGQVESGHKTAEFGRAYVSPGAESLPLLE 121

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G + +G ++QVWMSHGD V  I  GFEV  +S + PFA   D  R +YAVQFHPEV HT 
Sbjct: 122 GWFSEG-REQVWMSHGDHVSAIASGFEVYGTSPNAPFAITGDAARNFYAVQFHPEVHHTP 180

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++ +NF+  +AG + +W M +Y +E + +I+EQVG+++VIC +SGGVDS+VAA LI+
Sbjct: 181 NGRRIYENFID-LAGCKRDWTMGAYREEAIEKIREQVGDKKVICGLSGGVDSSVAAVLIH 239

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R+ E E ++++F+ + N  L   D  + F+  L+ + DPE KR
Sbjct: 240 EAIGDQLTCVFVDHGLLRQGEAEEVVTMFRDHYNMQLIHADEQDLFLGALEGVSDPEEKR 299

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 300 KTIGRLFIDVFQKHANEIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 359

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG EL LP  F+ RHP PGPGLAIRC GEIT ++++ILR++D
Sbjct: 360 GLKLVEPLRELFKDEVRRLGVELGLPKHFIGRHPFPGPGLAIRCPGEITRDKLDILRQAD 419

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y ++I + G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y  
Sbjct: 420 AVYIDQIRRHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPF 479

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL + A RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 480 SHEFLGETATRIINEVKGINRVTYDITSKPPGTIEWE 516


>gi|118589178|ref|ZP_01546585.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Stappia aggregata IAM 12614]
 gi|118438507|gb|EAV45141.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Stappia aggregata IAM 12614]
          Length = 523

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/520 (57%), Positives = 389/520 (74%), Gaps = 10/520 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  E  P+A+I SG P S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLAEFAPKAVIFSGGPDSVTRAG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIE-IKKNCS 120
           +P+ P+ +    +P+LGICYGQQ+M Q LGG+    +      + EFGRAF+   +   S
Sbjct: 66  APRPPESVYAMGVPILGICYGQQVMMQQLGGQVDGGKISGGGGTAEFGRAFVTPAESKLS 125

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LL G + +G ++QVWMSHGD V  I  GFEV  +S + P+A  A++++ +YAVQFHPEV 
Sbjct: 126 LLDGWFAEG-REQVWMSHGDHVSRIAPGFEVFGTSPNAPYAITANKEKNFYAVQFHPEVH 184

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G +L +NFV  +AG   +W M +Y  + ++RI+EQVG+++VIC +SGGVDS+VAA 
Sbjct: 185 HTPNGKKLYENFVR-LAGFTGDWTMGAYKDDAIARIREQVGDKKVICGLSGGVDSSVAAV 243

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG +R NE + ++S+F+   N PL   D SE F+ +L  + DPE
Sbjct: 244 LIHEAIGDQLTCVFVDHGLLRLNEADEVVSMFRDNYNIPLIHADESELFLGELDGVSDPE 303

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 304 TKRKIIGKLFIDVFQKHANEIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP 363

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M +KLVEPL+ELFKDEVR LG+EL LP+ F+ RHP PGPGLAIRC GEIT E+++ILR
Sbjct: 364 EKMGLKLVEPLRELFKDEVRALGRELGLPEKFIGRHPFPGPGLAIRCPGEITLEKLDILR 423

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DA+Y ++I + G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+
Sbjct: 424 KADAVYIDQIRQHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADY 483

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y    +FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 484 YPFTHDFLGETATRIINEVQGINRVTYDITSKPPGTIEWE 523


>gi|84516251|ref|ZP_01003611.1| GMP synthase (glutamine-hydrolyzing) [Loktanella vestfoldensis
           SKA53]
 gi|84509947|gb|EAQ06404.1| GMP synthase (glutamine-hydrolyzing) [Loktanella vestfoldensis
           SKA53]
          Length = 519

 Score =  625 bits (1613), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 379/514 (73%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F    D F  E  P+A+I SG PAS     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFNKVTDAFLTEFAPKAVIFSGGPASVFADG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           +P  P+ + +  +P+LGICYGQQ+M   LGGK +    + EFGRAF+   +   LL G W
Sbjct: 68  APMPPQSVFDLGVPILGICYGQQVMMHVLGGKVERGHGTAEFGRAFVTPVEKLDLLDG-W 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               ++QVWMSHGD V  I  GF V  +S + PFA  AD KR +YAVQFHPEV HT  G+
Sbjct: 127 FLTEREQVWMSHGDHVSAIAPGFAVYGTSPNAPFAITADVKRHFYAVQFHPEVHHTPNGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV  +AG   +W MS+Y ++ ++ I+EQVG+++VIC +SGGVDS+VAA LI+EAI
Sbjct: 187 RLYENFVR-IAGFSGDWTMSAYREQAIAAIREQVGDKQVICGLSGGVDSSVAAVLIHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +R+ E E ++++F+ +   PL   D  E F+ KL  + DPETKRK+I
Sbjct: 246 GDQLTCVFVDHGLLRQGEAEEVVTMFRDHYQMPLIHADEKELFLGKLDGVSDPETKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 306 GGLFIDVFQKYANGIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 365

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E+++ILR++DA++
Sbjct: 366 LVEPLRELFKDEVRALGAELGLPPSFIGRHPFPGPGLAIRCPGEITREKLDILRKADAVF 425

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    +
Sbjct: 426 IDQIRKHGLYDDIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFTHD 485

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 486 FLGETATRIINEVQGINRVTYDITSKPPGTIEWE 519


>gi|294677395|ref|YP_003578010.1| GMP synthase [Rhodobacter capsulatus SB 1003]
 gi|294476215|gb|ADE85603.1| GMP synthase-1 (glutamine-hydrolyzing) [Rhodobacter capsulatus SB
           1003]
          Length = 518

 Score =  625 bits (1612), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/515 (58%), Positives = 377/515 (73%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  +YCE+  ++   D F  +  P+AII SG P S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELSIYCEIHPYQKVTDAFLADFAPKAIIFSGGPDSVTREG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           SP+ PK      +P+LGICYGQQ+M Q LGG  +    + EFGRAF+    +   +L G 
Sbjct: 66  SPRPPKSAFALGVPILGICYGQQVMMQELGGLVETGHGTAEFGRAFVTPTDERLPILDG- 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W     +QVWMSHGD V  I  GF V  +S   PFA  AD  R +YAVQFHPEV HT  G
Sbjct: 125 WFDAGPEQVWMSHGDHVSRIAPGFAVYGTSPGAPFAITADVARNFYAVQFHPEVHHTPKG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG   +W M+SY  + +++I+ QVG++RVIC +SGGVDS+VAA LI+EA
Sbjct: 185 AKLYENFVR-LAGFTGDWTMASYKDDAIAKIRAQVGDKRVICGLSGGVDSSVAAVLIHEA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG MR NE + ++S+F+   N PL   D ++ FI  L+ + DPE KRK 
Sbjct: 244 IGDQLTCVFVDHGLMRLNEADEVVSMFRDNYNIPLIHADEADLFIGALEGVSDPEVKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF+ EA KI GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 304 IGKLFIDVFQREANKIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP+ F+ RHP PGPGLAIRC GEIT E+++ILR++DA+
Sbjct: 364 KLVEPLRELFKDEVRALGRELGLPEKFIGRHPFPGPGLAIRCPGEITREKLDILRKADAV 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y    
Sbjct: 424 YIDQIRKHGLYDEIWQAFVAILPVKTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFSH 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL + A RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 484 DFLGETATRIINEVKGINRVTYDITSKPPGTIEWE 518


>gi|163747172|ref|ZP_02154528.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Oceanibulbus indolifex HEL-45]
 gi|161379733|gb|EDQ04146.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Oceanibulbus indolifex HEL-45]
          Length = 520

 Score =  625 bits (1611), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 301/516 (58%), Positives = 380/516 (73%), Gaps = 5/516 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDI 66
            ++LIIDFGSQ TQLIARR+RE  V+CE+  F    D F KE  P+A+ILSG P+S    
Sbjct: 7   DRLLIIDFGSQVTQLIARRLRELNVFCEIHPFNVVDDAFLKEFAPKAVILSGGPSSVFAE 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKG 124
            +P  P+ + E  +P+LGICYGQQ+M   LGG  +    + EFGRAF+    +   LL+G
Sbjct: 67  GAPMPPQAVFELGVPILGICYGQQVMMHCLGGHVERGHGTAEFGRAFVTPTGQQLELLEG 126

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
            W    ++QVWMSHGD V  I  GFEV  +S + PFA   D  R +YAVQFHPEV HT  
Sbjct: 127 -WFATDREQVWMSHGDHVSKIAPGFEVYGTSPNAPFAITGDVSRNFYAVQFHPEVHHTPN 185

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +L +NFV  +AG + +W M +Y  E ++ I+EQVG+++VIC +SGGVDS+VAA LI+E
Sbjct: 186 GPRLYENFVR-LAGFKGDWTMRAYRDEAIAAIREQVGDQKVICGLSGGVDSSVAAVLIHE 244

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RK E E ++++F+ + N PL   D  E F+ +L  + DPETKRK
Sbjct: 245 AIGDQLTCVFVDHGLLRKGEAEEVVTMFRDHYNMPLIHADEQELFLGELDGVSDPETKRK 304

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ AK +G A FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 305 IIGKLFIDVFQKHAKDVGDATFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 364

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DA
Sbjct: 365 LKLVEPLRELFKDEVRELGRELGLPPSFIGRHPFPGPGLAIRCPGEITREKLAILREADA 424

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I + G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y   
Sbjct: 425 VYIDQIRRHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFT 484

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 485 HDFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 520


>gi|149203862|ref|ZP_01880831.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseovarius sp. TM1035]
 gi|149142979|gb|EDM31021.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Roseovarius sp. TM1035]
          Length = 522

 Score =  624 bits (1610), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 296/516 (57%), Positives = 383/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++   D F +E  P+AII SG P S +   
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQKVTDAFLQEMAPRAIIFSGGPDSVMREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIEIKKNCSLLKGM 125
           SP+ P+   +  +P+LGICYGQQ+M Q LGG+ +  +  + EFGRA++      S     
Sbjct: 68  SPRPPQAAYDLGVPILGICYGQQVMMQDLGGRVEAGEHATAEFGRAYVTSTGVASGFVDG 127

Query: 126 WEKG-SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           W  G S++QVWMSHGD V  I  GFEV+ +S   PFA  AD  R +YAVQFHPEV HT  
Sbjct: 128 WFAGDSREQVWMSHGDHVSEIAPGFEVLGTSPGAPFAITADRARNFYAVQFHPEVHHTPN 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NF+   AG + +W M +Y +E +++I+ QVG+++VIC +SGGVDS+VAA LI+E
Sbjct: 188 GARLYENFIRQ-AGFKGDWTMGAYREEAIAKIRAQVGDKQVICGLSGGVDSSVAAVLIHE 246

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +R+ E + ++++F+   N PL   D +E F+ +L+ + DPETKRK
Sbjct: 247 AIGDQLTCVFVDHGLLRQGEADEVVAMFRDNYNIPLIHADEAELFLGELEGVSDPETKRK 306

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
            IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 307 TIGRLFIDVFQKYASQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 366

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E+++ILR++D 
Sbjct: 367 LKLVEPLRELFKDEVRALGRELGLPQSFIGRHPFPGPGLAIRCPGEITREKLDILRKADT 426

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I + G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y   
Sbjct: 427 VYIDQIRRHGLYDDIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFT 486

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 487 HEFLGETATRIINEVKGINRVTYDITSKPPGTIEWE 522


>gi|126726861|ref|ZP_01742700.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhodobacterales bacterium HTCC2150]
 gi|126703819|gb|EBA02913.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhodobacterales bacterium HTCC2150]
          Length = 519

 Score =  624 bits (1609), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/520 (57%), Positives = 381/520 (73%), Gaps = 4/520 (0%)

Query: 3   KRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPA 61
           K+    ++LIIDFGSQ TQLIARR+RE  VYCE+  ++   D F  + +P+A+ILSG P 
Sbjct: 2   KKPSHERLLIIDFGSQVTQLIARRLRELNVYCEIHPYQIVDDAFLADFDPKAVILSGGPD 61

Query: 62  SSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCS 120
           S     SP+ P+ + +  +P+LGICYGQQ M Q LGG  ++   + EFGRAF+  K   S
Sbjct: 62  SVTREGSPRAPQSLFDMGLPVLGICYGQQTMMQQLGGMVESGHGTAEFGRAFVTPKNTLS 121

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LL G W    K+QVWMSHGD V  I  GFEV  +S + P+A  AD  R +YAVQFHPEV 
Sbjct: 122 LLDG-WFAEDKEQVWMSHGDHVSKIAPGFEVYGTSPNAPYAITADVSRNFYAVQFHPEVH 180

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G++L +NFV  +AG   +W M +Y  + ++ I+ QVG+E+VIC +SGGVDS+VAA 
Sbjct: 181 HTPNGAKLYENFVK-MAGFTGDWTMDAYKDQAIAAIRAQVGDEKVICGLSGGVDSSVAAR 239

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG +RK E E ++++F+   N  L   D  E F+ +L    DPE
Sbjct: 240 LIHEAIGDQLTCVFVDHGLLRKGEAEEVVTMFRDNYNMQLIHADEQELFLGELDGQSDPE 299

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFI+VF++ A ++GGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 300 TKRKIIGKLFIDVFQKHASEVGGAKFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP 359

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT +++ ILR
Sbjct: 360 EKMGLKLVEPLRELFKDEVRALGEELGLPKSFIGRHPFPGPGLAIRCPGEITRQKLEILR 419

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           E+DA+Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAV S+DGMTAD+
Sbjct: 420 EADAVYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVNSVDGMTADY 479

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y     FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 480 YPFTHEFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 519


>gi|189424960|ref|YP_001952137.1| GMP synthase [Geobacter lovleyi SZ]
 gi|189421219|gb|ACD95617.1| GMP synthase, large subunit [Geobacter lovleyi SZ]
          Length = 517

 Score =  624 bits (1608), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/514 (57%), Positives = 380/514 (73%), Gaps = 4/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ TQLIARR+RE  VYCE+  +   L+  K   PQ IILSG P+S  D 
Sbjct: 8   SQKILILDFGSQVTQLIARRIREQSVYCEIHPYNMGLEKIKAFAPQGIILSGGPSSVYDA 67

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     + E  +P+LGICYG Q+M   LGGK + S  REFGRA + I     L  G+ 
Sbjct: 68  DAPHSDAGVYELGVPVLGICYGMQLMTSQLGGKVERSDKREFGRAAMTIDDTTDLFSGL- 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               K++VWMSHGD++E +P+GF  IA +D+TP A + DEKR+ YAVQFHPEVVHT  G+
Sbjct: 127 --SGKEEVWMSHGDKIEQMPKGFSAIAHTDNTPAAAMKDEKRRLYAVQFHPEVVHTPKGA 184

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +++ NFV  V G Q  W M+++ +  ++ I+E+VGN +VICA+SGGVDS+V A L+++AI
Sbjct: 185 EMLGNFVFTVCGCQPIWTMANFIETEIAAIREKVGNGKVICALSGGVDSSVVAVLLHKAI 244

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ V++G +RK E E +++LF  +    L  V+AS RF+ KLK I DPE KRK+I
Sbjct: 245 GDQLQCIFVNNGLLRKGEAEKVVNLFTRHFKINLDYVEASSRFLDKLKGITDPEQKRKII 304

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI +FE+EAKKIG   +L QGTLYPDVIES+S   GPS++IKSHHNVGGLP+ M MK
Sbjct: 305 GNEFIYLFEDEAKKIGTVDWLAQGTLYPDVIESVST-KGPSAVIKSHHNVGGLPDRMKMK 363

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP++ELFKDEVRLLGKEL LPD  + R P PGPGLAIRCIGEIT +R+ ILRESDAI 
Sbjct: 364 LIEPVRELFKDEVRLLGKELGLPDEVIHRQPFPGPGLAIRCIGEITADRLEILRESDAIV 423

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+YR+IWQ+F VLLPV++VGVMGD RTY+Y  +LRAV S+DGMTAD+      
Sbjct: 424 LDEIRKAGLYREIWQSFAVLLPVRSVGVMGDARTYDYTIALRAVNSLDGMTADWVKLPYE 483

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +  ++ RI+NEVKG+NRVVYDI+ KPPATIEWE
Sbjct: 484 VMGSISSRIINEVKGVNRVVYDISQKPPATIEWE 517


>gi|254501298|ref|ZP_05113449.1| GMP synthase, C-terminal domain protein [Labrenzia alexandrii
           DFL-11]
 gi|222437369|gb|EEE44048.1| GMP synthase, C-terminal domain protein [Labrenzia alexandrii
           DFL-11]
          Length = 524

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 300/520 (57%), Positives = 383/520 (73%), Gaps = 10/520 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  E  P+A+I SG P S     
Sbjct: 7   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDTFLAEFAPKAVIFSGGPDSVTREG 66

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIE-IKKNCS 120
           SP+ P+ +    +P+LGICYGQQ+M Q LGG+    +      + EFGRAF+     + S
Sbjct: 67  SPRPPESVYNIGVPILGICYGQQVMMQQLGGEVHGGKISGGGGTAEFGRAFVTPAGSDLS 126

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           +L G W  G K+QVWMSHGD V  +  GFEV  +S + P+A  AD +R +YAVQFHPEV 
Sbjct: 127 ILNG-WFAGGKEQVWMSHGDHVAKLAPGFEVFGTSPNAPYAITADTRRNFYAVQFHPEVH 185

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G  L +NFV  +AG   +W M +Y  + + +I++QVG+++VIC +SGGVDS+VAA 
Sbjct: 186 HTPNGKTLYENFVK-LAGFSGDWTMGAYKDDAIEKIRQQVGDKKVICGLSGGVDSSVAAV 244

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           LI+EAIG  LTCV VDHG +R NE E ++S+F+   N PL   D ++ F+ +L    DPE
Sbjct: 245 LIHEAIGDQLTCVFVDHGLLRLNEAEEVVSMFRDNYNIPLIHADETDLFLGELDGQSDPE 304

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
           TKRK+IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP
Sbjct: 305 TKRKIIGKLFIDVFQKHANEIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLP 364

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           E M +KLVEPL+ELFKDEVR LG+EL LP+SF+ RHP PGPGLAIRC GEIT +++ ILR
Sbjct: 365 EKMGLKLVEPLRELFKDEVRALGRELGLPESFIGRHPFPGPGLAIRCPGEITRDKLEILR 424

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
           ++DA+Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+
Sbjct: 425 KADAVYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADY 484

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           Y     FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 485 YPFTHEFLGETATRIINEVEGINRVTYDITSKPPGTIEWE 524


>gi|304321565|ref|YP_003855208.1| GMP synthase [Parvularcula bermudensis HTCC2503]
 gi|303300467|gb|ADM10066.1| GMP synthase [Parvularcula bermudensis HTCC2503]
          Length = 524

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/514 (57%), Positives = 385/514 (74%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD--YFKEQNPQAIILSGSPASSLDI 66
           ++L+IDFGSQ TQLIARR+RE  +YCE+  F N +D  + +E +P+ IILSG P+S    
Sbjct: 13  RLLVIDFGSQVTQLIARRLREDGIYCEIHPF-NRVDAAFLEEFSPKGIILSGGPSSVRTA 71

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            +P+  + I    +P+LGICYG+Q +   LGG+ + +  REFGRA + +  +  L +G+W
Sbjct: 72  TAPRPIEAIYAYGVPILGICYGEQCLVAQLGGEVERATHREFGRADVTVVSSSPLFQGVW 131

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            +G    VWMSHGD+V  +P+GF  IA++ S PFA IADE R YY VQFHPEVVHT+ G+
Sbjct: 132 TEGGTYPVWMSHGDRVIALPDGFHPIATTPSAPFAVIADELRNYYGVQFHPEVVHTLDGA 191

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L+ NF   + G+  +W M+S+ +E+ ++IK+QVG+ RVIC +SGGVDS VAA LI+EAI
Sbjct: 192 RLLSNFTRQICGLSGDWTMASFREEMTAKIKDQVGDGRVICGLSGGVDSAVAAVLIHEAI 251

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VD G MR+ E   ++ LF+ + + PL  V+A + F+ KL+ + DPE KRK+I
Sbjct: 252 GDQLTCVFVDTGLMRQGEARAVVDLFREHYHIPLVHVEAEDLFLSKLEGVEDPERKRKII 311

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI+VFE EAKKI G  FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M++K
Sbjct: 312 GGTFIDVFEAEAKKIKG-DFLAQGTLYPDVIESVSFDGGPSVTIKSHHNVGGLPERMNLK 370

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP+ FV+RHP PGPGLAIR  G +T E+ ++LR++DAIY
Sbjct: 371 LVEPLRELFKDEVRHLGQELGLPEGFVKRHPFPGPGLAIRIPGAVTREKADLLRQADAIY 430

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI   G+Y  IWQAF VLLPV+TVGVMGDER+Y++V +LRAVTS DGMTA+ Y  +  
Sbjct: 431 LEEIRAEGLYDAIWQAFAVLLPVKTVGVMGDERSYDWVLALRAVTSTDGMTAESYPFEHR 490

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FLS+VA R++NEV GINRV YD+TSKPP TIEWE
Sbjct: 491 FLSRVATRLINEVDGINRVTYDVTSKPPGTIEWE 524


>gi|84501069|ref|ZP_00999304.1| GMP synthase [Oceanicola batsensis HTCC2597]
 gi|84391136|gb|EAQ03554.1| GMP synthase [Oceanicola batsensis HTCC2597]
          Length = 523

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/517 (57%), Positives = 384/517 (74%), Gaps = 6/517 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ-NPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F+N    F E+  P+A+I SG P S +   
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFQNVSAAFLEEFAPRAVIFSGGPDSVMREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIE-IKKNCSLLKG 124
           SP+ PKE+ +  +P+LGICYGQQ+M   LGG+ +  +  + EFGRA++         L G
Sbjct: 68  SPRPPKEVYDLGVPILGICYGQQVMMHDLGGRVEAGEHATAEFGRAWVTPTDTKDGFLTG 127

Query: 125 MWEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +  G+ ++Q WMSHGD V  +  GF+V+ +S   PFA  AD  R++YAVQFHPEV HT 
Sbjct: 128 WFLDGTGREQAWMSHGDHVSELAPGFQVLGTSPGAPFAITADTDRRFYAVQFHPEVHHTP 187

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  L +NFV  +AG   +W M++Y +E+V  I++QVG+ +VICA+SGGVDS+VAA L++
Sbjct: 188 NGRTLYENFVR-MAGFTGDWTMAAYREEMVQIIRDQVGDAKVICALSGGVDSSVAAALLH 246

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG NLTCV VDHG +R NE E ++ +F+ + N  +      E F+  L+ + DPETKR
Sbjct: 247 EAIGENLTCVFVDHGLLRLNEAEEVVGMFRDHMNLSVIHAQEQELFLGALEGVSDPETKR 306

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 307 KTIGRLFIDVFQKYADQIEGARFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 366

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG+EL LPDSF+ RHP PGPGLAIRC GEIT +++ ILR++D
Sbjct: 367 GLKLVEPLRELFKDEVRTLGRELGLPDSFIGRHPFPGPGLAIRCPGEITRDKLEILRKAD 426

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y  
Sbjct: 427 AVYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPF 486

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL + A RI+NEVKGINRV YD+TSKPP TIEWE
Sbjct: 487 SHDFLGETATRIINEVKGINRVTYDVTSKPPGTIEWE 523


>gi|260575041|ref|ZP_05843042.1| GMP synthase, large subunit [Rhodobacter sp. SW2]
 gi|259022663|gb|EEW25958.1| GMP synthase, large subunit [Rhodobacter sp. SW2]
          Length = 518

 Score =  621 bits (1602), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/514 (58%), Positives = 373/514 (72%), Gaps = 3/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  F    D F +   P+AII SG PAS    +
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPFNKVDDAFLRAFAPKAIIFSGGPASVFAEN 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           +P  P       +P+LGICYGQQ+M   LGG  +    + EFGRAF+   +  S L   W
Sbjct: 66  APMPPAAAFTLGVPILGICYGQQVMMHCLGGLVERGHGTAEFGRAFVTPTEATSPLLDGW 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            +  ++QVWMSHGD V  +  GF+V  +S + PFA  AD  R +YAVQFHPEV HT  G+
Sbjct: 126 FQAGREQVWMSHGDHVSRLAPGFQVYGTSPNAPFAITADPSRHFYAVQFHPEVHHTPKGA 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV  +AG + +W M +Y  + +++I+ QVG  RVICA+SGGVDS+VAA LI+EAI
Sbjct: 186 KLYENFVE-MAGFKGDWTMGAYRADAIAKIRAQVGKGRVICALSGGVDSSVAAILIHEAI 244

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG MR NE E ++S+F+ + N PL   D S  F+ KL+ + DPETKRK+I
Sbjct: 245 GDQLTCVYVDHGLMRLNESEQVVSMFREHYNLPLIHADESALFLGKLEGVSDPETKRKII 304

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFIEVFE+ AK IGGA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLP  M+M+
Sbjct: 305 GGLFIEVFEKHAKAIGGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPARMNMQ 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++++LR +DA+Y
Sbjct: 365 LVEPLRELFKDEVRALGRELGLPQSFIGRHPFPGPGLAIRCPGEITAEKLDLLRRADAVY 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y +IWQAF  +LP++TVGVMGD RTY+Y  +LRAVTS+DGMTAD Y     
Sbjct: 425 IDQIRKHGLYDEIWQAFAAILPMKTVGVMGDGRTYDYAVALRAVTSVDGMTADTYPFSHE 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +   RI+NEV GINRV YD+TSKPP TIE E
Sbjct: 485 FLGETMTRIINEVPGINRVFYDVTSKPPGTIELE 518


>gi|254294170|ref|YP_003060193.1| GMP synthase [Hirschia baltica ATCC 49814]
 gi|254042701|gb|ACT59496.1| GMP synthase, large subunit [Hirschia baltica ATCC 49814]
          Length = 527

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/516 (58%), Positives = 383/516 (74%), Gaps = 6/516 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDY-FKEQNPQAIILSGSPASSLDID 67
           K LIIDFGSQ TQLIARR+RE+ VYCE+  ++N  D   K  NP+AII SG P S +   
Sbjct: 14  KALIIDFGSQVTQLIARRLRENGVYCEIHPYQNVTDASLKAYNPKAIIFSGGPDSVMREG 73

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIEIKKN-CSLLKG 124
           SP+ PK   E  +P+LGICYGQQ+M   LGG+ +  +  + EFGRAF+    N   +L+G
Sbjct: 74  SPRPPKAAYELGVPILGICYGQQVMMHDLGGRVEAGEHATAEFGRAFVTPSSNKLDMLEG 133

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
            +E G+ +QVWMSHGD V     GFEV  +S   PFA  AD KR ++AVQFHPEV HT  
Sbjct: 134 WFEDGN-EQVWMSHGDHVAERAPGFEVYGTSPGAPFAITADVKRNFFAVQFHPEVHHTPN 192

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L  NF+  +AG + +W M +Y +E ++RI+EQVG+++VIC +SGGVDS+V A L+++
Sbjct: 193 GNKLYANFLK-LAGFKGDWTMGAYREEAIARIREQVGDKQVICGLSGGVDSSVTALLLHQ 251

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV V++G +RKNE E ++++F       L   D SE F+ +L+   DPETKRK
Sbjct: 252 AIGDQLTCVFVNNGLLRKNEAEEVVAMFTENYKIKLVYADESELFLGELEGQDDPETKRK 311

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 312 IIGRLFIDVFQKYADTIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 371

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR+LG+EL LP SF+ RHP PGPGLAIRC G IT E++ ILRE+DA
Sbjct: 372 LKLVEPLRELFKDEVRILGRELGLPQSFIGRHPFPGPGLAIRCPGLITREKLAILREADA 431

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I K G+Y +IWQA+  +LPV+TVGVMGD RTY+Y C++RAVTS+DGMTAD+Y   
Sbjct: 432 VYIDQIRKHGLYDEIWQAYVAILPVRTVGVMGDGRTYDYACAMRAVTSVDGMTADYYPFS 491

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINRV YDITSKPP TIEWE
Sbjct: 492 HEFLGETATRIINEVKGINRVTYDITSKPPGTIEWE 527


>gi|254487519|ref|ZP_05100724.1| GMP synthase (glutamine-hydrolyzing) [Roseobacter sp. GAI101]
 gi|214044388|gb|EEB85026.1| GMP synthase (glutamine-hydrolyzing) [Roseobacter sp. GAI101]
          Length = 520

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/515 (57%), Positives = 377/515 (73%), Gaps = 5/515 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  V+CE+  F    D F ++  P+A+I SG P+S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVFCEIHPFNTVDDAFLRDFAPKAVIFSGGPSSVFAEG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKN-CSLLKGM 125
           +P  PK + +  +P+LGICYGQQ+M   LGGK +    + EFGRAF+    +   LL G 
Sbjct: 68  APMPPKSVFDLGVPILGICYGQQVMMHCLGGKVERGHGTAEFGRAFVTPTTDRLDLLDG- 126

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W    ++QVWMSHGD V  I  GFEV  +S + PFA   D  R +YAVQFHPEV HT  G
Sbjct: 127 WFTTDREQVWMSHGDHVSAIAPGFEVYGTSPNAPFAITGDASRHFYAVQFHPEVHHTPNG 186

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NFV  +AG + +W M +Y +E ++ I+ QVG+ +VIC +SGGVDS+VAA LI+EA
Sbjct: 187 AKLYENFVK-LAGFKGDWTMRAYREEAIANIRAQVGDAKVICGLSGGVDSSVAAVLIHEA 245

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +RK E E ++++F+   N PL   D  + F+ +L  + DPETKRK+
Sbjct: 246 IGDQLTCVFVDHGLLRKGEAEEVVTMFRDNYNMPLIHADEQDLFLGELDGVSDPETKRKI 305

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ A  +G A+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 306 IGRLFIDVFQKHATAVGDAKFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 365

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E++ ILRE+DA+
Sbjct: 366 KLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLAILREADAV 425

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAV S+DGMTAD+Y    
Sbjct: 426 YIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVNSVDGMTADYYPFTH 485

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 486 DFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 520


>gi|126736304|ref|ZP_01752046.1| GMP synthase [Roseobacter sp. CCS2]
 gi|126714125|gb|EBA10994.1| GMP synthase [Roseobacter sp. CCS2]
          Length = 519

 Score =  618 bits (1594), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 376/514 (73%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  +  P+A+ILSG P S     
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELSVYCEIHPYQNVTDAFLADFAPKAVILSGGPDSVTRDG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGMW 126
           SP+ P+ + +  IP+LGICYGQQ M + LGGK  + + + EFGRA++  +   SLL G W
Sbjct: 68  SPRAPQALFDMGIPVLGICYGQQTMMEQLGGKVVSGEGTAEFGRAYVTPEGKLSLLDG-W 126

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               K+QVWMSHGD V  I  GF V  +S S P+A  AD  R +YAVQFHPEV HT  G+
Sbjct: 127 FMTDKEQVWMSHGDHVSEIAPGFAVYGTSPSAPYAITADVARNFYAVQFHPEVHHTPNGA 186

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +L +NFV  +AG    W M +Y ++ +  IKEQVG+  VICA+SGGVDS+VAA L++EAI
Sbjct: 187 KLYENFVR-IAGFSGGWTMGAYREQAIDAIKEQVGDAHVICALSGGVDSSVAAALLHEAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VDHG +R NE E ++ +F+   N  +   D S+ F+ +L+   DPETKRK+I
Sbjct: 246 GDQLTCVFVDHGLLRLNEAEEVVGMFRDNMNLKVIHADESDLFLGELEGQSDPETKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+VF++ A +I  A FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +K
Sbjct: 306 GKLFIDVFQKYADQIEDAAFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLK 365

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT E++ ILR++DA+Y
Sbjct: 366 LVEPLRELFKDEVRALGVELGLPKSFIGRHPFPGPGLAIRCPGEITREKLEILRKADAVY 425

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            ++I K G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y     
Sbjct: 426 IDQIRKHGLYDYIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSHE 485

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 486 FLGETATRIINEVQGINRVTYDITSKPPGTIEWE 519


>gi|254459568|ref|ZP_05072984.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacterales bacterium
           HTCC2083]
 gi|206676157|gb|EDZ40644.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 524

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 296/519 (57%), Positives = 381/519 (73%), Gaps = 9/519 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASSLDID 67
           ++LI+DFGSQ TQLIARR+RE  VYCE+  ++N  D Y  E  P+A+ILSG P S     
Sbjct: 8   RLLIVDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAYLAEFAPKAVILSGGPDSVTREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIEIKKNCSL 121
           SP+ P+ + E  +P+LGICYGQQ+M Q LGGK +  +      + EFGRAF+  +   +L
Sbjct: 68  SPRAPESLFEYGVPVLGICYGQQVMMQQLGGKVEGGKISGGGGTAEFGRAFVTPQNTLAL 127

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
           L+G + +G+ +QVWMSHGD V  +  GFEV  +S + P+A  AD  R ++AVQFHPEV H
Sbjct: 128 LEGWFAEGN-EQVWMSHGDHVSALAPGFEVFGTSPNAPYAITADAARNFFAVQFHPEVHH 186

Query: 182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFL 241
           T  GS+L +NFV  +AG   +W M +Y  + +  I+ QVG+++VIC +SGGVDS+VAA L
Sbjct: 187 TPNGSKLYENFVR-LAGFTGDWTMDAYRDQAIEAIRAQVGDKKVICGLSGGVDSSVAAVL 245

Query: 242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPET 301
           I+EAIG  LTCV VDHG +RK E + ++S+F+   N      +  E F+ +L    DPET
Sbjct: 246 IHEAIGDQLTCVFVDHGLLRKGEADEVVSMFRDNYNMHFIHAEEQELFLGELDGQDDPET 305

Query: 302 KRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPE 361
           KRK+IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE
Sbjct: 306 KRKIIGRLFIDVFQKYAGQIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPE 365

Query: 362 HMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRE 421
            M +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT  +++ILRE
Sbjct: 366 KMGLKLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITRAKLDILRE 425

Query: 422 SDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFY 481
           +DA+Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAV S+DGMTAD+Y
Sbjct: 426 ADAVYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVNSVDGMTADYY 485

Query: 482 HHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
                FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 486 PFSHEFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 524


>gi|114766398|ref|ZP_01445367.1| GMP synthase [Pelagibaca bermudensis HTCC2601]
 gi|114541339|gb|EAU44387.1| GMP synthase [Roseovarius sp. HTCC2601]
          Length = 521

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 298/517 (57%), Positives = 382/517 (73%), Gaps = 6/517 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F KE  P+AII SG P S     
Sbjct: 6   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVSDAFLKEFAPKAIIFSGGPDSVTREG 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTK--NSQSREFGRAFIEIKKNCSLLKGM 125
           SP+ PK   E  +P+LGICYGQQ+M Q LGG+ +   S + EFGRA++   ++ +     
Sbjct: 66  SPRPPKAAYELGVPILGICYGQQVMMQDLGGRIEAGESHTAEFGRAYVTPTEHSTEFFNG 125

Query: 126 W--EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           W  +   ++QVWMSHGD V  I  GF+V  +S   PFA IAD +R++YAVQFHPEV HT 
Sbjct: 126 WFLDATGREQVWMSHGDHVAEIAPGFDVYGTSPGAPFAMIADLERRFYAVQFHPEVHHTP 185

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G+ L +NFV  +AG   +W M++Y +E++++I+EQVG+++VICA+SGGVDS+V   L++
Sbjct: 186 NGATLYENFVK-IAGFTGDWTMTAYREEMIAKIREQVGDKQVICALSGGVDSSVTGILLH 244

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R NE E ++S+F+   N  L   D SE F+  L+ + DPETKR
Sbjct: 245 EAIGDQLTCVFVDHGLLRLNEAEQVVSMFRDNYNLNLIHADESELFLGALEGVSDPETKR 304

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 305 KTIGKLFIDVFQKYADQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 364

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT +++ ILR++D
Sbjct: 365 GLKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRDKLEILRKAD 424

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y ++I K G+Y +IWQAF  +LP++TVGVMGD RTY+Y  +LRAVTS+DGMTAD+Y  
Sbjct: 425 AVYIDQIRKHGLYDEIWQAFAAILPMRTVGVMGDGRTYDYALALRAVTSVDGMTADYYPF 484

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL + + RI+NEVKGINRV YD TSKPP TIE E
Sbjct: 485 THEFLGETSTRIINEVKGINRVFYDCTSKPPGTIELE 521


>gi|86138375|ref|ZP_01056949.1| GMP synthase [Roseobacter sp. MED193]
 gi|85824900|gb|EAQ45101.1| GMP synthase [Roseobacter sp. MED193]
          Length = 538

 Score =  615 bits (1587), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 293/516 (56%), Positives = 383/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  +++ ++  P+A+I SG P S     
Sbjct: 24  RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTMEFVRQMAPKAVIFSGGPDSVTREG 83

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIE-IKKNCSLLKGM 125
           SP++P+EI +  +P+LGICYGQQ+M   LGG  ++   + EFGRA+++    +  LL+G 
Sbjct: 84  SPRVPQEIFDYGVPILGICYGQQVMMHQLGGMVESGHGTAEFGRAYVKPTVASLPLLQGW 143

Query: 126 WEKG-SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           ++    ++QVWMSHGD V  I  GFEV  +S + PFA  AD  R +YAVQFHPEV HT  
Sbjct: 144 FQDDEDREQVWMSHGDHVSKIAPGFEVYGTSPNAPFAITADVARNFYAVQFHPEVHHTPN 203

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G++L +NFV  +AG   +W M  Y ++ +  I+EQVG+++VIC +SGGVDS+V A L++E
Sbjct: 204 GAKLYENFVR-LAGFSGDWTMGLYREQAIEAIREQVGDKKVICGLSGGVDSSVTAVLLHE 262

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +RK E E ++++F+   N      D  + F+ +L+   DPETKRK
Sbjct: 263 AIGDQLTCVFVDHGLLRKGEAEEVVTMFRDNYNMQFIHADEQDLFLGELEGQSDPETKRK 322

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+LFI+VF++ A  I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 323 IIGKLFIDVFQKHANTIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 382

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E+++ILRE+DA
Sbjct: 383 LKLVEPLRELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILREADA 442

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y   
Sbjct: 443 VYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFS 502

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEVKGINR  YDITSKPP TIEWE
Sbjct: 503 HEFLGETATRIINEVKGINRCTYDITSKPPGTIEWE 538


>gi|84684953|ref|ZP_01012853.1| GMP synthase (glutamine-hydrolyzing) [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667288|gb|EAQ13758.1| GMP synthase (glutamine-hydrolyzing) [Rhodobacterales bacterium
           HTCC2654]
          Length = 526

 Score =  615 bits (1586), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/516 (57%), Positives = 382/516 (74%), Gaps = 5/516 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  E  P+A+I SG PAS +D  
Sbjct: 12  RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLAEFAPKAVIFSGGPASVIDEG 71

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKT-KNSQSREFGRAFIE-IKKNCSLLKGM 125
           SP+ P  + +  +P+LGICYGQQ+M   LGG+  +   + EFGRA++   ++    L G 
Sbjct: 72  SPRPPASVFDLGVPILGICYGQQVMMHMLGGEVLRGHGTAEFGRAYVTPTEERIDALNGW 131

Query: 126 WEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +  G+ ++QVWMSHGD V  I  GF+V  +S + PFA  AD +R++YAVQFHPEV HT  
Sbjct: 132 FMDGTGREQVWMSHGDHVSKIAPGFKVYGTSPNAPFAITADLERRFYAVQFHPEVHHTPN 191

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  L +NFV   AG + +W M +Y +E +++I+EQVG+  VIC +SGGVDS+V A L++E
Sbjct: 192 GKTLYENFVRD-AGFKGDWTMGAYREEAIAKIREQVGSSHVICGLSGGVDSSVTAVLLHE 250

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTCV VDHG +R NE E ++++F+ + N  L   D S+ F+ +L+ + DPE KRK
Sbjct: 251 AIGDQLTCVFVDHGLLRLNEAEEVVTMFRDHYNMKLIHADESDLFLGELEGVSDPEQKRK 310

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
            IG+LFI+VF++ A +I  A FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M 
Sbjct: 311 TIGKLFIDVFQKYASEIEDADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMG 370

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT ++++ILR++DA
Sbjct: 371 LKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRDKLDILRKADA 430

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           +Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD+Y   
Sbjct: 431 VYIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTADYYPFS 490

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL + A RI+NEV+GINRV YDITSKPP TIEWE
Sbjct: 491 HEFLGETATRIINEVQGINRVTYDITSKPPGTIEWE 526


>gi|310816163|ref|YP_003964127.1| GMP synthase [Ketogulonicigenium vulgare Y25]
 gi|308754898|gb|ADO42827.1| GMP synthase [Ketogulonicigenium vulgare Y25]
          Length = 518

 Score =  614 bits (1584), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/515 (56%), Positives = 377/515 (73%), Gaps = 3/515 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDI 66
            ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F ++  P+A+ILSG P S    
Sbjct: 5   DRLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLRDFAPKAVILSGGPDSVTRE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ-SREFGRAFIEIKKNCSLLKGM 125
            SP+ P+ + +  +P+LGICYGQQ M   LGGK +    + EFGRAF+    +   +   
Sbjct: 65  GSPRAPEALWDFGVPVLGICYGQQTMMTQLGGKVERGHGTAEFGRAFVTPAADALNILDG 124

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
           W     +QVWMSHGD V  I  GF+V  +S + PFA  AD +R ++AVQFHPEV HT  G
Sbjct: 125 WFAAGNEQVWMSHGDHVSAIAPGFKVYGTSPNAPFAITADTERNFFAVQFHPEVHHTPKG 184

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           ++L +NF+  +AG   +W M+ Y ++ + +I++QVG+++VICA+SGGVDS+V A LI EA
Sbjct: 185 AKLYENFIR-LAGFTGDWTMAGYREQAIQQIRDQVGDKQVICALSGGVDSSVTAILINEA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VDHG +RK+E   +  +F+   N  L   D SE F+  L+ + DPE KRK 
Sbjct: 244 IGDQLTCVFVDHGLLRKDEAIEVTRMFRENYNLNLIAADESEMFLGALEGVTDPEVKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+LFI+VF++ AK+I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +
Sbjct: 304 IGKLFIDVFDKYAKEIDGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGL 363

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LP+ F+ RHP PGPGLAIRC GE+T E+++ILR +DA+
Sbjct: 364 KLVEPLRELFKDEVRALGRELGLPEQFIRRHPFPGPGLAIRCPGEVTREKLDILRNADAV 423

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y ++I K G+Y +IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y +  
Sbjct: 424 YIDQIRKHGLYDEIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPYTH 483

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 484 EFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 518


>gi|126731353|ref|ZP_01747160.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Sagittula stellata E-37]
 gi|126708264|gb|EBA07323.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Sagittula stellata E-37]
          Length = 523

 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 294/522 (56%), Positives = 381/522 (72%), Gaps = 6/522 (1%)

Query: 4   RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPAS 62
           + +  ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  +  P+A+I SG P S
Sbjct: 3   QAQHDRLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLADFTPKAVIFSGGPDS 62

Query: 63  SLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSR--EFGRAFI-EIKKNC 119
                SP+ PK + +  +P+LGICYGQQ+M Q LGG+ +  QS   EFGRA++   ++  
Sbjct: 63  VTRDGSPRPPKTVYDLGVPILGICYGQQVMMQDLGGRVEAGQSHTAEFGRAYVMPTERTT 122

Query: 120 SLLKGMWEKGS-KQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPE 178
               G +  GS ++QVWMSHGD V  +  GFEV  +S   PFA  AD  R++YAVQFHPE
Sbjct: 123 DFFNGWFLDGSGREQVWMSHGDHVAELAPGFEVYGTSTGAPFAMTADLDRRFYAVQFHPE 182

Query: 179 VVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVA 238
           V HT  G  L +NFV  +AG   +W MS+Y +E++++I+EQVG+++VICA+SGGVDS+V 
Sbjct: 183 VHHTPNGKTLYENFVK-LAGFNGDWTMSAYREEMIAKIREQVGDKQVICALSGGVDSSVT 241

Query: 239 AFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVD 298
             L++EAIG  LTCV VDHG +R NE E ++ +F+   N  L   D S+ F+  L+ + D
Sbjct: 242 GILLHEAIGDQLTCVFVDHGLLRLNEAEQVVQMFRDNYNLNLIHADESDLFLGALEGVSD 301

Query: 299 PETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGG 358
           PE KRK IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGG
Sbjct: 302 PEIKRKTIGKLFIDVFQKYADQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGG 361

Query: 359 LPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINI 418
           LPE M +KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT +++ I
Sbjct: 362 LPEKMGLKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRDKLEI 421

Query: 419 LRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTA 478
           LR++DA+Y ++I K G+Y +IWQAF  +LP++TVGVMGD RTY+Y  +LRAVTS+DGMTA
Sbjct: 422 LRKADAVYIDQIRKHGLYDEIWQAFAAILPMRTVGVMGDGRTYDYALALRAVTSVDGMTA 481

Query: 479 DFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           D+Y    +FL + + RI+NEVKGINRV YD TSKPP TIE E
Sbjct: 482 DYYPFSHDFLGETSTRIINEVKGINRVFYDTTSKPPGTIELE 523


>gi|17989232|ref|NP_541865.1| GMP synthase [Brucella melitensis bv. 1 str. 16M]
 gi|21759171|sp|Q8YBL2|GUAA_BRUME RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|17985091|gb|AAL54129.1| gmp synthase (glutamine-hydrolyzing) [Brucella melitensis bv. 1
           str. 16M]
          Length = 507

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 279/447 (62%), Positives = 354/447 (79%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ TQLIARRVRE+ VYCE++ F++A + FK   P+ +ILSGSP S+ DI SP
Sbjct: 10  ILIIDFGSQVTQLIARRVREANVYCEIVPFQSADEAFKRLQPKGVILSGSPHSTTDIGSP 69

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           + P+ I ++ IP+LGICYG+Q MC  LGG  ++   REFGRAF++++++  L  G+W KG
Sbjct: 70  RAPQAIFDAGIPVLGICYGEQTMCAQLGGNVESGHDREFGRAFLDVQEDSPLFAGIWAKG 129

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++ QVWMSHGD+V  +P+GF +I +S + P+A IADEKRKYY VQFHPEVVHT  G++L+
Sbjct: 130 TRHQVWMSHGDRVTSLPDGFTIIGTSPNAPYAVIADEKRKYYGVQFHPEVVHTPDGAKLL 189

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFVH + G++  W M +Y ++ V  I++QVG+ +VICA+SGGVDS+VAA L +EA+G  
Sbjct: 190 QNFVHRIVGVKPGWTMGAYREQAVEAIRKQVGSGKVICALSGGVDSSVAALLAHEAVGDQ 249

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MRK+EV+ ++ +F+ + N PL +VDAS+RFI  L+   DPE KRK IG+L
Sbjct: 250 LTCILVDHGLMRKDEVQQVVEMFREHYNLPLILVDASDRFIGALEGESDPEKKRKTIGRL 309

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEA+K+GGA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M M+LVE
Sbjct: 310 FIEVFEEEARKLGGADFLVQGTLYPDVIESVSFTGGPSVTIKSHHNVGGLPERMKMQLVE 369

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVRLLGKEL LPDSF+ RHP PGPGLAIRC G +T E++ ILRE+DAIY +E
Sbjct: 370 PLRELFKDEVRLLGKELGLPDSFIGRHPFPGPGLAIRCPGGVTREKLEILREADAIYLDE 429

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMG 456
           I KAG+Y  IWQAF VLLPVQ  G  G
Sbjct: 430 IRKAGLYDAIWQAFAVLLPVQDRGRDG 456


>gi|260427551|ref|ZP_05781530.1| GMP synthase [Citreicella sp. SE45]
 gi|260422043|gb|EEX15294.1| GMP synthase [Citreicella sp. SE45]
          Length = 523

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 290/517 (56%), Positives = 379/517 (73%), Gaps = 6/517 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F K+  P+A+I SG P S +   
Sbjct: 8   RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVTDAFLKDFAPKAMIFSGGPDSVMREG 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ--SREFGRAFIEIKKNCSLLKGM 125
           SP+ P+      +P+LGICYGQQ+M   LGG+ +  +  + EFGRA++   ++ +     
Sbjct: 68  SPRPPQSAYALGVPILGICYGQQVMMHDLGGRVEAGEHATAEFGRAYVSPTEHSTDFFNG 127

Query: 126 W--EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           W  +   ++QVWMSHGD V  I  GF+V  +S   PFA  AD +R++YAVQFHPEV HT 
Sbjct: 128 WFLDGTGREQVWMSHGDHVAEIAPGFDVYGTSPGAPFAMTADLERRFYAVQFHPEVHHTP 187

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G+ L +NFV  +AG   +W M +Y +E++++I+EQVG+++VICA+SGGVDS+V   L++
Sbjct: 188 NGATLYENFVR-IAGFTGDWTMGAYREEMIAKIREQVGDKKVICALSGGVDSSVTGILLH 246

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  LTCV VDHG +R NE E ++S+F+   N  L   D S+ F+  L+ + DPETKR
Sbjct: 247 EAIGDQLTCVFVDHGLLRLNEAEQVVSMFRDNYNLNLIHADESDLFLGALEGVSDPETKR 306

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG+LFI+VF++ A +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M
Sbjct: 307 KTIGKLFIDVFQKYADQIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKM 366

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KLVEPL+ELFKDEVR LG EL LP SF+ RHP PGPGLAIRC GEIT +++ ILR++D
Sbjct: 367 GLKLVEPLRELFKDEVRALGHELGLPASFIGRHPFPGPGLAIRCPGEITRDKLEILRKAD 426

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y ++I K G+Y +IWQAF  +LP++TVGVMGD RTY+Y  +LRAVTS+DGMTAD+Y  
Sbjct: 427 AVYIDQIRKHGLYDEIWQAFAAILPMRTVGVMGDGRTYDYALALRAVTSVDGMTADYYPF 486

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL + + RI+NEVKGINRV YD TSKPP TIE E
Sbjct: 487 THEFLGETSTRIINEVKGINRVFYDCTSKPPGTIELE 523


>gi|89054712|ref|YP_510163.1| GMP synthase [Jannaschia sp. CCS1]
 gi|88864261|gb|ABD55138.1| GMP synthase (glutamine-hydrolyzing) [Jannaschia sp. CCS1]
          Length = 535

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 295/521 (56%), Positives = 379/521 (72%), Gaps = 13/521 (2%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYF-KEQNPQAIILSGSPASSLDID 67
           ++LIIDFGSQ TQLIARR+RE  VYCE+  ++N  D F  +  P+AII SG P S     
Sbjct: 19  RLLIIDFGSQVTQLIARRLRELNVYCEIHPYQNVDDAFIGDFAPKAIIFSGGPDSVTRDG 78

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIEIKKNCSL 121
           SP+ P+    + +P+LGICYGQQ+M Q LGG+    +      + EFGRAF+E     +L
Sbjct: 79  SPRPPQAAYAAGVPILGICYGQQVMMQDLGGEVHGGKISGGGGTAEFGRAFVEPTGALAL 138

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
           L+G W    K+QVWMSHGD V  +  GFEV  +S + P+A  AD +R ++AVQFHPEV H
Sbjct: 139 LQG-WFADGKEQVWMSHGDHVAKLAPGFEVYGTSPNAPYAITADLERNFFAVQFHPEVHH 197

Query: 182 TVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFL 241
           T  G+ L +NFV  +AG   +W M +Y ++ V  I+ QVG+ +VICA+SGGVDS+V A L
Sbjct: 198 TPRGAMLYENFVK-LAGFSGDWTMGAYREQAVEAIRAQVGDAKVICALSGGVDSSVTAAL 256

Query: 242 IYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASER--FIRKLKNIVDP 299
           ++EAIG  LTCV VDHG +R NE   ++ +F+ + N  L V+ A E+  F+ +L  + DP
Sbjct: 257 LHEAIGDQLTCVFVDHGLLRLNEGAEVVEMFRDHMN--LHVIHAEEQDLFLGELDGVSDP 314

Query: 300 ETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGL 359
           ETKRK+IG+LFI+VF++ A +I GA FL QGTLYPDVIES+SF GGPS  IKSHHNVGGL
Sbjct: 315 ETKRKIIGRLFIDVFQKYAGQIEGADFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGL 374

Query: 360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINIL 419
           PE M + LVEPL+ELFKDEVR LG+EL LP  F+ RHP PGPGLAIRC GEIT  +++IL
Sbjct: 375 PEKMGLTLVEPLRELFKDEVRALGRELGLPAHFIARHPFPGPGLAIRCPGEITRAKLDIL 434

Query: 420 RESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTAD 479
           R++DA+Y ++I + G+Y +IWQAF  +LPV+TVGVMGD RTY+Y C+LRAVTS+DGMTAD
Sbjct: 435 RQADAVYIDQIRRHGLYDEIWQAFVAILPVRTVGVMGDGRTYDYACALRAVTSVDGMTAD 494

Query: 480 FYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +Y    +FL + A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 495 YYPFSHDFLGETATRIINEVPGINRVTYDITSKPPGTIEWE 535


>gi|291278885|ref|YP_003495720.1| GMP synthase glutamine-hydrolyzing [Deferribacter desulfuricans
           SSM1]
 gi|290753587|dbj|BAI79964.1| GMP synthase, glutamine-hydrolyzing [Deferribacter desulfuricans
           SSM1]
          Length = 517

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/513 (55%), Positives = 385/513 (75%), Gaps = 1/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           +K+LI+DFGSQ+TQLIARR+RE++VYCE+  +   L+  KE NP+ +ILSG P S  D D
Sbjct: 6   NKILILDFGSQYTQLIARRIRENRVYCEIFPYNVELERIKEFNPKGMILSGGPKSVYDED 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P + +EI E  IP+LGICYG Q+MC+   G    ++ RE+G A + + +   L   +  
Sbjct: 66  APFVSEEIYELGIPVLGICYGMQLMCKHFNGVVGRAEKREYGYAELIVNQKEILFDDIPL 125

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           +  K +VWMSHGD++E +PE F VI  +D++P A +  +++ +YA+QFHPEV HT  GS 
Sbjct: 126 ENGKLKVWMSHGDRLEKMPEDFIVIGKTDNSPVAAMKHKEKPFYALQFHPEVAHTDYGSS 185

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF   + G    W   ++    + +I+EQVG+++V+CA+SGGVDS+V A L+ EAIG
Sbjct: 186 ILANFAIKICGCLPVWTAGNFIHNEIEKIREQVGDKKVLCALSGGVDSSVVAVLLNEAIG 245

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTCV V++G +RKNE E ++  F+   N  L  VDA E F++ L+ + DPE KRK+IG
Sbjct: 246 KNLTCVFVNNGLLRKNEAEQVVKTFRDNFNINLIFVDAEEEFLKALRGVTDPEKKRKIIG 305

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
            LFI++FE EA+K+G   FL QGTLYPDVIES+S F GPS+ IK+HHNVGGLPE M+ KL
Sbjct: 306 NLFIKIFEREAEKLGRFDFLAQGTLYPDVIESVS-FKGPSATIKTHHNVGGLPEKMNFKL 364

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR +G EL LP+  V RHP PGPGLAIR IG+IT+ER++ILRE+D+I  
Sbjct: 365 IEPLRELFKDEVRQVGLELGLPEDIVYRHPFPGPGLAIRVIGDITKERLDILREADSIAI 424

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EEI KAG+YR+IWQAFTVLLPV++VGVMGDERTYE+V + RAVTS+DGMTAD+     + 
Sbjct: 425 EEIKKAGLYREIWQAFTVLLPVKSVGVMGDERTYEHVLAFRAVTSLDGMTADWAKIPYDV 484

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L++++ RI+NEVKGINRVVYDI+SKPPATIEWE
Sbjct: 485 LARISNRIINEVKGINRVVYDISSKPPATIEWE 517


>gi|254437220|ref|ZP_05050714.1| GMP synthase, C-terminal domain protein [Octadecabacter antarcticus
           307]
 gi|198252666|gb|EDY76980.1| GMP synthase, C-terminal domain protein [Octadecabacter antarcticus
           307]
          Length = 507

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/509 (56%), Positives = 364/509 (71%), Gaps = 9/509 (1%)

Query: 19  FTQLIARRVRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASSLDIDSPQIPKEILE 77
            TQLIARR+RE  VYCE+  ++N  D    + NP+A+ILSG P S     SP+ P  +  
Sbjct: 1   MTQLIARRLREQNVYCEIHPYQNVTDAMLADLNPKAVILSGGPDSVTRAGSPRAPNSLWR 60

Query: 78  SNIPLLGICYGQQIMCQSLGGKTKNSQ------SREFGRAFIEIKKNCSLLKGMWEKGSK 131
             IP+LGICYGQQ M Q LGG  +  +      + EFGRA +       LL G W     
Sbjct: 61  MGIPVLGICYGQQTMMQQLGGLVEGGKISGGGGTAEFGRAKVTPAGTLDLLDG-WFDAGP 119

Query: 132 QQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDN 191
           +QVWMSHGD V  I  GFEV  +S + P+A IAD  R YY VQFHPEV HT  G++L +N
Sbjct: 120 EQVWMSHGDHVSKIAPGFEVYGTSPNAPYAVIADTSRNYYGVQFHPEVHHTPRGAKLYEN 179

Query: 192 FVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLT 251
           FV  +AG +  W M +Y    +++I+EQVG+++VIC +SGGVDS+V A L++EAIG  LT
Sbjct: 180 FVR-LAGFKGGWTMDAYRDIAIAKIREQVGDKQVICGLSGGVDSSVTAALLHEAIGDQLT 238

Query: 252 CVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFI 311
           CV VDHG +R NE ++++++F+   N  +   D  E F+  L+   DPETKRK+IG LFI
Sbjct: 239 CVFVDHGLLRLNEADDVMTMFRDNMNLKVIYADEKELFLGALEGQSDPETKRKIIGGLFI 298

Query: 312 EVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPL 371
           +VF++ A KI GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +KLVEPL
Sbjct: 299 DVFQKYANKIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLKLVEPL 358

Query: 372 KELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIH 431
           +ELFKDEVR LG+EL LP SF+ RHP PGPGLAIRC GEIT E+++ILR++DA+Y ++I 
Sbjct: 359 RELFKDEVRALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILRQADAVYIDQIR 418

Query: 432 KAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQV 491
           K G+Y  IWQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    NFL + 
Sbjct: 419 KHGLYHDIWQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSHNFLGET 478

Query: 492 AIRIVNEVKGINRVVYDITSKPPATIEWE 520
           A RI+NEV GINRV YDITSKPP TIEWE
Sbjct: 479 ATRIINEVAGINRVTYDITSKPPGTIEWE 507


>gi|198283571|ref|YP_002219892.1| GMP synthase large subunit [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666576|ref|YP_002426196.1| GMP synthase [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248092|gb|ACH83685.1| GMP synthase, large subunit [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518789|gb|ACK79375.1| GMP synthase [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 514

 Score =  601 bits (1550), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 284/512 (55%), Positives = 367/512 (71%), Gaps = 1/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQFTQLIARRVRE+ VYCE+  +  AL       P+ IILSG P+S  D+D+
Sbjct: 4   RILILDFGSQFTQLIARRVREAHVYCEIHPYNMALAEIWAWRPKGIILSGGPSSVHDVDA 63

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P +   +    +P+LGICYG Q+M Q LGG+   ++ RE+GRA ++IK+           
Sbjct: 64  PSVDPALFAMGLPVLGICYGLQLMAQLLGGRVGKAEHREYGRAHLQIKEAIGPFLPFGAA 123

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G+ ++VWMSHGD++E +P+GF V+ASS ++P A I D  R +Y VQFH EV HT  G+++
Sbjct: 124 GAAEEVWMSHGDRIESMPDGFRVLASSANSPLAAIGDSARNFYGVQFHLEVAHTPRGAEM 183

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           +  FV  V G   +W M SY    V+ I+ QVG  RVI A+SGGVDS VA  LI+ AIG 
Sbjct: 184 LTAFVRGVCGCTGDWTMHSYVDTAVATIRAQVGKGRVIAALSGGVDSAVAVVLIHRAIGD 243

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD+G +R  E E + ++F+ Y   PL+VVDA +RF+  L ++ DPE KRK IG 
Sbjct: 244 QLTCIFVDNGLLRFGEAEKVATVFRNYFQIPLQVVDARQRFLDVLADVTDPEKKRKAIGN 303

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFIE+FEEE+K + GA FL QGTLYPDVIESIS F GPS+ IKSHHNVGGLPE M ++LV
Sbjct: 304 LFIEIFEEESKHLEGADFLAQGTLYPDVIESIS-FKGPSATIKSHHNVGGLPERMRLQLV 362

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL +P+  + R P PGPGLAIRC+G + E R+ +LR +D I  E
Sbjct: 363 EPLRELFKDEVRELGRELGMPEEVIRRQPFPGPGLAIRCLGAVDEHRLEVLRRADRIVME 422

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+Y ++WQAF VLLPV++VGVMGD RTY+   +LRAV S DGMTAD+ H     L
Sbjct: 423 EIRDAGLYGRLWQAFAVLLPVRSVGVMGDARTYDETVALRAVESADGMTADWAHIPYEVL 482

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 483 GRISTRIINEVAGINRVVYDISSKPPATIEWE 514


>gi|322421067|ref|YP_004200290.1| GMP synthase large subunit [Geobacter sp. M18]
 gi|320127454|gb|ADW15014.1| GMP synthase, large subunit [Geobacter sp. M18]
          Length = 516

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 291/514 (56%), Positives = 377/514 (73%), Gaps = 4/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S KVLI+DFGSQ TQLIARRVRE  VYCE+  +  ALD  KE  P+ IILSG P+S  D 
Sbjct: 7   SEKVLILDFGSQVTQLIARRVREQSVYCEIHPYNMALDKIKEFAPKGIILSGGPSSVYDK 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     I E  IP+LGICYG Q+M Q LGG+ +    REFGRA + +     +  G +
Sbjct: 67  DAPHSDLGIYELGIPILGICYGMQLMTQQLGGRVERCDKREFGRATLLLDGASEIFAG-F 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E G+  +VWMSHGD++E +P GF+++A +   P A + DEKR +Y VQFHPEVVHT  G 
Sbjct: 126 EGGA--EVWMSHGDRIEQMPAGFKLMAHTTGCPVAAMKDEKRNFYGVQFHPEVVHTPRGD 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           ++I NF+ +V G +  W M+++ +  +  I+ +VG  +V+CA+SGGVDS V A LI++AI
Sbjct: 184 EMIGNFLFNVCGSRPTWTMANFIETEMEEIRRKVGTGKVLCALSGGVDSAVVAVLIHKAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L CV V++G +RK E + +++LF  +    L  VDA++RF+  L+ I DPE KRK+I
Sbjct: 244 GDQLHCVFVNNGLLRKGEADKVVNLFTKHFKINLTHVDAADRFLGMLEGISDPEQKRKII 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI +FEEEAKK+G   +L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M++K
Sbjct: 304 GNEFIYLFEEEAKKLGQVDYLAQGTLYPDVIESVST-KGPSAVIKSHHNVGGLPEKMNLK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP++ELFKDEVRLLGKEL +PD  V R P PGPGLAIRCIGE++ E+++ILR++DAI 
Sbjct: 363 LLEPVRELFKDEVRLLGKELGMPDEVVYRQPFPGPGLAIRCIGELSAEKLDILRDADAIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI KAG+YR IWQ+F VLLPV+TVGVMGD RTYE+  +LRAV S+DGMTAD+      
Sbjct: 423 IEEIRKAGLYRDIWQSFAVLLPVKTVGVMGDARTYEWTVALRAVNSLDGMTADWVKLPYE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L  ++ RI+NEVKG+NRVVYDI+ KPPATIEWE
Sbjct: 483 LLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516


>gi|148265151|ref|YP_001231857.1| GMP synthase [Geobacter uraniireducens Rf4]
 gi|146398651|gb|ABQ27284.1| GMP synthase (glutamine-hydrolyzing) [Geobacter uraniireducens Rf4]
          Length = 516

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/514 (55%), Positives = 373/514 (72%), Gaps = 4/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ TQLIARRVRE  +YCE+  +  + +  KE  P+ IILSG P+S  D 
Sbjct: 7   SEKILILDFGSQVTQLIARRVREQSIYCEIHPYSMSFEKIKEFAPKGIILSGGPSSVYDK 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     + +  +P+LGICYG Q+M Q LGGK + S  REFG + +++     L  G  
Sbjct: 67  DAPHSDLGVFDLGLPVLGICYGMQLMTQQLGGKVERSDKREFGGSSLQLDDVSDLFAGF- 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
                  VWMSHGD++E +P GF+VIA ++  P A + DEKR +Y VQFHPEVVHT  G 
Sbjct: 126 --DGAADVWMSHGDRIEEMPAGFQVIAHTEHCPVAAMKDEKRHFYGVQFHPEVVHTPRGD 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           ++  NF+ ++ G +  W M+++ +  +  I+ +VG  RV+CA+SGGVDS+V A LI++AI
Sbjct: 184 EMFGNFLFNICGCEPTWTMANFIETEIESIRRKVGTGRVLCALSGGVDSSVVAVLIHKAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L CV V++G +RK E E +++LF  +    L  VDAS+RF+ KL  + DPETKRK+I
Sbjct: 244 GDQLHCVFVNNGLLRKGEAEKVVNLFSKHFRINLDYVDASDRFLEKLSGVSDPETKRKII 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI +FEEEAKKIG   +L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M++K
Sbjct: 304 GNEFIYLFEEEAKKIGKVDYLAQGTLYPDVIESVST-KGPSAVIKSHHNVGGLPEKMNLK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP++ELFKDEVRLLGKEL +PD  + R P PGPGLAIRCIGE++ E ++ILRE+DAI 
Sbjct: 363 LLEPVRELFKDEVRLLGKELGMPDEVIYRQPFPGPGLAIRCIGELSRENLDILREADAIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI KAG+YR+IWQ+F VLLPV+TVGVMGD RTYE   +LRAV S+DGMTAD+      
Sbjct: 423 IDEIRKAGLYREIWQSFAVLLPVKTVGVMGDARTYENTVALRAVNSLDGMTADWVKLPYE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L  ++ RI+NEVKG+NRVVYDI+ KPPATIEWE
Sbjct: 483 LLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516


>gi|253699425|ref|YP_003020614.1| GMP synthase [Geobacter sp. M21]
 gi|251774275|gb|ACT16856.1| GMP synthase, large subunit [Geobacter sp. M21]
          Length = 516

 Score =  598 bits (1542), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 287/514 (55%), Positives = 380/514 (73%), Gaps = 4/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S KVLI+DFGSQ TQLIARRVRE  VYCE+  +  AL+  K   P+ IILSG P+S  D 
Sbjct: 7   SEKVLILDFGSQVTQLIARRVREQSVYCEIHPYNMALEKIKAFAPKGIILSGGPSSVYDK 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     I +  +P+LGICYG Q+M Q LGG+ +    REFGRA + +     +  G +
Sbjct: 67  DAPHSDLGIYDLGVPVLGICYGMQLMTQQLGGRVERCDKREFGRATLALDGKSEIFAG-F 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           + G+  +VWMSHGD++E +P GF+++A ++  P A + DEKR ++ VQFHPEVVHT  G 
Sbjct: 126 DGGA--EVWMSHGDRIEAMPAGFQLMAHTEGCPVAAMKDEKRNFFGVQFHPEVVHTPRGE 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           ++I NF+ +V G Q  W M+++ +  ++ I+E+VG  +V+CA+SGGVDS V A LI++AI
Sbjct: 184 EMIGNFLFNVCGSQPTWTMANFIETELASIREKVGTGKVLCALSGGVDSAVVAVLIHKAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L CV V++G +RK E + +++LF  +    L  VDA++RF+  L+ I DPE KRK+I
Sbjct: 244 GDQLHCVFVNNGLLRKGEADKVVNLFTKHFKINLTHVDAADRFLGMLEGISDPEQKRKII 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI +FEEEAKK+G   +L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M++K
Sbjct: 304 GNEFIYLFEEEAKKLGQVDYLAQGTLYPDVIESVST-KGPSAVIKSHHNVGGLPEKMNLK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP++ELFKDEVRLLGKEL +PD  V R P PGPGLAIRCIGE++ E+++ILR++DAI 
Sbjct: 363 LLEPVRELFKDEVRLLGKELGMPDEVVYRQPFPGPGLAIRCIGELSAEKLDILRDADAIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI KAG+YR+IWQ+F VLLPV+TVGVMGD RTYE+  +LRAV S+DGMTAD+      
Sbjct: 423 IEEIRKAGLYREIWQSFAVLLPVKTVGVMGDARTYEWTVALRAVNSLDGMTADWVKLPYE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L  ++ RI+NEVKG+NRVVYDI+ KPPATIEWE
Sbjct: 483 LLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516


>gi|317051162|ref|YP_004112278.1| GMP synthase large subunit [Desulfurispirillum indicum S5]
 gi|316946246|gb|ADU65722.1| GMP synthase, large subunit [Desulfurispirillum indicum S5]
          Length = 518

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 282/514 (54%), Positives = 379/514 (73%), Gaps = 1/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S+K+LI+DFGSQ+TQLIARRVRE++VYCE++ F  +++  ++   + IILSG PAS    
Sbjct: 6   SNKILILDFGSQYTQLIARRVREARVYCEIMPFNTSIEIIRDFGARGIILSGGPASVFAE 65

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           ++P   K I +  +P+LGICYG Q++  + GG+   S  REFGRA + I     L   + 
Sbjct: 66  EAPLPDKAIFDLGLPILGICYGMQLIGHTQGGRVATSAKREFGRAKLLIDNQQDLFADLD 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +   VWMSHGD+VE +P GFE IA +++ P A + + +R+ +A+QFHPEVVHT  G+
Sbjct: 126 IVDNTCTVWMSHGDKVEQLPPGFEAIAHTENAPIAAMRNGERRIWAIQFHPEVVHTYEGA 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NFVH + G +  W M+++ +  ++ I+E VG+  V+CA+SGGVDS+VAA LI+ AI
Sbjct: 186 TMLANFVHKICGCEPTWNMTNFIESKIAEIRETVGDASVLCALSGGVDSSVAAVLIHRAI 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV V++G +RKNE E ++  F+ + +  L   DAS+RF++KL  + DPE KRK+I
Sbjct: 246 GDRLTCVFVNNGLLRKNEAEAVVKTFRDHYHMNLHYEDASDRFLQKLAGVSDPEKKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI VFE+  K++G   FL QGTLYPDVIES+S   GPS++IKSHHNVGGLPE++D K
Sbjct: 306 GNEFIYVFEDVKKRLGSFDFLAQGTLYPDVIESVS-VKGPSAVIKSHHNVGGLPENIDFK 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP +ELFKDEVRL+G EL +PD  V RHP PGPGL IR +GEI++ER+++LRE+D I+
Sbjct: 365 LLEPFRELFKDEVRLVGLELGMPDEIVHRHPFPGPGLGIRVLGEISKERLDVLREADHIF 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI  A +YR IWQAF VLLPV TVGVMGDERTYE  C+LRAVTS+DGMTAD+ H    
Sbjct: 425 LEEIKMADLYRHIWQAFVVLLPVNTVGVMGDERTYENACALRAVTSVDGMTADWAHIPYE 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L++++ RI+NEVKGINRVVYDI+SKPP TIEWE
Sbjct: 485 VLARISNRIINEVKGINRVVYDISSKPPGTIEWE 518


>gi|197117160|ref|YP_002137587.1| GMP synthase [Geobacter bemidjiensis Bem]
 gi|197086520|gb|ACH37791.1| guanosine monophosphate synthase [Geobacter bemidjiensis Bem]
          Length = 516

 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 286/514 (55%), Positives = 379/514 (73%), Gaps = 4/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S KVLI+DFGSQ TQLIARRVRE  VYCE+  +  AL+  K   P+ IILSG P+S  D 
Sbjct: 7   SEKVLILDFGSQVTQLIARRVREQSVYCEIHPYNMALEKIKAFAPKGIILSGGPSSVYDK 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     I +  IP+LGICYG Q+M Q LGG+ +    REFGRA + +     +  G +
Sbjct: 67  DAPHSDLGIYDLGIPVLGICYGMQLMTQQLGGRVERCDKREFGRATLALDGKSEIFAG-F 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           + G+  +VWMSHGD++E +P GF+++A +   P A + DEKR ++ VQFHPEVVHT  G 
Sbjct: 126 DGGA--EVWMSHGDRIEAMPAGFQLMAHTTGCPVAAMKDEKRNFFGVQFHPEVVHTPRGD 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           ++I NF+ +V G +  W M+++ +  ++ I+E+VG  +V+CA+SGGVDS V A LI++AI
Sbjct: 184 EMIGNFLFNVCGSKPTWTMANFIETELASIREKVGTGKVLCALSGGVDSAVVAVLIHKAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L CV V++G +RK E + +++LF  +    L  VDA++RF+  L+ + DPE KRK+I
Sbjct: 244 GDQLHCVFVNNGLLRKGEADKVVNLFTKHFKINLAHVDAADRFLGMLEGVSDPEQKRKII 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI +FEEEAKK+G   +L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M++K
Sbjct: 304 GNEFIYLFEEEAKKLGQVDYLAQGTLYPDVIESVST-KGPSAVIKSHHNVGGLPEKMNLK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EP++ELFKDEVRLLGKEL +PD  V R P PGPGLAIRCIGE++ E+++ILR++DAI 
Sbjct: 363 LLEPVRELFKDEVRLLGKELGMPDEVVYRQPFPGPGLAIRCIGELSAEKLDILRDADAIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI KAG+YR+IWQ+F VLLPV+TVGVMGD RTYE+  +LRAV S+DGMTAD+      
Sbjct: 423 IEEIRKAGLYREIWQSFAVLLPVKTVGVMGDARTYEWTVALRAVNSLDGMTADWVKLPYE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L  ++ RI+NEVKG+NRVVYDI+ KPPATIEWE
Sbjct: 483 LLGSISSRIINEVKGVNRVVYDISQKPPATIEWE 516


>gi|255021404|ref|ZP_05293452.1| GMP synthase (glutamine-hydrolyzing) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969267|gb|EET26781.1| GMP synthase (glutamine-hydrolyzing) [Acidithiobacillus caldus ATCC
           51756]
          Length = 513

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 280/514 (54%), Positives = 370/514 (71%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S ++LI+DFGSQFTQLIARR+RE++VYCE+  +  +L   +   P  I+LSG P+S  D 
Sbjct: 2   SERILILDFGSQFTQLIARRIREAQVYCEIHPYNLSLAAIRAWQPSGIVLSGGPSSVADA 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P +  E+    +P+LGICYG Q+M   LGG+   S  RE+GRA +EI +     + + 
Sbjct: 62  DAPLVDAELFALGVPVLGICYGLQLMTHLLGGRVAKSDHREYGRARLEILEAEGPFQSLV 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G+ ++VWMSHGD++E +PEGF  I  S  +P A IA  +R+ + VQFH EV HT  G+
Sbjct: 122 AGGT-EEVWMSHGDRIETLPEGFVAIGRSPGSPLAAIAHRQRRLFGVQFHLEVAHTPAGA 180

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           Q++ +FV  V G    W M SY +  ++ ++ QVG  RVI A+SGGVDS VA+ L++ A+
Sbjct: 181 QMLTDFVRGVCGCNGQWTMHSYSESAIAAVRAQVGQGRVISALSGGVDSAVASILVHRAV 240

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ VD+G +R  EVE +  +F+ Y + PL VVDA  RF+  L  + DPE KRK+I
Sbjct: 241 GEQLHCIFVDNGLLRFGEVEQVSQVFRQYFHIPLHVVDARARFLDALAGVTDPERKRKII 300

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFIEVF+EEAK +GGA FL QGTLYPDVIES+SF  GPS+ IKSHHNVGGLPE M ++
Sbjct: 301 GNLFIEVFDEEAKALGGADFLVQGTLYPDVIESVSF-KGPSATIKSHHNVGGLPERMRLQ 359

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR LG+EL +P+  V R P PGPGLAIRC+GE+T  R+++LR +D I 
Sbjct: 360 LVEPLRELFKDEVRELGRELGMPEEIVRRQPFPGPGLAIRCLGEVTGPRLDVLRRADRIV 419

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
           +EEI +AG Y ++WQAF VLLPV++VGVMGD RTYE   ++RAV S DGMTAD+ H    
Sbjct: 420 QEEIREAGYYDRVWQAFAVLLPVRSVGVMGDGRTYEETLAIRAVESSDGMTADWAHLPHE 479

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L++++ RI+NEV G+NRVVYDI+SKPPATIEWE
Sbjct: 480 LLARMSTRIINEVAGVNRVVYDISSKPPATIEWE 513


>gi|301063575|ref|ZP_07204092.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [delta proteobacterium NaphS2]
 gi|300442307|gb|EFK06555.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [delta proteobacterium NaphS2]
          Length = 518

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 282/514 (54%), Positives = 377/514 (73%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ+TQLIARRVRE+KVYCE+  F   LD  K  +P+ IILSG PAS  D 
Sbjct: 7   SEKILILDFGSQYTQLIARRVREAKVYCEIHPFNMELDAIKAFSPKGIILSGGPASIYDE 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           ++P   + +LE +IP+LGICYG Q M    GG+   S  RE+G A + I+ +  L  G +
Sbjct: 67  NAPMAHEGLLELDIPMLGICYGMQFMTHLQGGQVARSGDREYGSATMTIRDDKDLFYG-F 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           EK  +  VWMSHGD++E +P+GFEV+ASS ++P A + D  R+ + VQFHPEV HT  G 
Sbjct: 126 EKADEWTVWMSHGDRIEQMPDGFEVLASSKNSPVAAMVDASRQLFGVQFHPEVAHTPEGP 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +++ NF+  V G + +W M+S+    V  ++E++G +RVIC +SGGVDS+V A L++EA+
Sbjct: 186 KILSNFLFRVCGCEPSWTMASFVSRTVETLREKLGGKRVICGLSGGVDSSVTAVLLHEAV 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NL+C+LVD+G +RK+E   ++++F+ Y    L +VDAS+ F+  L  + DPE KRK+I
Sbjct: 246 GDNLSCILVDNGLLRKDEARKVVAVFQEYYGIDLHLVDASKHFLDCLSGVTDPEEKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+ FI +FE++A ++G AQ+L QGTLYPDVIES+S F GPS+ IKSHHNVGGLPE M++K
Sbjct: 306 GREFINIFEKKAAELGSAQYLAQGTLYPDVIESVS-FKGPSATIKSHHNVGGLPEVMNLK 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR +G EL LP   V R P PGPGLAIR +GEIT ER+ ILR +D I 
Sbjct: 365 LVEPLRELFKDEVREVGIELGLPRELVMRQPFPGPGLAIRILGEITAERLEILRLADVIV 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI  AG+Y K+WQ+F VLLPV+TVGVMGDERTYE V ++R V S+D MTAD+      
Sbjct: 425 LDEIKMAGLYEKVWQSFAVLLPVRTVGVMGDERTYENVIAVRVVDSLDAMTADWSKIPYE 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + +++ RI+N VKG+NRVVYDI+SKPP TIEWE
Sbjct: 485 VMGRISNRIINSVKGVNRVVYDISSKPPGTIEWE 518


>gi|206889695|ref|YP_002248055.1| GMP synthase (glutamine-hydrolyzing) [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741633|gb|ACI20690.1| GMP synthase (glutamine-hydrolyzing) [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 510

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 284/512 (55%), Positives = 379/512 (74%), Gaps = 4/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++L+IDFGSQ+TQLIARRVRE KVY E+I         +++NP  IILSG PAS  + DS
Sbjct: 3   EILVIDFGSQYTQLIARRVRELKVYSEIIPCNAPFSEIEKRNPSGIILSGGPASVFEKDS 62

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P I ++I    IP+LGICYG Q++   LGGK   ++ RE+G+A ++I     L     E 
Sbjct: 63  PSIDRKIFNLEIPILGICYGMQLITHLLGGKVSRAEKREYGKAILKIDDFSDLFA---EI 119

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            ++  VWMSH D++  +PEGF  +A ++++P+A +AD+ RK YA+QFHPEVVHT  G ++
Sbjct: 120 KNETVVWMSHADKINEMPEGFIRLAHTENSPYAAMADKVRKIYALQFHPEVVHTEEGKKI 179

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  + G +  W M S+ +     I+++VG  +V+CA+SGGVDSTV A L+++AIG 
Sbjct: 180 LKNFVFKICGCKPTWNMHSFVERETEEIRKKVGKYKVVCALSGGVDSTVTAVLVHKAIGD 239

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD+G +R  E E +  + +   +  L+VVDASERF+++LK + DPE KRK+IG 
Sbjct: 240 ALTCIFVDNGLLRAGEREKVEEMLRNNFHINLKVVDASERFLKRLKGVHDPERKRKIIGG 299

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI++FEEEAKKI G +FL QGTLYPDVIESISF  GPS+ IKSHHNVGGL + M +KL+
Sbjct: 300 EFIKIFEEEAKKIEGVKFLAQGTLYPDVIESISF-KGPSATIKSHHNVGGLLKRMKLKLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LGKEL +P+  + RHP PGPGLAIRC+GE+T ER+ ILR++D I  E
Sbjct: 359 EPLRELFKDEVRELGKELGIPEEILYRHPFPGPGLAIRCVGEVTRERLEILRQADKIVLE 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI K+G Y+K+WQ+F VLLP++TVGVMGDERTYE+V ++RAV S+DGMTAD+       L
Sbjct: 419 EIKKSGWYKKVWQSFAVLLPIRTVGVMGDERTYEHVIAIRAVHSVDGMTADWVKLPHELL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 479 ERLSNRIINEVKGVNRVVYDITSKPPGTIEWE 510


>gi|296127335|ref|YP_003634587.1| GMP synthase, large subunit [Brachyspira murdochii DSM 12563]
 gi|296019151|gb|ADG72388.1| GMP synthase, large subunit [Brachyspira murdochii DSM 12563]
          Length = 514

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/513 (55%), Positives = 380/513 (74%), Gaps = 4/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
            KVLI+DFGSQFTQLI RR+RE  VY E+  F  ++D+ KE NP+AIILSG P+S  + D
Sbjct: 6   DKVLILDFGSQFTQLITRRIRELNVYSEIHPFHVSIDFIKEFNPKAIILSGGPSSVYEED 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P++ K + E  IP+LGICYG QI+  S+GGK +++  RE+G+A IEI  + S+ K    
Sbjct: 66  APKVDKALFELGIPILGICYGMQIIVYSMGGKVESASKREYGKAEIEITNHESIFKSF-- 123

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
              K  VWMSHGD ++ IPEGFE+IA + +T  A I ++++  YA+QFHPEVVHT  G +
Sbjct: 124 -DKKNIVWMSHGDSIKSIPEGFELIAKTPNTELAAIENKQKNIYAIQFHPEVVHTENGIK 182

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           +I+NF+ ++   + NW M S+ +  V+RIKE+VG++ VI  +SGGVDS+VAA LI +AIG
Sbjct: 183 IIENFLFNICKCEKNWNMGSFIEYEVNRIKERVGDKNVILGLSGGVDSSVAAVLIEKAIG 242

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ V++G +RK+E + ++ +F+   N  L  VDAS+RF+ KL  + DPE KRK+IG
Sbjct: 243 KQLKCIFVNNGLLRKDEDKKVVEVFRDNFNIDLIYVDASKRFLDKLAGVTDPEQKRKIIG 302

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             F+ VF +EAKKI    FL QGTLYPDVIES+S   G S++IKSHHNVGGLP+ M  +L
Sbjct: 303 HEFVSVFNDEAKKIENVGFLAQGTLYPDVIESVSL-RGSSAVIKSHHNVGGLPKDMKFEL 361

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EP +ELFKDEVR +G EL+LP+  V R P PGPGLA+R +G+ITEER+ IL+E+D I  
Sbjct: 362 LEPFRELFKDEVREIGLELKLPEDIVYRQPFPGPGLAVRILGDITEERVKILQEADDIVV 421

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
            EI  AG+YRK+WQ+F VLLPV++VGVMGD RTYE VC++RAV S+D MTAD+   D N 
Sbjct: 422 AEIKHAGLYRKLWQSFAVLLPVKSVGVMGDGRTYEQVCAVRAVESVDAMTADWAKIDYNV 481

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L  ++ RI+NEVKGINRVVYDI+SKPPATIEWE
Sbjct: 482 LGIISNRIINEVKGINRVVYDISSKPPATIEWE 514


>gi|300871832|ref|YP_003786705.1| bifunctional GMP synthase glutamine amidotransferase protein
           [Brachyspira pilosicoli 95/1000]
 gi|300689533|gb|ADK32204.1| bifunctional GMP synthase glutamine amidotransferase protein
           [Brachyspira pilosicoli 95/1000]
          Length = 514

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 284/513 (55%), Positives = 379/513 (73%), Gaps = 4/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
            KVLI+DFGSQFTQLI RR+RE  VY E+  F  ++D+ KE NP+AIILSG P+S  + D
Sbjct: 6   DKVLILDFGSQFTQLITRRIRELNVYSEIHPFHVSIDFIKEFNPKAIILSGGPSSVYEED 65

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P++ K++ E  IP+LGICYG QI+  S+GGK +++  RE+G+A IEI  + S+ K    
Sbjct: 66  APKVDKKLFELGIPILGICYGMQIIVYSMGGKVESADKREYGKAEIEITNHESIFKSF-- 123

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
            G    VWMSHGD ++ IPEGFE+IA + +T  A I ++++  YA+QFHPEVVHT  G +
Sbjct: 124 -GKNNIVWMSHGDSIKSIPEGFELIAKTPNTELAAIENKQKNIYAIQFHPEVVHTENGIK 182

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           +I+NF+ ++   + NW M S+ +  + RIKE VG++ VI  +SGGVDS+VAA LI +AIG
Sbjct: 183 IIENFLFNICKCERNWNMGSFIEYEIKRIKETVGDKNVILGLSGGVDSSVAAVLIEKAIG 242

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ V++G +RK+E + ++ +F+   N  L  VDAS+RF+ KL  + DPE KRK+IG
Sbjct: 243 KQLKCIFVNNGLLRKDEDKKVVEVFRDNFNIDLIYVDASKRFLDKLAGVTDPEQKRKIIG 302

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             F+ VF +EAKKI    FL QGTLYPDVIES+S   G S++IKSHHNVGGLP+ M  +L
Sbjct: 303 HEFVSVFNDEAKKIENVGFLAQGTLYPDVIESVSL-RGSSAVIKSHHNVGGLPKDMKFEL 361

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EP +ELFKDEVR +G EL+LP+  V R P PGPGLA+R +G+ITEER+ IL+E+D I  
Sbjct: 362 LEPFRELFKDEVREIGLELKLPEDIVYRQPFPGPGLAVRILGDITEERVKILQEADDIVV 421

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
            EI KAG+YRK+WQ+F +LLPV++VGVMGD RTYE VC++R V S+D MTAD+   D N 
Sbjct: 422 SEIKKAGLYRKLWQSFAILLPVKSVGVMGDGRTYEQVCAVRCVESVDAMTADWAKIDYNV 481

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L  ++ RI+NEVKGINRVVYDI+SKPPATIEWE
Sbjct: 482 LGIISNRIINEVKGINRVVYDISSKPPATIEWE 514


>gi|225621479|ref|YP_002722738.1| bifunctional GMP synthase/glutamine amidotransferase [Brachyspira
           hyodysenteriae WA1]
 gi|254800088|sp|C0QYF1|GUAA_BRAHW RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|225216300|gb|ACN85034.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Brachyspira hyodysenteriae WA1]
          Length = 514

 Score =  586 bits (1510), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 283/512 (55%), Positives = 379/512 (74%), Gaps = 4/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           KVLI+DFGSQFTQLI RR+RE  VY E+  F  ++D+ KE  P+AIILSG P+S  + D+
Sbjct: 7   KVLILDFGSQFTQLITRRIRELNVYSEIHPFHVSIDFIKEFKPKAIILSGGPSSVYEEDA 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P++ K++ E  +P+LGICYG QI+  S+GGK +++  RE+G+A IEI  + S+ K     
Sbjct: 67  PKVDKQLFELGMPILGICYGMQIIVYSMGGKVESADKREYGKAEIEITNHESIFKSF--- 123

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G    VWMSHGD ++ IPEGFE+IA + +T  A I ++++  YA+QFHPEVVHT  G ++
Sbjct: 124 GKSNIVWMSHGDSIKSIPEGFELIAKTPNTELAAIENKQKNIYAIQFHPEVVHTENGIKI 183

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I+NF+ ++   + NW M S+ +  + RI+E VG++ VI  +SGGVDS+VAA LI +AIG 
Sbjct: 184 IENFLFNICKCERNWNMGSFIEYEIKRIRETVGDKNVILGLSGGVDSSVAAVLIEKAIGK 243

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L C+ V++G +RK+E + ++ +F+   N  L  VDAS+RF+ KL  + DPE KRKVIG 
Sbjct: 244 QLKCIFVNNGLLRKDEDKKVVEVFRDNFNIDLIYVDASKRFLDKLAGVTDPEQKRKVIGH 303

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            F+ VF +EAKKI    FL QGTLYPDVIES+S   G S++IKSHHNVGGLP+ M  +L+
Sbjct: 304 EFVSVFNDEAKKIENVGFLAQGTLYPDVIESVSL-RGSSAVIKSHHNVGGLPKDMKFELL 362

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EP +ELFKDEVR +G EL+LP+  V R P PGPGLA+R +G+ITEER+ IL+E+D I   
Sbjct: 363 EPFRELFKDEVREIGLELKLPEDIVYRQPFPGPGLAVRILGDITEERVKILQEADDIVVS 422

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+YRK+WQ+F +LLPV++VGVMGD RTYE VC++RAV S+D MTAD+   D N L
Sbjct: 423 EIKKAGLYRKLWQSFAILLPVKSVGVMGDGRTYEQVCAVRAVESVDAMTADWAKIDYNVL 482

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             ++ RI+NEVKGINRVVYDI+SKPPATIEWE
Sbjct: 483 GIISNRIINEVKGINRVVYDISSKPPATIEWE 514


>gi|158520983|ref|YP_001528853.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Desulfococcus oleovorans Hxd3]
 gi|158509809|gb|ABW66776.1| GMP synthase, large subunit [Desulfococcus oleovorans Hxd3]
          Length = 509

 Score =  584 bits (1506), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 368/511 (72%), Gaps = 3/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQF QLIARRVRE+KVYC++      +   +   P+ IILSG P+   +  SP
Sbjct: 2   ILIIDFGSQFNQLIARRVRENKVYCQIEPPTITISRIRALAPEGIILSGGPSGIYEKHSP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ K + +  +P+LGICYG Q M  +LGG    +  RE+G A + +K    + KG+   G
Sbjct: 62  KVTKAVFDLGVPVLGICYGMQFMVGALGGAVHAATKREYGFAELAVKAQAKIFKGV---G 118

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K   WMSHGD  E +P GF++I S+++T  A IAD +RK+Y +QFHPEV HT  G+ +I
Sbjct: 119 KKTTCWMSHGDSAETVPPGFKIIGSTENTKIAAIADTRRKFYGLQFHPEVAHTAEGTTMI 178

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +   +  W M+++ +E ++ I+E+VG +RVI  +SGGVDS+VAA LI+ AIG  
Sbjct: 179 ANFLFDICKCRPTWSMAAFAEETIAEIRERVGEKRVILGLSGGVDSSVAALLIHHAIGRQ 238

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VD+G +RK+E + + ++F       +R V+A+ RF++ L  + DPE KRK+IG++
Sbjct: 239 LTCIFVDNGLLRKDEAKKLKAVFAEKLQLNIRFVNAAGRFLKALAGVADPEKKRKIIGKI 298

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           F++VFE EAKKI GA FL QGTLYPDVIES S FGGP+SIIKSHHNVGGLP  M + L+E
Sbjct: 299 FMDVFEAEAKKIKGADFLAQGTLYPDVIESQSAFGGPTSIIKSHHNVGGLPAKMKLSLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVRLLGK L L D  V R P PGPGLAIR IG++   ++ +LRE DAI  EE
Sbjct: 359 PLRFLFKDEVRLLGKTLGLDDDMVHRQPFPGPGLAIRIIGKVDRRQLTLLREVDAILLEE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG YRK+WQ+F VLLP+++VG+MGD+RTYE + ++RAVTS+D MTAD+     + + 
Sbjct: 419 IRKAGYYRKLWQSFAVLLPLKSVGIMGDKRTYENIAAIRAVTSVDAMTADWARLPHDLMG 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 479 RISNRIINEVKGVNRVVYDISSKPPSTIEWE 509


>gi|242279024|ref|YP_002991153.1| GMP synthase [Desulfovibrio salexigens DSM 2638]
 gi|259647677|sp|C6BSD8|GUAA_DESAD RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|242121918|gb|ACS79614.1| GMP synthase, large subunit [Desulfovibrio salexigens DSM 2638]
          Length = 515

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 279/516 (54%), Positives = 383/516 (74%), Gaps = 2/516 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           +  +KV+I+DFGSQFTQLIARR+RE+ VY E+          K+ NP A+ILSG P+S L
Sbjct: 2   QHDNKVIILDFGSQFTQLIARRIREAGVYSEIHPCNVDPQKIKDLNPGALILSGGPSSVL 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           + +SPQ+   +LE  +P+LGICYG Q+M   LGG+  +S+ RE+GRA  +   +C++ +G
Sbjct: 62  EDESPQLDPSLLELGVPVLGICYGMQLMTNDLGGRVVSSEDREYGRAEFKGDSSCTIFEG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           + E   K  VWMSHGD+VE IPEGF+V  +++S PFA +A+E++K YA+QFHPEV HT  
Sbjct: 122 I-EDIEKLTVWMSHGDRVEAIPEGFKVCGTTESIPFAAMANEEKKMYALQFHPEVAHTES 180

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G+ +I+NFV  VAG++ +W MSS+ +  +  ++E++G+ +V+  +SGG+DSTV A L+++
Sbjct: 181 GTTIINNFVFKVAGLKADWTMSSFVENCIEEMREKIGDNQVVLGLSGGIDSTVVAVLLHK 240

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  L C+ VD+G +R +E E +I   + +    ++ VD++E F+ KLK + DPE KRK
Sbjct: 241 AIGKRLHCIFVDNGLLRMHEREEVIGFLEEHFELNVKCVDSAELFLDKLKGVEDPEKKRK 300

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FI+VF EEA  +   +FL QGTLYPDVIES SF  GPS++IKSHHNVGGLPE MD
Sbjct: 301 LIGYTFIDVFNEEASALKDVKFLAQGTLYPDVIESESF-KGPSAVIKSHHNVGGLPEDMD 359

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           + LVEPL+ELFKDEVR +  EL LP+  + R P PGPGLAIR +GEITEER+ ILR++D 
Sbjct: 360 LDLVEPLRELFKDEVRKVAYELGLPEFIIWRQPFPGPGLAIRVLGEITEERLEILRQADK 419

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I + E+H +G YRK+WQ F VLLP++TVGVMGD+RTYE+V +LR V SID MTAD+    
Sbjct: 420 IVQNEMHASGWYRKVWQGFAVLLPLKTVGVMGDDRTYEHVIALRIVDSIDAMTADWSRIP 479

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + L++++ RI+NEVKG+NRVV DI+SKPPATIEWE
Sbjct: 480 NDILARMSNRIINEVKGVNRVVLDISSKPPATIEWE 515


>gi|224368988|ref|YP_002603152.1| GMP synthase [Desulfobacterium autotrophicum HRM2]
 gi|223691705|gb|ACN14988.1| GuaA1 [Desulfobacterium autotrophicum HRM2]
          Length = 509

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 282/511 (55%), Positives = 370/511 (72%), Gaps = 3/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQF QLIARRVRE+++YC+V      ++  K  NP+ IILSG P+S  + DSP
Sbjct: 2   ILIIDFGSQFNQLIARRVRENEIYCQVEPAGIDIERIKALNPEGIILSGGPSSIYEDDSP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++  EI   N+P+LGICYG Q M  +LGG  + S  RE+G A + IK +  L  G+ EK 
Sbjct: 62  KVDTEIFNLNVPILGICYGMQFMVNALGGSIERSDKREYGFADLTIKDHAPLFTGL-EKS 120

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +  QVWMSHGD    +P GF V AS+ +T  A +AD K  +Y +QFHPEV HT+GG +++
Sbjct: 121 T--QVWMSHGDSTNRLPAGFTVTASTKNTEIAAMADNKNHFYGLQFHPEVEHTLGGFEML 178

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V   + +W MSS+    V +IKE VG+++VI  +SGGVDS+VAA LI+ AIG N
Sbjct: 179 KNFLFNVCHCEKSWTMSSFVTGAVEQIKEAVGDKKVIMGLSGGVDSSVAALLIHRAIGKN 238

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L C+ VD+G +R NE  N+      + +  +R VDA   F+ +L  + DPE KRK+IG L
Sbjct: 239 LYCIFVDNGLLRNNERTNLEKSLTTHLDMNIRFVDARRLFLDQLAGVEDPEKKRKIIGNL 298

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VFE+EAKKI GA+FLGQGTLYPD+IES S FGGP+SIIKSHHNVGGLPE M +KLVE
Sbjct: 299 FIDVFEDEAKKIDGAEFLGQGTLYPDIIESKSAFGGPTSIIKSHHNVGGLPEKMKLKLVE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR LG EL L ++ V R P PGPGLAIR +G ++E+R++IL+ +D +  EE
Sbjct: 359 PLQFLFKDEVRKLGLELGLNENLVWRQPFPGPGLAIRIMGAVSEKRLSILKAADTLLLEE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+YRK+WQ+F VLLP+++VGVMGD+RTY+   ++RAVTS D MTAD+       L+
Sbjct: 419 IRAAGLYRKLWQSFAVLLPIKSVGVMGDKRTYDSCIAIRAVTSKDAMTADWARLPHELLA 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            V+ RI+NEV G+NRVV+DITSKPP TIEWE
Sbjct: 479 TVSNRIINEVDGVNRVVFDITSKPPGTIEWE 509


>gi|254449475|ref|ZP_05062912.1| GMP synthase (glutamine-hydrolyzing) [Octadecabacter antarcticus
           238]
 gi|198263881|gb|EDY88151.1| GMP synthase (glutamine-hydrolyzing) [Octadecabacter antarcticus
           238]
          Length = 499

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 357/501 (71%), Gaps = 9/501 (1%)

Query: 27  VRESKVYCEVIAFKNALD-YFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGI 85
           +RE  VYCE+  ++N  D    +  P+A+ILSG P S     SP+ P  +    IP+LGI
Sbjct: 1   MREQNVYCEIHPYQNVTDAMLADLTPKAVILSGGPDSVTRGGSPRAPDSLWTMGIPVLGI 60

Query: 86  CYGQQIMCQSLGGKTKNSQ------SREFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHG 139
           CYGQQ M Q LGG  +  +      + EFGRA +       LL G W     +QVWMSHG
Sbjct: 61  CYGQQTMMQQLGGLVEGGKISGGGGTAEFGRAKVTSAGTLDLLDG-WFSDGPEQVWMSHG 119

Query: 140 DQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFVHHVAGI 199
           D V  I  GFEV  +S + PFA IAD  R YY VQFHPEV HT  G++L +NFV  +AG 
Sbjct: 120 DHVSKIAPGFEVYGTSPNAPFAIIADASRHYYGVQFHPEVHHTPRGAKLYENFVR-LAGF 178

Query: 200 QDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGF 259
           +  W M +Y    +++I+EQVG+++VIC +SGGVDS+V A L++EAIG  LTCV VDHG 
Sbjct: 179 KGGWTMDAYRDIAIAKIREQVGDKQVICGLSGGVDSSVTAALLHEAIGDQLTCVFVDHGL 238

Query: 260 MRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAK 319
           +R NE ++++++F+   N  +   D  E F+  L+   DPETKRK+IG LFI+VF++ A 
Sbjct: 239 LRLNEADDVVAMFRDNMNLKVIYADEKELFLGALEGQSDPETKRKIIGGLFIDVFQKYAN 298

Query: 320 KIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEV 379
           +I GA+FL QGTLYPDVIES+SF GGPS  IKSHHNVGGLPE M +KLVEPL+ELFKDEV
Sbjct: 299 EIEGAEFLAQGTLYPDVIESVSFSGGPSVTIKSHHNVGGLPEKMGLKLVEPLRELFKDEV 358

Query: 380 RLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKI 439
           R LG+EL LP SF+ RHP PGPGLAIRC GEIT E+++ILR++DA+Y ++I K G+Y +I
Sbjct: 359 RALGRELGLPASFIGRHPFPGPGLAIRCPGEITREKLDILRQADAVYIDQIRKHGLYDEI 418

Query: 440 WQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEV 499
           WQAF  +LPV+TVGVMGD RTY++ C+LRAVTS+DGMTAD+Y    +FL + A RI+NEV
Sbjct: 419 WQAFVAILPVRTVGVMGDGRTYDFACALRAVTSVDGMTADYYPFSHDFLGETATRIINEV 478

Query: 500 KGINRVVYDITSKPPATIEWE 520
            GINRV YDITSKPP TIEWE
Sbjct: 479 AGINRVTYDITSKPPGTIEWE 499


>gi|302036775|ref|YP_003797097.1| GMP synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
 gi|190343190|gb|ACE75578.1| GMP synthetase [Candidatus Nitrospira defluvii]
 gi|300604839|emb|CBK41171.1| GMP synthase (glutamine-hydrolyzing) [Candidatus Nitrospira
           defluvii]
          Length = 518

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 273/514 (53%), Positives = 376/514 (73%), Gaps = 4/514 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++L++DFGSQ+TQLIARR+RE++VY +++     L       P+ I+LSG P+S  D  +
Sbjct: 7   RILVLDFGSQYTQLIARRIREAQVYSQILPCTVPLATVLAYRPKGIVLSGGPSSVYDKKA 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P + K++ E  IP+LGICYG Q++    GG+ + +  REFGRA + +     L KG+  +
Sbjct: 67  PSVSKQLFEQGIPILGICYGMQLVTHLQGGEVEKAPHREFGRAELTLDDRSDLFKGIGTR 126

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIA--DEKRKYYAVQFHPEVVHTVGGS 186
           GS   VWMSHGD++E +P GF  IA ++++P A +   D K++ Y +QFHPEV HTV G+
Sbjct: 127 GSTV-VWMSHGDRIERMPPGFRSIAHTENSPIAAMKRHDAKQRIYCLQFHPEVAHTVEGA 185

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NFV+ + G +  W M SY +  V +I++QVG ERVICA+SGGVDS+VAA L + A+
Sbjct: 186 TILKNFVYDICGCKPTWTMRSYVETAVEQIRQQVGTERVICALSGGVDSSVAAALTHRAV 245

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTCV VD+G +R  E + +   F    +  +R++D + +F+  LKN+ DPE KRK+I
Sbjct: 246 GDQLTCVFVDNGVLRTGERDQVEKTFASQMHLNMRILDRTSQFLTGLKNVTDPERKRKII 305

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G+LFI+ FE E+KK+ G ++L QGTLYPDVIES+SF  GPS+ IK+HHNVGGLP  M +K
Sbjct: 306 GRLFIKNFEVESKKLKGIKYLVQGTLYPDVIESVSF-KGPSATIKTHHNVGGLPTRMKLK 364

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR+LG+EL LPD  + R P PGPGLAIR +G +T+ER+ ILR ++ I 
Sbjct: 365 LVEPLRELFKDEVRVLGQELGLPDEIIWRQPFPGPGLAIRVLGAVTKERLAILRGAETIV 424

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +EI  AG+YR+IWQAF VLLP++TVGVMGD+RTYEYV ++RAVTS+DGMTAD+      
Sbjct: 425 DQEIRAAGLYREIWQAFAVLLPIRTVGVMGDQRTYEYVIAIRAVTSLDGMTADWAKIPNE 484

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 485 VLGKMSSRIINEVKGVNRVVYDISSKPPSTIEWE 518


>gi|291286025|ref|YP_003502841.1| GMP synthase, large subunit [Denitrovibrio acetiphilus DSM 12809]
 gi|290883185|gb|ADD66885.1| GMP synthase, large subunit [Denitrovibrio acetiphilus DSM 12809]
          Length = 515

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/514 (54%), Positives = 366/514 (71%), Gaps = 3/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S KVLI+DFGSQ+TQLIARRVRE+ VYCE+       +  KE   + IILSG PAS  D 
Sbjct: 5   SQKVLILDFGSQYTQLIARRVREANVYCEIFPCNVEFEKIKEYGAKGIILSGGPASVYDK 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P++  E+ E  +P+LGICYG Q+     GG    +  RE+GRA +   K+      + 
Sbjct: 65  DAPKVSDEVYELGVPVLGICYGHQLTGMYFGGVVAEADHREYGRAELYADKSDDFFADI- 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            +     VWMSHGD+++ +PEGF+ IA +D+ P A +  E R  Y +QFHPEV HT  G 
Sbjct: 124 -EDDSFVVWMSHGDRLDKMPEGFKTIAKTDNAPVAAMRHETRPIYTIQFHPEVAHTKNGR 182

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           Q+++NFV  + G +  W   ++ +  + RIKE VG++RV+C +SGGVDS+VAA LI+ AI
Sbjct: 183 QILENFVVKICGCEQVWTPRNFVEAEIERIKELVGDKRVLCGLSGGVDSSVAAVLIHRAI 242

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NLTCV VD+G +RK+E + +   F+      L  V+A +RF+  LK + DPE KRK I
Sbjct: 243 GDNLTCVFVDNGLLRKDEGKQVEDAFRNQFKMNLVAVNAEDRFLSVLKGVTDPEKKRKAI 302

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G +F+ +FEEE+ K+G  +FL QGTLYPDVIES+SF  GPS+ IK+HHNVGGLPE M  K
Sbjct: 303 GNMFVRIFEEESSKLGEFEFLAQGTLYPDVIESVSF-KGPSATIKTHHNVGGLPEDMKFK 361

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPL+ELFKDEVR +G EL +P++F+ RHP PGPGL +R +GE+T+ER ++LRE+DAI+
Sbjct: 362 LLEPLRELFKDEVRRVGLELGIPENFIWRHPFPGPGLGVRVLGEVTKERCDVLREADAIF 421

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EE+HKA +Y KIWQAFTVLLPV TVGVMGD RTYE   ++RAV S DGMTAD+ H    
Sbjct: 422 LEELHKADLYTKIWQAFTVLLPVNTVGVMGDNRTYENAVAVRAVESTDGMTADWAHIPYE 481

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV+GINRV YDI+SKPPATIEWE
Sbjct: 482 VLGRISNRIINEVRGINRVAYDISSKPPATIEWE 515


>gi|212703506|ref|ZP_03311634.1| hypothetical protein DESPIG_01551 [Desulfovibrio piger ATCC 29098]
 gi|212673074|gb|EEB33557.1| hypothetical protein DESPIG_01551 [Desulfovibrio piger ATCC 29098]
          Length = 514

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/513 (53%), Positives = 375/513 (73%), Gaps = 2/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           SKV+IID+GSQ TQLIARRVRE+ VY E+ A            P AIILSG PAS  + D
Sbjct: 4   SKVIIIDYGSQVTQLIARRVREAGVYSEIHACNVTAAEVASMAPSAIILSGGPASVGEAD 63

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P + K  LE  +P+LGICYG Q++ Q+LGG+   S +RE+G A + +K +C+L  G+ +
Sbjct: 64  APTLDKGFLELGVPVLGICYGMQLLAQNLGGELAQSLTREYGPADLTLKASCALWDGL-D 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
                +VWMSHGD+V+  P GF +  S+ +   A +ADE RK YAVQFHPEV H+V G  
Sbjct: 123 SSKPSRVWMSHGDKVKTPPPGFVITGSTPTLEVAAMADESRKIYAVQFHPEVHHSVDGDA 182

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  V  I  +W MSS+ + +V  + E++G++ V+CA+SGG+DSTV A L+++AIG
Sbjct: 183 MLRNFLFKVCNIVPDWSMSSFVERVVKEMAEKIGDKHVVCALSGGIDSTVVAVLLHKAIG 242

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ VD+G +R NE E ++S  + + +  L  V A +RF+  LK + DPE KRK+IG
Sbjct: 243 HRLHCIFVDNGLLRLNEGEEVVSYLREHFDLNLNFVQAQDRFLDLLKGVEDPEKKRKIIG 302

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FI++F+EEAKK+   ++L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M +KL
Sbjct: 303 HTFIDIFDEEAKKLPEVEYLAQGTLYPDVIESVSH-KGPSAVIKSHHNVGGLPETMKLKL 361

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPL+ELFKDEVR +  EL +PDS V RHP PGPGLAIR +GEITEER+NILR++D I +
Sbjct: 362 VEPLRELFKDEVRKVAAELGMPDSIVWRHPFPGPGLAIRVLGEITEERLNILRQADKIVQ 421

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EE+ ++G YRK+WQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+     + 
Sbjct: 422 EELRESGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVIALRVVDSVDAMTADWARLPADL 481

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++++ RI+NEVKG+NRVVYD++SKPP+TIEWE
Sbjct: 482 IARMSGRIINEVKGVNRVVYDVSSKPPSTIEWE 514


>gi|108760981|ref|YP_631957.1| GMP synthase [Myxococcus xanthus DK 1622]
 gi|108464861|gb|ABF90046.1| GMP synthase [Myxococcus xanthus DK 1622]
          Length = 517

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 363/515 (70%), Gaps = 3/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ+TQLIARRVRE  VYCE+       +  ++  P+ IILSG PAS    
Sbjct: 5   AEKILILDFGSQYTQLIARRVRELGVYCEIHRPDLPAEDIRKYAPRGIILSGGPASVEAP 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           DSP+    + E+ +P+LGICYG Q+  + LGGK   S  REFG A +E+          +
Sbjct: 65  DSPRCDPFVFEAGVPVLGICYGLQLTAKLLGGKIDRSAHREFGNAEVEVLARRGPF-AEF 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G + QVWMSHGD+VE +P GFE I  S ++PFA  A   + ++ VQFHPEVVHT  G 
Sbjct: 124 TPGDRVQVWMSHGDRVEALPPGFEAIGRSGNSPFAATAHATKPWFGVQFHPEVVHTPQGK 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEA 245
            ++  FV +   +  +W M  +  E V  I+ QVG   RVICA+SGGVDS+VAA L++ A
Sbjct: 184 AMLRAFVFNECKVSGSWTMKGFIDEAVGTIRRQVGEHGRVICALSGGVDSSVAALLLHRA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L C+ VD+G +R+NE   + +LF    + PL+ VDA +RF+ KL  + DPE KRK+
Sbjct: 244 IGPRLQCIFVDNGVLRQNERAQVEALFVDRFHVPLKTVDARQRFLDKLAGVTDPEKKRKI 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FI VFEE A+ +  A+FL QGTLYPDVIES+S+  GPS  IKSHHNVGGLPE M +
Sbjct: 304 IGREFIAVFEEAARDVQDAEFLAQGTLYPDVIESVSY-KGPSVTIKSHHNVGGLPETMKL 362

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR LG+EL LPD  V R P PGPGLAIR +GE+TE+R+ ++R +DAI
Sbjct: 363 KLVEPLRELFKDEVRALGRELGLPDEMVSRQPFPGPGLAIRVLGEVTEQRLELVRRADAI 422

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
            +EEI  AG+Y+++WQAF VLLPVQ+VGVMGDERTYE  C LRAVTS+DGMTAD+     
Sbjct: 423 VQEEIRSAGLYKEVWQAFAVLLPVQSVGVMGDERTYESTCVLRAVTSVDGMTADWARLPF 482

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L +++ RI NEV+GINRV YDI+SKPPATIEWE
Sbjct: 483 PVLERISTRITNEVRGINRVAYDISSKPPATIEWE 517


>gi|164687029|ref|ZP_02211057.1| hypothetical protein CLOBAR_00655 [Clostridium bartlettii DSM
           16795]
 gi|164603914|gb|EDQ97379.1| hypothetical protein CLOBAR_00655 [Clostridium bartlettii DSM
           16795]
          Length = 511

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/513 (53%), Positives = 377/513 (73%), Gaps = 9/513 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE+I++K  ++  K +NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEIISYKTDIEEIKAKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQS--REFGRAFIEIKKNCSLLKGMWE 127
           Q+ KEI ++ IP+LGICYG Q MC +LGG  +   +  +E+G+  I  K++  L +GM  
Sbjct: 66  QMAKEIYDAGIPILGICYGIQTMCHTLGGTVRKGTAAEKEYGKTAITYKES-RLFEGM-- 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +   VWMSH D+++ +PEGFE+IA +   P A I + ++  Y VQFHPEV H+  G  
Sbjct: 123 --TTNSVWMSHTDRIDTVPEGFEIIAYTADCPVAGIQNVEKNLYGVQFHPEVEHSQEGYM 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           +I NF++++ G++ +W   S+ K+ V+ +K  +G+++V+CA+SGGVDS+VAA L+++AIG
Sbjct: 181 IIKNFLYNICGVKGDWTTDSFIKDKVAELKATIGDKKVLCALSGGVDSSVAAVLVHKAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTCV VDHG +RKNE +++  +F+   +  L  V+A +RF+ KLK + +PE KRK+IG
Sbjct: 241 DNLTCVFVDHGLLRKNEGDDVERIFRNTFDMNLIRVNAEDRFLGKLKGVTEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
           + FI VFEEE+ K+G   FL QGT+YPD++ES    GG S+ IKSHHNVGGLPE +D ++
Sbjct: 301 EEFIRVFEEESNKLGKMDFLVQGTIYPDIVES--GLGGESATIKSHHNVGGLPEDVDFQI 358

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPLKELFKDEVR +G EL + D  + RHP PGPGL IR IGE+T+E+ +ILRE+DAIY 
Sbjct: 359 VEPLKELFKDEVRKIGLELGIEDKLIFRHPFPGPGLGIRVIGEVTKEKCDILREADAIYM 418

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           +E+ KAG+YR+IWQAF  L  V+TVGVMGDERTY Y+  LRAV+S DGMT+D+Y    + 
Sbjct: 419 DELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVSSSDGMTSDWYKIPYDV 478

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L ++A RIVNEV G NRVVYDITSKPP TIEWE
Sbjct: 479 LEKIANRIVNEVDGANRVVYDITSKPPGTIEWE 511


>gi|78044956|ref|YP_359914.1| GMP synthase [Carboxydothermus hydrogenoformans Z-2901]
 gi|91206799|sp|Q3AD70|GUAA_CARHZ RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|77997071|gb|ABB15970.1| GMP synthase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 509

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/514 (54%), Positives = 366/514 (71%), Gaps = 6/514 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +SKV+++DFG Q++QLIARR+RE KVYCE++ +   L+   ++NP  I+ SG P+S    
Sbjct: 2   ASKVIVLDFGGQYSQLIARRIRELKVYCEMLPYNTPLEKIVQENPGGIVFSGGPSSVYGE 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            +P +  EI   NIP+LGICYG Q+M   LGG  + ++ RE+G+  + I     L  G+ 
Sbjct: 62  GAPTVDPEIYRLNIPILGICYGMQLMAHQLGGIVRPAEGREYGKTPLFILNRDRLFAGLN 121

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           E    +  WMSHGD V   PEGF V A ++ TP A + + +R  YAVQFHPEVVHT  G 
Sbjct: 122 ET---EICWMSHGDFVAKAPEGFLVTAKTEYTPIAAMENRERNLYAVQFHPEVVHTPKGK 178

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           +++ NF++ + G+  +W M S+ ++ +  IKEQVG E+V+CA+SGGVDS+VAA L+++AI
Sbjct: 179 EILKNFLYEICGLTPDWTMESFAQKAIREIKEQVGEEKVVCALSGGVDSSVAAVLVHKAI 238

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NLTC+ VDHG +RK E E ++  FK      L  VDA E+F+ KLK + DPE KRK+I
Sbjct: 239 GDNLTCIFVDHGLLRKGEAEEVVRTFKEQFQMNLVFVDAKEQFLAKLKGVRDPEQKRKII 298

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI VFEEEA K+G  +FL QGTLYPDV+ES +     ++ IKSHHNVGGLPE M  +
Sbjct: 299 GHEFIRVFEEEAAKLGDIRFLVQGTLYPDVVESGT---ATAATIKSHHNVGGLPEDMKFQ 355

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPLK LFKDEVR LG EL LP+S V RHP PGPGLA+R +GEITEE++ ILRE+D I+
Sbjct: 356 LIEPLKWLFKDEVRELGLELGLPESIVWRHPFPGPGLAVRVLGEITEEKLAILREADYIF 415

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ K+G YRK WQAF VL  +Q+VGVMGDERTY Y  +LRAVTS DGMTAD+      
Sbjct: 416 IDELKKSGWYRKTWQAFAVLPNLQSVGVMGDERTYAYTIALRAVTSEDGMTADWVRLPYE 475

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RIV EVKG+NRVVYDITSKPPATIEWE
Sbjct: 476 LLEKISARIVGEVKGVNRVVYDITSKPPATIEWE 509


>gi|313672100|ref|YP_004050211.1| gmp synthase (glutamine-hydrolyzing) [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312938856|gb|ADR18048.1| GMP synthase (glutamine-hydrolyzing) [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 516

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 282/514 (54%), Positives = 370/514 (71%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ+TQLIARRVRE +VYCE+       +  +  +P+ IILSG P+S  D 
Sbjct: 5   SEKILILDFGSQYTQLIARRVREQRVYCEIFPCNAPFEKIQAFSPKGIILSGGPSSVYDK 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P   K + E N+P+LGICYG Q++CQ  GG    +Q RE+GR+ I +K N      + 
Sbjct: 65  DAPLCDKRVFELNLPILGICYGMQLICQFFGGVVSPAQQREYGRSEIMLK-NDIFFDNLK 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G+K  VWMSHGD++E IPE FE+I  +D+ P A +  + +  YA+QFHPEV HT  G 
Sbjct: 124 LSGNKLTVWMSHGDRLEKIPEQFEIIGWTDNAPIAAMKHKDKPIYAIQFHPEVAHTDQGD 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NFV  + G +  W   ++    + RI+  VG ++V+CA+SGGVDS+VAA L++EAI
Sbjct: 184 TILKNFVVDICGCKQIWTAGNFIHTEIERIRSLVGEKKVLCALSGGVDSSVAAVLVHEAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L CV V++G +R  E E ++  F+      L  VDA +RF+  L++I +PE KRK I
Sbjct: 244 GDQLICVFVNNGLLRYREAEQVLKTFRDNFKINLIYVDAEDRFLEALRDIEEPEKKRKTI 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFI +FEEEAKK+G  +FL QGTLYPDVIES+SF  GPS+ IK+HHNVGGLPE M  K
Sbjct: 304 GNLFIRIFEEEAKKLGDFEFLVQGTLYPDVIESVSF-KGPSATIKTHHNVGGLPEDMKFK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPL+ELFKDEVR +G EL L +  + RHP PGPGLAIR +G + +E++++LR +D IY
Sbjct: 363 LIEPLRELFKDEVRKVGLELGLSEDILFRHPFPGPGLAIRVLGSVDKEKLDLLRLADHIY 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EEI KAG+YR+IWQAF+VLLPV++VGVMGDERTYE V +LRAVTS+DGMTAD+      
Sbjct: 423 IEEIKKAGLYREIWQAFSVLLPVRSVGVMGDERTYENVLALRAVTSVDGMTADWAKIPYE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +V+ RI+NEVKGINRVVYDI+SKPPATIEWE
Sbjct: 483 ILGKVSNRIINEVKGINRVVYDISSKPPATIEWE 516


>gi|225848894|ref|YP_002729058.1| GMP synthase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643531|gb|ACN98581.1| GMP synthase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 511

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 275/511 (53%), Positives = 373/511 (72%), Gaps = 4/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+TQLIARR+RE  +Y E++ +   ++   + NP+ II SG PAS  + D+P
Sbjct: 5   IVILDFGSQYTQLIARRIRELHIYSEILPYNTPVEEILKHNPKGIIFSGGPASVYEKDAP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +  + + +  +P+LGICYG Q++    GG+   +   E+GRA I++  +  L    +E  
Sbjct: 65  KPDERVYDLGLPILGICYGLQLITHHFGGEVVKADKHEYGRAEIQVLNHEDLF---YEIP 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               VWMSH D+V  +P+GFEV+A S + P+A + ++++K + VQFHPEV HT+ G +++
Sbjct: 122 EFTHVWMSHADKVVKLPQGFEVLARSFNAPYAAVRNKEKKIWGVQFHPEVSHTLLGKEIL 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF   + G + +W M ++  E + +I++ VGN++ ICA+SGGVDS+VAA L++ AIG N
Sbjct: 182 KNFAVRICGCKQDWTMGNFLMEEIVKIRQTVGNKKAICALSGGVDSSVAAVLVHNAIGDN 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VD+G +RK E E +   F+   + PL VVDA ERF+  LK I DPE KRK+IG L
Sbjct: 242 LTCIFVDNGLLRKGEREQVEKTFRDNFHIPLIVVDARERFLNALKGITDPEQKRKIIGNL 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKK+   +FL QGTLYPDVIES+S   GPS++IK+HHNVGGLPE M++KL+E
Sbjct: 302 FIEVFEEEAKKLKDVEFLVQGTLYPDVIESVSV-KGPSAVIKTHHNVGGLPERMNLKLIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LGKEL LPD  + R P PGPGLAIR IGE+T+E ++ILRE+DAI  EE
Sbjct: 361 PLRELFKDEVRELGKELGLPDEIIYRQPFPGPGLAIRVIGEVTQESLDILREADAIVLEE 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y+ +WQ+F VLLP+ TVGVMGD RTYE V ++RAV S DGMTAD+     + L 
Sbjct: 421 IKKAGLYKDLWQSFAVLLPIHTVGVMGDYRTYEKVIAVRAVESSDGMTADWARLPYDLLD 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +  RI+NEVKG+NRVVYDI+SKPPATIEWE
Sbjct: 481 TIMRRIINEVKGVNRVVYDISSKPPATIEWE 511


>gi|225849593|ref|YP_002729827.1| GMP synthase [Persephonella marina EX-H1]
 gi|225645120|gb|ACO03306.1| GMP synthase [Persephonella marina EX-H1]
          Length = 512

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 278/511 (54%), Positives = 369/511 (72%), Gaps = 4/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+TQLIARR+RE  ++ E++ F  +++     NP+ II SG PAS    D+P
Sbjct: 6   IIILDFGSQYTQLIARRIRELHIFSEILPFNASVEEIMSHNPKGIIFSGGPASVYHPDAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +  + + +  +P+LGICYG Q++    GG+   ++  E+GRA +EI  +  L K +    
Sbjct: 66  KPDERVFDLGLPILGICYGLQLITHHFGGEVVKAERHEYGRAELEILDHSDLFKDI---P 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++  VWMSHGD+V  +PEGFE IA + + PFA I + ++K + VQFHPEV HT  G  ++
Sbjct: 123 NEIHVWMSHGDRVTKLPEGFEPIARTYNAPFAAIRNREKKIWGVQFHPEVAHTYLGKDIL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF   + G   +W M S+  E    I++ VG+++ ICA+SGGVDS+VAA L++ AIG N
Sbjct: 183 KNFAVQICGCSQDWTMGSFLMEKEVEIRKMVGDKKAICALSGGVDSSVAAVLVHNAIGDN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VD+G +RK E E +   F+ + + PL VVDA ERF+  LK + DPE KRK+IG L
Sbjct: 243 LTCIFVDNGLLRKGEREKVEKTFRDHFHIPLIVVDARERFLEALKGVTDPEQKRKIIGNL 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIE+FEEEAKKI   +FL QGTLYPDVIES+S   GPS++IK+HHNVGGLPE M++KL+E
Sbjct: 303 FIEIFEEEAKKIPDVEFLVQGTLYPDVIESVSV-KGPSAVIKTHHNVGGLPEKMNLKLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LGKEL LPD  + R P PGPGLAIR IGE+ +E + ILRE+DAI  EE
Sbjct: 362 PLRELFKDEVRELGKELGLPDEIIYRQPFPGPGLAIRIIGEVNKEDLEILREADAIVVEE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           + KAG+YR++WQ+F VLLPV TVGVMGD RTYE V ++RAV S DGMTAD+     + L 
Sbjct: 422 VKKAGLYRQLWQSFAVLLPVLTVGVMGDYRTYEKVIAVRAVESTDGMTADWARLPYDLLD 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++  RI+NEVKG+NRVVYDITSKPP TIEWE
Sbjct: 482 RIMRRIINEVKGVNRVVYDITSKPPGTIEWE 512


>gi|46579456|ref|YP_010264.1| GMP synthase [Desulfovibrio vulgaris str. Hildenborough]
 gi|120602993|ref|YP_967393.1| GMP synthase [Desulfovibrio vulgaris DP4]
 gi|50400347|sp|Q72D86|GUAA_DESVH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738438|sp|A1VEV0|GUAA_DESVV RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|46448870|gb|AAS95523.1| GMP synthase [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563222|gb|ABM28966.1| GMP synthase (glutamine-hydrolyzing) [Desulfovibrio vulgaris DP4]
 gi|311233272|gb|ADP86126.1| GMP synthase, large subunit [Desulfovibrio vulgaris RCH1]
          Length = 515

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/516 (53%), Positives = 375/516 (72%), Gaps = 2/516 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           +  +KV+IID+GSQ TQLIARRVRE+ VY E+       +  +   P AIILSG PAS  
Sbjct: 2   DAQTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTAEQVRAMKPAAIILSGGPASVG 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           + D+P + K +L+  +P+LGICYG Q++ Q LGG+   S++RE+G A + +   C L  G
Sbjct: 62  EKDAPALEKGLLDLGVPVLGICYGMQLLGQDLGGELATSETREYGPADLTLTAPCPLWDG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           + + G+  +VWMSHGD+V+  P GF+V+  + +   A +ADE R+ YAVQFHPEV H+  
Sbjct: 122 L-DLGTTSRVWMSHGDKVKTPPPGFKVVGRTATLEVAAMADEARRIYAVQFHPEVHHSED 180

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G+++I+NF+ HVA ++ +W MSS+ +  V  + E VG+  V+CA+SGG+DSTV A L+++
Sbjct: 181 GARIINNFLFHVAKLKADWTMSSFVERAVKEMAEVVGDRHVVCALSGGIDSTVVAVLLHK 240

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  L C+ VD+G +R NE + ++   + + +  L+ V A ERF+ KL  + DPE KRK
Sbjct: 241 AIGKQLHCIFVDNGVLRLNEGQEVVDYLREHFDLNLKYVQAQERFLSKLHGVDDPEQKRK 300

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FIEVF+EEAK +G   FL QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M+
Sbjct: 301 IIGYTFIEVFDEEAKALGHVDFLAQGTLYPDVIESVSH-KGPSAVIKSHHNVGGLPEKMN 359

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KL+EPL+ELFKDEVR +  EL LPD  + RHP PGPGLAIR IGEITEER++ILR +D 
Sbjct: 360 LKLIEPLRELFKDEVRKVAAELGLPDFIIWRHPFPGPGLAIRVIGEITEERLDILRRADK 419

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           + ++E+  +G YRK+WQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+    
Sbjct: 420 VVQQELMSSGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVIALRIVDSVDAMTADWARLP 479

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              L +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 480 SELLERISSRIINEVKGVNRVVYDISSKPPSTIEWE 515


>gi|268316244|ref|YP_003289963.1| GMP synthase, large subunit [Rhodothermus marinus DSM 4252]
 gi|262333778|gb|ACY47575.1| GMP synthase, large subunit [Rhodothermus marinus DSM 4252]
          Length = 522

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/523 (52%), Positives = 377/523 (72%), Gaps = 15/523 (2%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K++I+D+GSQ+TQLIARRVRE+ VY E+       D      P+ +ILSG P S  D  +
Sbjct: 4   KIVILDYGSQYTQLIARRVREAGVYSEIHPCTLTPDEVAALRPKGLILSGGPCSVYDPGA 63

Query: 69  PQIPKEILE------SNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLL 122
           PQ+P+E+LE      S +P+LGICYG Q M Q+LGG  + +  REFGRA ++I  +  L 
Sbjct: 64  PQLPREMLELRREDGSPLPVLGICYGLQAMAQTLGGAVERADRREFGRAHLQIDDDSDLF 123

Query: 123 KGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHT 182
            G+    S   VWMSHGD +  +PEGFEVIA +++ P A +    R  Y VQFHPEVVHT
Sbjct: 124 AGV---PSGTTVWMSHGDHLTRLPEGFEVIAHTENAPIAAVRAVDRPLYGVQFHPEVVHT 180

Query: 183 VGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLI 242
             G Q++ NF   + G + +W  +S+ +E ++ ++E+VG+E VI  +SGGVDS+VAA L+
Sbjct: 181 DYGRQILQNFALRICGCRGDWTPASFIEEKIAEVRERVGDEHVILGLSGGVDSSVAAVLL 240

Query: 243 YEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK 302
           + A+G  LTC+ VD+G +RK E   +++ F+ + +  L+ VDA   F+ +L+ +VDPE K
Sbjct: 241 HRALGDRLTCIFVDNGLLRKGEAAQVVATFRDHFHIRLKAVDAGALFLSRLEGVVDPEQK 300

Query: 303 RKVIGQLFIEVFEEEAKKIGG-----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVG 357
           RK+IG  FIEVFE+  +++        +FL QGTLYPDVIES+SF G PS+ IK+HHNVG
Sbjct: 301 RKIIGATFIEVFEQATEELTRELGRRPRFLAQGTLYPDVIESVSFRG-PSATIKTHHNVG 359

Query: 358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN 417
           GLPE ++ +++EP +ELFKDEVR +G+ L++P+  + RHP PGPGLA+R IG +T+ER++
Sbjct: 360 GLPEKLNFEIIEPFRELFKDEVRAIGRLLQVPEVILHRHPFPGPGLAVRVIGPVTKERLD 419

Query: 418 ILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMT 477
           +LRE+DAI+ EE+ + G+Y ++WQAF VLLPVQTVGVMGDERTYEYVC+LRAVTS+DGMT
Sbjct: 420 LLREADAIFIEELQRHGLYDQVWQAFAVLLPVQTVGVMGDERTYEYVCALRAVTSVDGMT 479

Query: 478 ADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           AD+      FL+ V+ RIVNEV+GINR VYDI+SKPPATIEWE
Sbjct: 480 ADWARLPHEFLAHVSNRIVNEVRGINRAVYDISSKPPATIEWE 522


>gi|220905069|ref|YP_002480381.1| GMP synthase [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219869368|gb|ACL49703.1| GMP synthase, large subunit [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 511

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 370/513 (72%), Gaps = 4/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           SKV+IID+GSQ TQLIARRVRE+ VY E+ +            PQAIILSG PAS  + D
Sbjct: 3   SKVIIIDYGSQVTQLIARRVREAGVYSEIHSCVTTAQQVAAMKPQAIILSGGPASVGEAD 62

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P +    LE  +P+LGICYG Q++ + +GG+   S +RE+G A +     C+L +G+  
Sbjct: 63  APALDPGFLELGVPVLGICYGMQLLAREMGGQLAQSLTREYGPADLNFTAPCALWEGI-- 120

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +  +VWMSHGD+V   P GF V  S+ +   A +ADE RK YAVQFHPEV H+V G +
Sbjct: 121 -TAPTRVWMSHGDKVMAPPPGFTVTGSTSTLEVAAMADETRKIYAVQFHPEVHHSVDGER 179

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  V GI+ +W MSS+ + +V  + EQVG++ V+CA+SGG+DSTV A L++ AIG
Sbjct: 180 MLHNFLFKVTGIKPDWTMSSFVERVVKEMAEQVGDKHVVCALSGGIDSTVVAVLLHRAIG 239

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ VD+G +R  E + ++S  + + +  L  V A ERF+ KLK + DPE KRK+IG
Sbjct: 240 KRLHCIFVDNGLLRLGEGDEVVSYLREHFDLNLNFVQAQERFLSKLKGVEDPEKKRKIIG 299

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FIE+F+EEA K+    FL QGTLYPDVIESIS   GPS++IKSHHNVGGLP+ M +KL
Sbjct: 300 HTFIEIFDEEANKLDQVDFLAQGTLYPDVIESISH-KGPSAVIKSHHNVGGLPDTMKLKL 358

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR +  EL +PDS V RHP PGPGLAIR +GE++EER+NILR++D I +
Sbjct: 359 IEPLRELFKDEVRKVAAELGMPDSIVWRHPFPGPGLAIRVLGEVSEERLNILRQADRIVQ 418

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           +E+ ++G YRK+WQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+     + 
Sbjct: 419 QELRESGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVVALRVVDSVDAMTADWARLPADL 478

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + +++ RI+NEVKG+NRVVYD++SKPP+TIEWE
Sbjct: 479 IERMSGRIINEVKGVNRVVYDVSSKPPSTIEWE 511


>gi|85860898|ref|YP_463100.1| GMP synthase [Syntrophus aciditrophicus SB]
 gi|85723989|gb|ABC78932.1| GMP synthase (glutamine-hydrolyzing) [Syntrophus aciditrophicus SB]
          Length = 510

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/512 (53%), Positives = 375/512 (73%), Gaps = 4/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LIIDFGSQ+ QLIARRVRE +VYC++   + AL+  K   P+ IILSG PAS  +  SP
Sbjct: 2   ILIIDFGSQYNQLIARRVRELEVYCQIEPPEIALETIKALQPEGIILSGGPASIYEPKSP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSLLKGMWEK 128
           ++ K I + NIP+LGICYG Q M  SLGGK   S  RE+G A + I ++   +  G+ E 
Sbjct: 62  KVDKGIFDLNIPILGICYGLQYMVDSLGGKVIRSAKREYGFAQLHIVREGKGIFAGVTEN 121

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
               + WMSHGD ++ +P GF + AS+ +TP A + D  R+ Y +QFHPEVVHT  G ++
Sbjct: 122 ---TRCWMSHGDTIDQLPAGFAITASTANTPAAAMEDPVRRLYGLQFHPEVVHTPEGKKM 178

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           ++NF+  V G + +W M+S+ ++ V  I+  VG+ +V+  +SGGVDS+VAA L+++AIG 
Sbjct: 179 LENFLFSVCGCRKSWTMASFIRDSVEEIRSTVGDRKVVLGLSGGVDSSVAALLLHQAIGN 238

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VD+G +R+ E E + SLFK + +  +R   A  +F+  LK IVDPE KRK+IG+
Sbjct: 239 QLTCVFVDNGLLRQGEAEKVRSLFKQHFHMNVRFARAKAQFLDALKGIVDPERKRKIIGR 298

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           +F+EVF++EA+KI    +L QGTLYPDVIES S FGGPS++IKSHHNVGGLP  M +KL+
Sbjct: 299 VFVEVFDQEARKIRDVDYLAQGTLYPDVIESRSAFGGPSAVIKSHHNVGGLPRRMKLKLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPLK LFKDEVRLLG+EL L D  + RHP PGPGL IR IGE+T++R+++LR++DAI  E
Sbjct: 359 EPLKHLFKDEVRLLGRELGLSDDMIWRHPFPGPGLGIRIIGEVTDKRLSLLRKADAILLE 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  A  Y ++WQ+F VLLP+++VG+MGD+RTYE++ ++RAVTS D MTAD+     + L
Sbjct: 419 EIKAADYYGRLWQSFVVLLPLKSVGIMGDQRTYEHIAAIRAVTSDDAMTADWARLPHDLL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++A RI+NEV+GINRVVYDI+SKPP+TIEWE
Sbjct: 479 GKIANRIINEVRGINRVVYDISSKPPSTIEWE 510


>gi|256830263|ref|YP_003158991.1| GMP synthase, large subunit [Desulfomicrobium baculatum DSM 4028]
 gi|256579439|gb|ACU90575.1| GMP synthase, large subunit [Desulfomicrobium baculatum DSM 4028]
          Length = 515

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/512 (54%), Positives = 365/512 (71%), Gaps = 2/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           KV+I+DFGSQ+TQLIARR RES VY E+       +  K   P AIILSG PAS    DS
Sbjct: 6   KVIILDFGSQYTQLIARRTRESGVYSEIHPCTITPEELKALQPSAIILSGGPASVSSPDS 65

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P I   I E  +P+LGICYG Q+M   LGGK   S  RE+GR+ +  + +C L + + + 
Sbjct: 66  PGIDPSIFEWGLPILGICYGMQLMAHVLGGKVAPSLDREYGRSDLHFEGHCPLWETLSDA 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G K  VWMSHGD V  +P GF V+A + +   A +AD  RK YA+QFHPEV HT  G ++
Sbjct: 126 G-KLTVWMSHGDHVLAVPPGFSVMAKTQNIEIAAMADVGRKMYALQFHPEVAHTEQGDEI 184

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+ HV G++  W MSS+   ++  + EQ+G+++V+C +SGG+DSTV A L+ +AIG 
Sbjct: 185 LRNFLFHVVGLKSVWTMSSFVDSMLQALPEQIGDDKVVCGLSGGIDSTVVAVLLNKAIGK 244

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
           NL C+ VD+G +R  E + +I   + + +  L  + A ++F+ +L+ + DPE KRK+IG 
Sbjct: 245 NLHCIFVDNGLLRAGEGDEVIGYLRQHFDLNLHYIKAQDKFLSRLEGLEDPEQKRKIIGY 304

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVFEEEAKKI G ++L QGTLYPDVIESISF  GPS++IKSHHNVGGLPE MD+ LV
Sbjct: 305 TFIEVFEEEAKKIPGVKYLAQGTLYPDVIESISF-KGPSAVIKSHHNVGGLPEKMDLALV 363

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR + +EL LPD  V RHP PGPGLAIR IGEIT+ER+ ILR++D I + 
Sbjct: 364 EPLRELFKDEVRKVAQELGLPDFIVWRHPFPGPGLAIRVIGEITDERLEILRQADKIVQH 423

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+  +  Y K+WQ F VLLP++TVGVMGDERTYE+V +LR V SID MTAD+       L
Sbjct: 424 ELMASNWYYKVWQGFAVLLPLKTVGVMGDERTYEHVIALRIVDSIDAMTADWSRIPTEIL 483

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 484 GRMSSRIINEVKGVNRVVYDISSKPPSTIEWE 515


>gi|218888208|ref|YP_002437529.1| GMP synthase [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226738437|sp|B8DNB9|GUAA_DESVM RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|218759162|gb|ACL10061.1| GMP synthase, large subunit [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 515

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/516 (53%), Positives = 374/516 (72%), Gaps = 2/516 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E  +KV+IID+GSQ TQLIARRVRE+ VY E+       D  +   P A+ILSG PAS  
Sbjct: 2   EAQTKVIIIDYGSQVTQLIARRVREAGVYSEIHPCIVTADQVRAMKPAAVILSGGPASVG 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           + D+P + K +LE  +P+L ICYG Q++  +LGG+   S++RE+G A + +  +C L  G
Sbjct: 62  EADAPTLEKGLLELGVPVLAICYGMQLLGHNLGGQLATSETREYGPADLTLLGDCPLWDG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           + +K +  +VWMSHGD+V+  P GF V+  + +   A +AD+ R+ YAVQFHPEV HT  
Sbjct: 122 I-DKSATTRVWMSHGDKVKTPPPGFAVVGRTATLDVAAMADDARRIYAVQFHPEVHHTEE 180

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G+++I+NF+ HVA ++ +W MSS+ +  +  + E VG+  V+CA+SGG+DSTV A L+++
Sbjct: 181 GTRIINNFLFHVAKLKADWTMSSFVERAIKEMAETVGDRHVVCALSGGIDSTVVAVLLHK 240

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  L C+ VD+G +R NE + ++   + + +  L+ V A  RF+ KL+ + DPE KRK
Sbjct: 241 AIGKRLHCIFVDNGVLRLNEGQEVVDYLREHFDLNLKYVQAQRRFLDKLEGVEDPEQKRK 300

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FIEVF+EEAK +G   FL QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M+
Sbjct: 301 IIGYTFIEVFDEEAKALGHVDFLAQGTLYPDVIESVSH-KGPSAVIKSHHNVGGLPEKMN 359

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           +KL+EPL+ELFKDEVR +  EL LPD  + RHP PGPGLAIR IGEITEER++ILR++D 
Sbjct: 360 LKLIEPLRELFKDEVRKVAGELGLPDFIIWRHPFPGPGLAIRVIGEITEERLDILRKADK 419

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I + E+  +G YRK+WQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+    
Sbjct: 420 IVQAELMSSGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVIALRIVDSVDAMTADWARLP 479

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              L +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 480 SELLERISSRIINEVKGVNRVVYDISSKPPSTIEWE 515


>gi|153004390|ref|YP_001378715.1| GMP synthase [Anaeromyxobacter sp. Fw109-5]
 gi|152027963|gb|ABS25731.1| GMP synthase, large subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 518

 Score =  575 bits (1482), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/518 (53%), Positives = 365/518 (70%), Gaps = 8/518 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ+TQLIARR+RE  VYCE+       +  +   P+ ++LSG PAS L  
Sbjct: 5   AEKILILDFGSQYTQLIARRLRELGVYCEIHPCTMTPEAMRAFAPRGVVLSGGPASVLAE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+  + + E  +P+LGICYG Q++   LGG+   +  RE+G A IE +++  L +G+ 
Sbjct: 65  GSPRADRLVFELGVPVLGICYGLQLLAHELGGRVDKAAHREYGPATIETREDAELFEGL- 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
               +  VWMSHGD+VE +P GFE IAS+ S PFA + D +R+++ VQFHPEVVHT  G 
Sbjct: 124 --PRRLDVWMSHGDRVEKLPPGFEPIASTPSAPFAAVEDRRRRFFGVQFHPEVVHTPLGK 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NF + V G   +W M +Y +  V +I+ QV +  VICA+SGGVDS VAA L++ AI
Sbjct: 182 DVLRNFAYRVCGCSGSWSMRAYAEIAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ VD+G +R  E   +  +F G  + PL  VDAS RF+ +L  + DPE KRK+I
Sbjct: 242 GDRLRCIFVDNGVLRAGERAQVEEVFGGMFHLPLVTVDASARFLARLAGVTDPEQKRKII 301

Query: 307 GQLFIEVFEEEAKKIGG----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           G+ FI VFEE+ + +      AQFL QGTLYPDVIES+SF  GPS+ IKSHHNVGGLPE 
Sbjct: 302 GREFIAVFEEQVEDLAAHGERAQFLVQGTLYPDVIESVSF-KGPSATIKSHHNVGGLPEV 360

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           M + LVEPL+ELFKDEVR LG EL LP   V+R P PGPGLAIR +GE+TEER+ +LR++
Sbjct: 361 MKLGLVEPLRELFKDEVRRLGLELGLPQHIVQRQPFPGPGLAIRVLGEVTEERLALLRKA 420

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           D I +EEI  AG+Y K+WQAF VLLPV++VGVMGDERTYE  C++RA+ S DGMT D+  
Sbjct: 421 DTIVQEEIRAAGLYEKLWQAFAVLLPVRSVGVMGDERTYEATCAVRAIESTDGMTGDWAR 480

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
                L +++ RI+NEV+GINRVVYDI+SKPPATIEWE
Sbjct: 481 LPYELLGRMSSRIINEVRGINRVVYDISSKPPATIEWE 518


>gi|218777977|ref|YP_002429295.1| GMP synthase [Desulfatibacillum alkenivorans AK-01]
 gi|218759361|gb|ACL01827.1| GMP synthase, large subunit [Desulfatibacillum alkenivorans AK-01]
          Length = 509

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/511 (54%), Positives = 368/511 (72%), Gaps = 3/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++IIDFGSQ+ QLIARRVRE KV+C++      ++  K   P  IILSG PAS    +SP
Sbjct: 2   IIIIDFGSQYNQLIARRVREHKVFCQIEPPTLTVEKVKSLAPDGIILSGGPASIYSENSP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I  E+L   IP+LGICYG Q M  + GGK + +  RE+G A    K+   L +G+ E  
Sbjct: 62  KIDPELLNLGIPVLGICYGLQFMVHTQGGKVERADKREYGLAMFHPKEAAGLFEGVPEA- 120

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              + WMSHGD ++ +PEGF +  S+D+T  A IA +K+K + +QFHPEV HT  G +++
Sbjct: 121 --TECWMSHGDSIKELPEGFVITGSTDNTKVAAIAHKKKKLFGLQFHPEVTHTPKGKRML 178

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V   + NW M S+ KE V  IKE  G+++VI  +SGGVDS+VAA LI++AIG N
Sbjct: 179 KNFLFNVCDCKRNWTMKSFVKEAVDEIKEAAGDDKVILGLSGGVDSSVAAVLIHKAIGKN 238

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L  + VD+G +RK E + +  +F    N  +R   AS +F+  LK + DPE KRK+IG++
Sbjct: 239 LYPIFVDNGLLRKGEADRLKEVFTQNLNMKVRYAKASRKFLSGLKGVTDPEKKRKIIGKV 298

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           F++VFEEEAKKI GA+FL QGTLYPD+IES+S FGGPS++IKSHHNVGGLP+ M +KL+E
Sbjct: 299 FMDVFEEEAKKIKGAKFLAQGTLYPDIIESVSAFGGPSAVIKSHHNVGGLPKKMKLKLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVRLLG+EL LP   V R P PGPGLAIR IGE+T +R++ILRE DA+  EE
Sbjct: 359 PLKYLFKDEVRLLGEELGLPGDMVWRQPFPGPGLAIRVIGEVTAKRLSILREVDALIIEE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I K   YRK+WQ+F VLLP+++VGVMGD+RTYE + ++RAVTS D MTAD+     + L+
Sbjct: 419 IRKNDYYRKLWQSFGVLLPIKSVGVMGDQRTYENIIAIRAVTSTDAMTADWARLPHDMLA 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++ RI+NE+ G+NRVVYDI+SKPP+TIEWE
Sbjct: 479 VMSNRIINEINGVNRVVYDISSKPPSTIEWE 509


>gi|118443777|ref|YP_878930.1| GMP synthase [Clostridium novyi NT]
 gi|226738427|sp|A0Q2S8|GUAA_CLONN RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|118134233|gb|ABK61277.1| GMP synthase [Clostridium novyi NT]
          Length = 512

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/511 (54%), Positives = 372/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  K++NP+AII +G P S     +P
Sbjct: 8   VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KEI E  +P+LGICYG Q+   +LGGK ++   RE+G+  ++I     L  G+ E  
Sbjct: 68  RVEKEIFELGVPVLGICYGHQLTAYTLGGKVESPDIREYGKTEVKIDNKSPLFDGIKEA- 126

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D V  IPEGF++IA++D  P A +A+E++K Y VQFHPEV HT+ G +++
Sbjct: 127 --DQSWMSHTDYVSEIPEGFKIIATTDQCPVAAMANEEKKIYGVQFHPEVEHTLFGQKML 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  VAG++ +W M+S+ +E +  IKE VG+++V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 185 GNFLFKVAGLKADWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + + ++FK   +  L  V+A ERF+ KLK + DPETKRK+IG+ 
Sbjct: 245 LTCVFVDHGLLRKDEGDQVEAIFKKQFDMNLIRVNAGERFLGKLKGVSDPETKRKIIGEE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M   L+E
Sbjct: 305 FIRVFEEEAGKLGQIDFLVQGTIYPDVVESGT---NTSATIKSHHNVGGLPEDMQFSLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I RE+DAI+REE
Sbjct: 362 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEITREADAIFREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 422 IALAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 482 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 512


>gi|317487335|ref|ZP_07946129.1| GMP synthase domain-containing protein [Bilophila wadsworthia
           3_1_6]
 gi|316921434|gb|EFV42726.1| GMP synthase domain-containing protein [Bilophila wadsworthia
           3_1_6]
          Length = 513

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/513 (53%), Positives = 375/513 (73%), Gaps = 2/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           SKV+IID+GSQ TQLIARRVRE+ VY E+          K   P AIILSG PAS  + D
Sbjct: 3   SKVIIIDYGSQVTQLIARRVREAGVYSEIHPCVVTAAQVKAMQPSAIILSGGPASVGEKD 62

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P + K  L+  +P+LGICYG Q++  +LGG  + S++RE+G A +   ++C+L  G+ +
Sbjct: 63  APALDKGFLDLGVPVLGICYGMQLLAFNLGGGLEQSETREYGPADLRFVRSCALWDGI-D 121

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
                +VWMSHGD V+  P GF V  S+D+   A +ADE RK YAVQFHPEV H+V G  
Sbjct: 122 LTKLSRVWMSHGDTVKTPPAGFLVTGSTDTLEVAAMADEARKIYAVQFHPEVHHSVDGDT 181

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  +A I  +W MSS+ + +++ ++E VG+  V+CA+SGGVDSTV A L+++AIG
Sbjct: 182 MLRNFLFKIAKITPDWTMSSFVERVINEVRETVGDGHVVCALSGGVDSTVVAVLLHKAIG 241

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NL C+ VD+G +R  E + +++  + + +  L++V+A +RF+  L  + DPE KRK+IG
Sbjct: 242 KNLHCIFVDNGVLRSGEGDEVVTYLREHFDLNLKLVNAQDRFLDLLAGVEDPEKKRKIIG 301

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FI+VF+EEA+ IG  ++L QGTLYPDVIES+S   GPS++IKSHHNVGGLPE M+MKL
Sbjct: 302 HTFIDVFDEEARAIGNVEWLAQGTLYPDVIESVSH-KGPSAVIKSHHNVGGLPEKMNMKL 360

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR +G EL +P+S + R P PGPGLAIR IGE+T ER++ILR++D I +
Sbjct: 361 IEPLRELFKDEVRQVGAELGMPESVIWRQPFPGPGLAIRVIGEVTRERLDILRKADTIVQ 420

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           +E+  AG YRKIWQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+     + 
Sbjct: 421 QELRDAGWYRKIWQGFAVLLPLKTVGVMGDGRTYEHVIALRCVDSVDAMTADWARLPYDL 480

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L +++ RI+NEVKG+NRVVYD++SKPP+TIEWE
Sbjct: 481 LERISRRIINEVKGVNRVVYDVSSKPPSTIEWE 513


>gi|319789152|ref|YP_004150785.1| GMP synthase, large subunit [Thermovibrio ammonificans HB-1]
 gi|317113654|gb|ADU96144.1| GMP synthase, large subunit [Thermovibrio ammonificans HB-1]
          Length = 518

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/516 (54%), Positives = 374/516 (72%), Gaps = 9/516 (1%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           SK+LI+DFGSQ+TQLIARR+RE  VYCE+  F   ++  +E  P+ IILSG PAS     
Sbjct: 9   SKILILDFGSQYTQLIARRLREKHVYCEIHPFNTPIEKIREFKPKGIILSGGPASVYAPG 68

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           SP++ KE+ E  +P+LGICYG Q++    GG+   ++  E+GRA +++  +  L KG+ +
Sbjct: 69  SPKVSKEVFELGVPVLGICYGMQLITYLFGGEVVRAERHEYGRAELQVLDHSDLFKGLPD 128

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           + +   VWMSHGD+V  IPEGFE IA +++ P+A I + KR+ Y VQFHPEV HT  G +
Sbjct: 129 RFT---VWMSHGDRVLRIPEGFEPIAKTENAPYAAIRNGKRRIYGVQFHPEVKHTQYGDK 185

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           +++NF   + G +  W M ++ +  + +I+E VG++ VICA+SGGVDS+V A L++ AIG
Sbjct: 186 ILENFAIEICGCEPTWTMENFIEYEIEKIRETVGDKNVICALSGGVDSSVVAALLHRAIG 245

Query: 248 INLTCVLVDHGFMRKNEVENIISLFK---GYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
             L  + VD G +RK E E++   FK      NF  +V+DAS+ F+ +LK + DPE KRK
Sbjct: 246 DQLYPIFVDTGLLRKGERESVERTFKEKFHMKNF--KVIDASDLFLERLKGVTDPEQKRK 303

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FIEVFE+ AK+I  A+FL QGTLYPDVIES+S   GPS+ IKSHHNVGGLPE ++
Sbjct: 304 IIGHTFIEVFEKAAKEIPNAEFLAQGTLYPDVIESVSV-KGPSATIKSHHNVGGLPERLN 362

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            KL+EPL+ELFKDEVR LGKEL LP+  ++R P PGPGLAIR IGE+  E + ILRE+DA
Sbjct: 363 FKLIEPLRELFKDEVRELGKELGLPEEIIKRQPFPGPGLAIRIIGEVKPEYLKILREADA 422

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I  EEI KAG+Y KIWQ+F V LP+QTVGVMGD RTY+YV ++RAV S+DGMTAD+    
Sbjct: 423 IVLEEIKKAGLYDKIWQSFAVFLPIQTVGVMGDVRTYDYVIAVRAVESVDGMTADWVKLP 482

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              L +++ RI+NEV+G+NRVVYDITSKPP TIEWE
Sbjct: 483 YELLERISNRIINEVEGVNRVVYDITSKPPGTIEWE 518


>gi|253681080|ref|ZP_04861883.1| GMP synthase (glutamine-hydrolyzing) [Clostridium botulinum D str.
           1873]
 gi|253562929|gb|EES92375.1| GMP synthase (glutamine-hydrolyzing) [Clostridium botulinum D str.
           1873]
          Length = 512

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 372/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  K++NP+AII +G P S     +P
Sbjct: 8   VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KEI E  +P+LGICYG Q+   +LGGK ++   RE+G+  ++I  N  L  G+ E  
Sbjct: 68  RVEKEIFELGVPVLGICYGHQLTAYTLGGKVESPDIREYGKTEVKIDNNSPLFDGIKET- 126

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D V  IPEGF++IA++D  P A +A+E++K Y VQFHPEV HT+ G +++
Sbjct: 127 --DQSWMSHTDYVSQIPEGFKIIATTDQCPVAAMANEEKKIYGVQFHPEVEHTLFGQKML 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +A ++ +W M+S+ +E +  IKE VG+++V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 185 GNFLFKIADLKADWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + + ++FK   +  L  V+A ERF+ KLK + DPETKRK+IG+ 
Sbjct: 245 LTCVFVDHGLLRKDEGDQVEAIFKKQFDMNLIRVNAEERFLGKLKGVSDPETKRKIIGEE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M   L+E
Sbjct: 305 FIRVFEEEAGKLGQIDFLVQGTIYPDVVESGT---NTSATIKSHHNVGGLPEDMQFSLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I RE+DAI+REE
Sbjct: 362 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEITREADAIFREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 422 IALAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 482 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 512


>gi|332704335|ref|ZP_08424423.1| GMP synthase (glutamine-hydrolyzing) [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554484|gb|EGJ51528.1| GMP synthase (glutamine-hydrolyzing) [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 513

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/512 (52%), Positives = 367/512 (71%), Gaps = 1/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           KV+I+D+GSQ+TQLIARRVRE+ VY E+          K   P A+ILSG PAS L  +S
Sbjct: 3   KVVILDYGSQYTQLIARRVREAGVYSEIHPCTIPAAELKALKPAALILSGGPASVLAPES 62

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P +   IL+  +P+LGICYG Q++   LGGK   ++ RE+GRA +E+   CSL +G+   
Sbjct: 63  PGLDASILDWGLPVLGICYGMQLLAHYLGGKVHAAKDREYGRADLEVVSPCSLFEGLSGT 122

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
             K +VWMSHGD V+  P+GFE++A + S   A +AD  R+ YA+QFHPEV HT  G  +
Sbjct: 123 AGKHKVWMSHGDHVDTPPQGFEILARTGSLKVAAMADASRRLYAIQFHPEVAHTDDGDLV 182

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+  +AG++  W M+S+ +  +  +++ +G++ V+C +SGG+DSTV A L+++AIG 
Sbjct: 183 LRNFLFKIAGLKPGWSMASFVESTIKDLRDTLGDDHVVCGLSGGIDSTVVAVLLHKAIGK 242

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L C+ VD+G +R NE E +I       +  L+ V+A E F+  L+ + DPE KRK+IG 
Sbjct: 243 RLHCIFVDNGLLRINEREEVIDFLTESFDLNLKYVEAQELFLSPLEGVTDPERKRKIIGH 302

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVF+ EA K+ G ++L QGTLYPDVIESIS F GPS++IKSHHNVGGLPE M++KLV
Sbjct: 303 NFIEVFDAEAHKLQGVKWLAQGTLYPDVIESIS-FKGPSAVIKSHHNVGGLPEKMNLKLV 361

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +  EL LPD+ + RHP PGPGLAIR IGEIT ER+ ILR++D I + 
Sbjct: 362 EPLRELFKDEVRKVAYELGLPDNIIWRHPFPGPGLAIRVIGEITRERLEILRQADKIVQH 421

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+  +G YRK+WQ F VLLP++TVGVMGDER+YE V +LR V S+D MTAD+       L
Sbjct: 422 ELQASGWYRKVWQGFAVLLPLKTVGVMGDERSYESVIALRIVDSLDAMTADWTRVPSEIL 481

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++ RI+NEVKG+NRVV DI+SKPP+TIEWE
Sbjct: 482 ARMSNRIINEVKGVNRVVLDISSKPPSTIEWE 513


>gi|296132308|ref|YP_003639555.1| GMP synthase, large subunit [Thermincola sp. JR]
 gi|296030886|gb|ADG81654.1| GMP synthase, large subunit [Thermincola potens JR]
          Length = 513

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 280/517 (54%), Positives = 369/517 (71%), Gaps = 7/517 (1%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E+   V+++DFG Q+TQLIARR+RE  VYCE++ +   +   K  NP+ I+ SG P+S  
Sbjct: 3   EQKEMVIVLDFGGQYTQLIARRIRECHVYCEILPYSTPVARLKAINPKGIVFSGGPSSVY 62

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSLLK 123
             ++P   KEI  + IP+LGICYG Q+M Q LGG    + +RE+G+  +++   +  L K
Sbjct: 63  AENAPVCDKEIFAAGIPILGICYGMQLMAQMLGGNVSRADNREYGKTLLQVLDADSPLFK 122

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G+ E     QVWMSHGD V   P GF+ IA +++TP A + ++++K Y VQFHPEVVHT 
Sbjct: 123 GLPET---LQVWMSHGDFVAAPPPGFKSIARTENTPVAALGNDEKKLYGVQFHPEVVHTP 179

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ F+  V     +W M S+ ++ V  IKE+VG+++V+CA+SGGVDS+VAA L++
Sbjct: 180 QGQRMLEFFLLDVCQCHADWTMESFVEQAVREIKEKVGDKKVLCALSGGVDSSVAAALVH 239

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +A+G  LTCV VDHG +RK+E   +I  F+   +  L  VDAS RF+ KLK + DPE KR
Sbjct: 240 KAVGDQLTCVFVDHGLLRKDEARQVIQTFRDQFHINLVAVDASARFLNKLKGVTDPEQKR 299

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FI VFEEEA+K+G   FL QGTLYPDV+ES +     +++IKSHHNVGGLPE M
Sbjct: 300 KIIGNEFIRVFEEEARKLGEIDFLVQGTLYPDVVESGT---DTAAVIKSHHNVGGLPEDM 356

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
              LVEPL+ LFKDEVR +G++L LP+  V R P PGPGLAIR +GEITEE++NILRE+D
Sbjct: 357 KFDLVEPLRWLFKDEVRQVGEQLGLPERIVWRQPFPGPGLAIRILGEITEEKLNILREAD 416

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI  EEI KAG+YR+IWQ F VL  +++VGVMGDERTY Y C +RAVTS DGMTAD+   
Sbjct: 417 AILHEEIIKAGLYREIWQFFAVLPSMRSVGVMGDERTYSYTCVIRAVTSHDGMTADWARI 476

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  V+ RIVNEVK INRVVYDITSKPPATIEWE
Sbjct: 477 PYDVLESVSSRIVNEVKDINRVVYDITSKPPATIEWE 513


>gi|323700722|ref|ZP_08112634.1| GMP synthase, large subunit [Desulfovibrio sp. ND132]
 gi|323460654|gb|EGB16519.1| GMP synthase, large subunit [Desulfovibrio desulfuricans ND132]
          Length = 514

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 279/513 (54%), Positives = 366/513 (71%), Gaps = 2/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           ++VLI+DFGSQFTQLIARRVRE+ VY E+       +  K   P A+ILSG P+S L+  
Sbjct: 4   NRVLILDFGSQFTQLIARRVREAGVYSEIHPCNVDPERVKAFKPSALILSGGPSSVLEGG 63

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
            P +  E L+  IP+LGICYG Q++  +LGG+   S  RE+GRA    + +C L  G+ +
Sbjct: 64  CPALNMEYLDMGIPVLGICYGMQLLAHNLGGRVVASTDREYGRAQFTAQNDCILFDGVKD 123

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           K     VWMSHGD+VE +PEGF  +  +DS  FA + D KRK+YA+QFHPEV HT  GS 
Sbjct: 124 K-DDLTVWMSHGDRVEALPEGFVPMGKTDSIEFAAMGDPKRKFYALQFHPEVAHTTDGSL 182

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           +I NF+  VAG++ +W MSS+    +  +KEQVG+ +V+  +SGG+DSTVAA ++++AIG
Sbjct: 183 IIQNFLFKVAGLEASWSMSSFVDTTIESLKEQVGDAKVVLGLSGGIDSTVAAVMLHKAIG 242

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NL C+ VD+G +R  E E +I     + +  +++VDAS  F+  LK + DPE KRK+IG
Sbjct: 243 KNLHCIFVDNGLLRMGEREEVIGFLAEHFDLNVKMVDASSEFLDNLKGVEDPEKKRKIIG 302

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FIEVF+ EAK I G +FLGQGTLYPDVIES S F GPS++IKSHHNVGGLPE M++KL
Sbjct: 303 HKFIEVFDREAKAIKGVEFLGQGTLYPDVIESES-FKGPSAVIKSHHNVGGLPETMNLKL 361

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPL+ELFKDEVR    EL LP+  + R P PGPGL+IR IGE+TEER+ ILR +D I +
Sbjct: 362 VEPLRELFKDEVRRAAYELGLPEHIIWRQPFPGPGLSIRVIGEVTEERLQILRLADKIVQ 421

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
            E+  A  YRK+WQ F VLLP++TVGVMGD+RTYE V +LR V S+D MTAD+       
Sbjct: 422 NEMMAADWYRKVWQGFAVLLPLKTVGVMGDDRTYENVIALRIVDSLDAMTADWSRLPSEL 481

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L++++ RI+ EVKG+NRVV DI+SKPP+TIEWE
Sbjct: 482 LARMSNRIIREVKGVNRVVLDISSKPPSTIEWE 514


>gi|168186048|ref|ZP_02620683.1| GMP synthase [Clostridium botulinum C str. Eklund]
 gi|169296037|gb|EDS78170.1| GMP synthase [Clostridium botulinum C str. Eklund]
          Length = 512

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/511 (53%), Positives = 371/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  K++NP+AII +G P S     +P
Sbjct: 8   VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSVEDIKKKNPKAIIFTGGPNSVYGEGTP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KEI E  +P+LGICYG Q+   +LGGK ++   RE+G+  ++I  N  L  G+ E  
Sbjct: 68  RVEKEIFELGVPVLGICYGHQLTAYTLGGKVESPDIREYGKTEVKIDNNSPLFDGIKEA- 126

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D V  IPEGF++IA++D  P A +A+E++K Y VQFHPEV HT+ G +++
Sbjct: 127 --DQSWMSHTDYVSEIPEGFKIIATTDQCPVAAMANEEKKIYGVQFHPEVEHTLFGQKML 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +A ++ +W M+S+ +E +  IKE VG+++V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 185 GNFLFKIADLKADWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + + ++FK   +  L  V+A ERF+ KLK + DPE KRK+IG+ 
Sbjct: 245 LTCVFVDHGLLRKDEGDQVETIFKKQFDMNLIRVNAGERFLGKLKGVSDPEKKRKIIGEE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M   L+E
Sbjct: 305 FIRVFEEEANKLGQIDFLVQGTIYPDVVESGT---NTSATIKSHHNVGGLPEDMQFSLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEIT+E++ I RE+DAI+REE
Sbjct: 362 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITDEKLEITREADAIFREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 422 IALAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 482 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 512


>gi|303327985|ref|ZP_07358424.1| GMP synthase [Desulfovibrio sp. 3_1_syn3]
 gi|302861811|gb|EFL84746.1| GMP synthase [Desulfovibrio sp. 3_1_syn3]
          Length = 514

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 369/513 (71%), Gaps = 2/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           SKV+IID+GSQ TQLIARRVRE+ VY E+ +         E +P A+ILSG PAS  + D
Sbjct: 4   SKVIIIDYGSQVTQLIARRVREAGVYSEIHSCVTTAAQVAEMHPSALILSGGPASVGEAD 63

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P +    LE  +P+LGICYG Q++ Q++GG+   S +RE+G A +     C+L  G+ +
Sbjct: 64  APALDPGFLELGVPVLGICYGMQLLAQNMGGQLAQSLTREYGPAELTFSAPCALWDGL-D 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +  +VWMSHGD+V   P GF V   + +   A +ADEKR  YAVQFHPEV H+V G +
Sbjct: 123 ARNPSRVWMSHGDKVLAPPPGFAVTGRTPTLDVAAMADEKRGIYAVQFHPEVHHSVDGER 182

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  VA I  +W MSS+ + +V  + EQVG+  V+CA+SGG+DSTV A L++ AIG
Sbjct: 183 VLQNFLFKVAHITPDWTMSSFVERVVKEMAEQVGDRHVVCALSGGIDSTVVAVLLHRAIG 242

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ VD+G +R NE E +++  + + +  L  V A E F+ +LK + DPE KRK+IG
Sbjct: 243 KRLHCIFVDNGLLRLNEGEEVVNYLREHFDLNLDFVQAQELFLSRLKGVEDPEKKRKIIG 302

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FIE+F+EEAKK+    FL QGTLYPDVIES+S   GPS++IKSHHNVGGLP+ M +KL
Sbjct: 303 HTFIEIFDEEAKKLPQVDFLAQGTLYPDVIESVSH-KGPSAVIKSHHNVGGLPDTMKLKL 361

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR +  EL +PDS V RHP PGPGLAIR +GEITEER+ ILR +D I +
Sbjct: 362 IEPLRELFKDEVRKVAAELGMPDSIVWRHPFPGPGLAIRVLGEITEERLGILRLADRIVQ 421

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EE+ ++G YRK+WQ F VLLP++TVGVMGD RTYE+V +LR V S+D MTAD+     + 
Sbjct: 422 EELRESGWYRKVWQGFAVLLPLKTVGVMGDGRTYEHVIALRVVDSVDAMTADWARLPADL 481

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++++ RI+NEVKG+NRVVYD++SKPP+TIEWE
Sbjct: 482 IARMSGRIINEVKGVNRVVYDVSSKPPSTIEWE 514


>gi|237755401|ref|ZP_04584028.1| GMP synthase [glutamine-hydrolyzing] [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692442|gb|EEP61423.1| GMP synthase [glutamine-hydrolyzing] [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 511

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 370/511 (72%), Gaps = 4/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+TQLIARR+RE  VY E++ F  +++   + NP+ +I SG PAS  + D+P
Sbjct: 5   IVILDFGSQYTQLIARRIRELNVYSEILQFNASVEEILKHNPKGMIFSGGPASVYEPDAP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +  +++ +  +P+LGICYG Q++    GG+   +   E+G+A +E+  +  L   +    
Sbjct: 65  KPDEKVYDLGLPILGICYGLQLITHHFGGEVIKADKHEYGKAELEVLDHEDLFYNI---P 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              QVWMSH D+V  +PEGFEVI  + + PFA + ++++K + VQFHPEV HT+ G +++
Sbjct: 122 HYTQVWMSHADKVVKLPEGFEVIGRTFNAPFAAVRNKEKKIWGVQFHPEVSHTLLGKEML 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF   +   + +W M ++  E  + I++ VGN++ ICA+SGGVDS+VAA L++ AIG N
Sbjct: 182 KNFAVRICKCKQDWTMGNFLMEKQAEIRKMVGNKKAICALSGGVDSSVAAVLVHNAIGDN 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VD+G +RK E E +   F+   +  L VVDA +RF++ LK I DPE KRK+IG L
Sbjct: 242 LTCIFVDNGLLRKGEREQVEKTFRDNFHISLIVVDAKDRFLKALKGITDPEQKRKIIGNL 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKK+   ++L QGTLYPDVIES+S   GPS++IK+HHNVGGLPE M++KL+E
Sbjct: 302 FIEVFEEEAKKLKDVEYLVQGTLYPDVIESVSV-KGPSAVIKTHHNVGGLPERMNLKLIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LGKEL LP+  + R P PGPGLAIR IGE+ E  +NILRE+DAI  EE
Sbjct: 361 PLRELFKDEVRELGKELGLPEEIIYRQPFPGPGLAIRVIGEVNENDLNILREADAIVLEE 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y+ +WQ+F VLLP+ TVGVMGD RTYE V ++RAV S DGMTAD+     + L 
Sbjct: 421 IKKAGLYKDLWQSFAVLLPIHTVGVMGDYRTYEKVIAIRAVESTDGMTADWARLPYDLLD 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +  RI+NEVKG+NRVVYDI+SKPPATIEWE
Sbjct: 481 TMMRRIINEVKGVNRVVYDISSKPPATIEWE 511


>gi|78356515|ref|YP_387964.1| GMP synthase [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|91206806|sp|Q311X7|GUAA_DESDG RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|78218920|gb|ABB38269.1| GMP synthase (glutamine-hydrolyzing) [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 516

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/517 (52%), Positives = 378/517 (73%), Gaps = 3/517 (0%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E+ +KV+I+D+GSQ TQLIARR+RE+ VY E+             +P A++LSG PAS L
Sbjct: 2   EKQNKVIIVDYGSQVTQLIARRIREAGVYSEIHPCIVTAAEVAAMSPSAVVLSGGPASVL 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
             DSP + K +LE  +P+LGICYG Q++  +LGG+   S++RE+G A ++      L  G
Sbjct: 62  GEDSPALDKGLLELGVPVLGICYGMQLLAHNLGGELSCSETREYGPADLKFCAGSPLWDG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           + +     +VWMSHGD+V+ +P GF V  S+++   A +AD++R+ YAVQFHPEV H+  
Sbjct: 122 L-KTDESSRVWMSHGDRVKKVPAGFTVTGSTETLEVAAMADDQRRIYAVQFHPEVHHSED 180

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLIY 243
           G +++ NF+  +AGI+ +W MSS+ + ++  + EQVG +++V+CA+SGG+DSTV A L++
Sbjct: 181 GVRMLHNFLFKIAGIKADWSMSSFCERVIKEVSEQVGPDDQVVCALSGGIDSTVVAVLLH 240

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +AIG  L C+ VD+G +R NEV+ +    + + +  L VVDA ERF+++   + DPE KR
Sbjct: 241 KAIGHRLHCIFVDNGVLRLNEVDEVSGYLREHFDLNLTVVDARERFMKQFAGVEDPEKKR 300

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FI+VF+EE++KI   ++L QGTLYPDVIESIS   GPS++IKSHHNVGGLPE M
Sbjct: 301 KIIGYTFIDVFDEESQKIPNVKYLAQGTLYPDVIESISH-KGPSAVIKSHHNVGGLPETM 359

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KL+EPL+ELFKDEVR L  EL LPD  V RHP PGPGLAIR IGE+TEER++ILR++D
Sbjct: 360 KLKLIEPLRELFKDEVRKLAVELGLPDFIVWRHPFPGPGLAIRVIGEVTEERLDILRKAD 419

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I + E+  +G YRK+WQ F VLLP++TVGVMGD+RTYE+V +LR V S+D MTAD+   
Sbjct: 420 KIVQNELTASGWYRKVWQGFAVLLPLKTVGVMGDDRTYEHVIALRVVDSVDAMTADWVRL 479

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L +++ RI+NEVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 480 PSEVLERISSRIINEVKGVNRVVYDISSKPPSTIEWE 516


>gi|258593582|emb|CBE69923.1| GMP synthase [glutamine-hydrolyzing] (Glutamine amidotransferase)
           (GMP synthetase) [NC10 bacterium 'Dutch sediment']
          Length = 510

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/513 (53%), Positives = 365/513 (71%), Gaps = 4/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           +K+LI+DFGSQ+TQLIARRVRE  VYCE+  F   LD  K  NP+ IILSGSPAS    D
Sbjct: 2   NKILILDFGSQYTQLIARRVRELGVYCEIHPFDLPLDNIKAFNPKGIILSGSPASVYQPD 61

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P   +EI+E  +P+LGICYG  ++    G  +  + +RE+GRA + I  +  L  G+  
Sbjct: 62  APLCRREIIEQGVPVLGICYGMGVLGHFYGAVSTRAANREYGRASLTIDDDSDLFAGL-- 119

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +   VWMSHGD++E +P+ F  +A + + PFA I    +  +AVQFHPEV HT  G  
Sbjct: 120 -NNGLTVWMSHGDKLEAMPDTFRRLAHTANAPFAAIRHRTQPLFAVQFHPEVAHTDSGKA 178

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  V G   +W M S+ +  + RI+ +VG++RV+CA+SGGVDS+V A L++ AIG
Sbjct: 179 ILGNFLFKVCGCAHDWEMHSFAEMAIDRIRRRVGDQRVLCALSGGVDSSVVALLVHRAIG 238

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             LTCV VD+G +RK E   +      +    L  VDA ERF+ +LK I+DPE KRK+IG
Sbjct: 239 PKLTCVFVDNGLLRKGEAAQVEQAMGEHLGVHLVSVDARERFLTRLKGIIDPEEKRKIIG 298

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FI VFEEE++++G   FL QGTLYPDVIES+S   GPS  IKSHHNVGGLPE  D +L
Sbjct: 299 AEFIAVFEEESRRLGRFDFLAQGTLYPDVIESVSV-KGPSVTIKSHHNVGGLPEQFDFEL 357

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR LG+EL LPD+ + R P PGPGLA+R I EIT+ R+++LRE+DAI  
Sbjct: 358 LEPLRELFKDEVRELGRELGLPDAILWRQPFPGPGLAVRIIDEITQARLDLLREADAIVE 417

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
            EI +A + R++WQAF VLLP++TVGVMGDERTYE+V ++RAVTS+DGMTAD+     + 
Sbjct: 418 AEITRAKLNRELWQAFAVLLPIKTVGVMGDERTYEHVVAIRAVTSLDGMTADWARLPHDL 477

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L  ++ RI++EVKG+NRVVYDI+SKPP+TIEWE
Sbjct: 478 LQAISSRIISEVKGVNRVVYDISSKPPSTIEWE 510


>gi|116749554|ref|YP_846241.1| GMP synthase [Syntrophobacter fumaroxidans MPOB]
 gi|116698618|gb|ABK17806.1| GMP synthase (glutamine-hydrolyzing) [Syntrophobacter fumaroxidans
           MPOB]
          Length = 518

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 369/512 (72%), Gaps = 3/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ+TQLIARRVRES VYCE+  F   ++  K   P+ IILSG P+S  +  +
Sbjct: 10  RVLILDFGSQYTQLIARRVRESHVYCEIHPFNMDMESIKAFRPKGIILSGGPSSVHEQGA 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P     I E  +P+LGICYG Q+M + LGG  + +  RE+G A I+I     L + +  +
Sbjct: 70  PFSDPAIFELGVPVLGICYGMQLMARQLGGSVERADRREYGPATIDIDVPDELFRDIERE 129

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSHGD++  +P GF ++A SD++P A + + +R+ Y VQFHPEVVHT  G  +
Sbjct: 130 GVR--VWMSHGDRILELPAGFSILARSDNSPAAAMGNSERRLYGVQFHPEVVHTPCGKDI 187

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           +DNF+      +  W M S+ +  V+ I+EQVG+++VICA+SGGVDS+V A L++ AIG 
Sbjct: 188 LDNFLFRTCRCRATWTMKSFVESAVASIREQVGDDQVICALSGGVDSSVVAVLLHNAIGS 247

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L C+ V++G +RK E E++  +F+ + +  L   DAS+ F+ +LK++ DPE KRK+IG 
Sbjct: 248 RLHCIFVNNGLLRKGEAESVQRVFRDHFSINLIYADASDLFLERLKDVTDPERKRKIIGN 307

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LF+E+FE EA ++   ++L QGTLYPDVIES+SF  GPS+ IK+HHNVGGLPE M++KL+
Sbjct: 308 LFVELFEREAGRLESVKYLAQGTLYPDVIESVSF-KGPSATIKTHHNVGGLPERMNLKLI 366

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG+EL LP+  + RHP PGPGLAIR IG +T E + ILR++D I  E
Sbjct: 367 EPLRELFKDEVRMLGRELGLPERIIMRHPFPGPGLAIRTIGAVTPESLEILRDADRIILE 426

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  +G Y  +WQAF VLLP+++VGVMGDERTY+ V ++RAV S+D MTAD+       L
Sbjct: 427 EIEASGWYDHVWQAFAVLLPIRSVGVMGDERTYDQVVAVRAVESVDAMTADWARLPYEVL 486

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI+NEVKG+NRVVYDI+SKPP TIEWE
Sbjct: 487 QRISNRIINEVKGVNRVVYDISSKPPGTIEWE 518


>gi|254416610|ref|ZP_05030361.1| GMP synthase, C-terminal domain protein [Microcoleus chthonoplastes
           PCC 7420]
 gi|196176576|gb|EDX71589.1| GMP synthase, C-terminal domain protein [Microcoleus chthonoplastes
           PCC 7420]
          Length = 542

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 371/517 (71%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++ + +  ++ +P+ IILSG P S  D  +P
Sbjct: 29  IVILDFGSQYSELIARRIRETQVYSEVISYRTSAEQLRQLSPKGIILSGGPNSVYDDAAP 88

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   EIL   IP+LG+CYG Q+M Q LGGK   SQ  E+G+A + I     LL  + E  
Sbjct: 89  QCDPEILLMGIPILGVCYGMQLMVQQLGGKVTRSQRGEYGKAELHIDDPTDLLTNVEESS 148

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD  + +P+GFEV+A +D+TP A IAD ++  Y VQFHPEVVH+VGG  LI
Sbjct: 149 T---MWMSHGDSCQELPDGFEVLAHTDNTPCAAIADHQKHLYGVQFHPEVVHSVGGIALI 205

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 206 RNFVYHICDCEPTWTTEAFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLHKAIGDQ 265

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF+   + P+  V+A +RF+ +L+ + DPE KR+ IG  
Sbjct: 266 LTCMFIDQGFMRKLEPERLVKLFQDEFHIPVEYVNARDRFLARLEGVTDPEEKRRRIGHE 325

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEE++K +G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 326 FIRVFEEQSKILGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 385

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP++ V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 386 RFKLVEPLRKLFKDEVRKVGRSIGLPEAIVRRHPFPGPGLAIRIIGEVTAERLNILRDAD 445

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI++ G+Y+++WQAF VLLP+++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 446 LIVRQEINRHGLYKELWQAFAVLLPIRSVGVMGDQRTYAYPVVLRLVSSEDGMTADWSRV 505

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L  ++ RIVNEVKG+NRV YDITSKPP TIEWE
Sbjct: 506 PYELLELISNRIVNEVKGVNRVAYDITSKPPGTIEWE 542


>gi|310657611|ref|YP_003935332.1| gmp synthetase [Clostridium sticklandii DSM 519]
 gi|308824389|emb|CBH20427.1| GMP synthetase (glutamine aminotransferase) [Clostridium
           sticklandii]
          Length = 509

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/515 (53%), Positives = 366/515 (71%), Gaps = 7/515 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   VLIIDFG Q+ QLIARRVRE+KVYCE++ +K A++  KE  P+ II +G P+S  D
Sbjct: 2   KHETVLIIDFGGQYNQLIARRVREAKVYCEIVPYKKAMEKIKEVKPEGIIFTGGPSSVND 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             +P I  EI +  IP+LGICYG Q+  ++LGG     + RE+G+  I    N +  K  
Sbjct: 62  PGAPDIQAEIFDLGIPILGICYGAQLTAKTLGGSVAKPEKREYGKTEI----NYTGGKLF 117

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
            +       WMSH DQ++ +PEGF + A++   P A + +  +K YA+QFHPEV HTV G
Sbjct: 118 KDVDKSNICWMSHTDQIDKLPEGFTITAATHDCPVAAMENVDKKLYALQFHPEVEHTVQG 177

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            ++I NF+  V  +  ++   S+  + V  I++QVG+++ +CA+SGGVDS+VAA L+++A
Sbjct: 178 YKIIRNFLFEVCALSGDFTSDSFIDDKVRLIRQQVGDKKTLCALSGGVDSSVAAVLVHKA 237

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG NLTC+ VDHG +RKNE +++  +F+   +  L  V+A ERF+ KL  + DPE KRK+
Sbjct: 238 IGDNLTCIFVDHGLLRKNEGDDVERIFRDEFSMNLIRVNAQERFLSKLAGVTDPERKRKI 297

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FI VFEEE+KK+G  +FL QGT+YPDVIES +     +++IKSHHNVGGLPE M +
Sbjct: 298 IGEEFIRVFEEESKKLGDVEFLVQGTIYPDVIESGT---DEAAVIKSHHNVGGLPEDMKL 354

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
            LVEPL+ELFKDEVR +G EL +P+  + RHP PGPGL IR +GE+TEE+ +ILRE+DAI
Sbjct: 355 SLVEPLRELFKDEVRNVGLELGIPEYLIFRHPFPGPGLGIRVLGEVTEEKCDILREADAI 414

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           YREE+ KAG+ RKIWQAF  L  V+TVGVMGDERTY Y+  LRA+TS DGMT +FY    
Sbjct: 415 YREELEKAGLGRKIWQAFATLPDVKTVGVMGDERTYSYMVGLRAITSTDGMTGEFYPIPY 474

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L  ++ RIVNEVKG+NRVVYD+T KPPATIEWE
Sbjct: 475 EVLGTISTRIVNEVKGVNRVVYDVTGKPPATIEWE 509


>gi|332982204|ref|YP_004463645.1| GMP synthase [Mahella australiensis 50-1 BON]
 gi|332699882|gb|AEE96823.1| GMP synthase (glutamine-hydrolyzing) [Mahella australiensis 50-1
           BON]
          Length = 511

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/512 (54%), Positives = 365/512 (71%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ +LIARRVRE+KVYCEV+ +   L+  +   P+ II +G P+S    ++P
Sbjct: 6   VLVLDFGGQYNELIARRVREAKVYCEVLPYNTPLESIRSIAPKGIIFTGGPSSVYADNAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
                I    IP+LGICYG Q+M + LGG    +Q RE+GR  I I     L  G+    
Sbjct: 66  YCDDGIYRLGIPILGICYGAQLMAKQLGGHVARAQVREYGRTDIHIDNQSVLFHGI---E 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S    WMSH D ++ +P GF+VIASS + P A +ADE+RK YAVQFHPEV HT  G  ++
Sbjct: 123 SDTVGWMSHTDYIDELPAGFKVIASSFNCPVAAMADEERKLYAVQFHPEVAHTPRGFDML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V G    W M+S+ ++ V+ IKE+VGN   +CA+SGGVDS+VAA L+++AIG  
Sbjct: 183 KNFLYKVCGCNGTWTMTSFIEDTVASIKERVGNGSALCALSGGVDSSVAAMLVHKAIGRR 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+LVDHG MR++EVE +  +FK   N  L VVDAS+RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCILVDHGLMRQDEVEEVERVFKEQFNVNLVVVDASDRFLSKLKGVTDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFEE+AK +G   +L QGT+YPDVIES     G +++IKSHHNVGGLPE +D K ++
Sbjct: 303 FIRVFEEQAKALGHIDYLVQGTIYPDVIESGR---GDAAVIKSHHNVGGLPEDIDFKGII 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ LFKDEVR +G EL +P+  V R P PGPGLAIR IGE+T E++ ILR +DAI R 
Sbjct: 360 EPLRNLFKDEVRKVGLELGMPEKVVWRQPFPGPGLAIRIIGEVTPEKLAILRHADAILRA 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+ R+IWQ F VL  +++VGVMGDERTY+Y  +LRAVTS DGMTAD+     + L
Sbjct: 420 EIAKAGLDREIWQYFAVLTGMRSVGVMGDERTYDYTIALRAVTSTDGMTADWARIPYDVL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           S ++ RIVNEV+ +NRVVYDITSKPPATIEWE
Sbjct: 480 SNISNRIVNEVQNVNRVVYDITSKPPATIEWE 511


>gi|224373011|ref|YP_002607383.1| GMP synthase [Nautilia profundicola AmH]
 gi|223588494|gb|ACM92230.1| GMP synthase (glutamine-hydrolyzing) [Nautilia profundicola AmH]
          Length = 511

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 276/512 (53%), Positives = 365/512 (71%), Gaps = 4/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  +Y E++ + + L   KE+ P+ II SG PAS  + D+
Sbjct: 4   EILILDFGSQYTQLIARRLREEGIYSEIVPYFDGLKAAKEKKPKGIIFSGGPASVYEKDA 63

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
            ++ KEI E  +P+LGICYG Q++    GG+   +   E+G+A + I +   L   +   
Sbjct: 64  YRVDKEIYELGLPILGICYGMQLITVDFGGEVVRADHHEYGKAELFIDEPHKLFDDV--- 120

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            +   VWMSHGD+VE +  GF+ IA + + P+A I +E+++ YA+QFHPEV H+V G ++
Sbjct: 121 SNPTIVWMSHGDRVEKLAPGFKRIAHTSNAPYAAIVNEEKEIYAIQFHPEVTHSVEGQKI 180

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF  +V G+   W M+ + KE + +I+EQVG+ +VICA+SGGVDS+V A L++EAIG 
Sbjct: 181 LRNFARNVCGVTSKWDMAHFAKEQIKKIREQVGDNKVICALSGGVDSSVTAALLHEAIGD 240

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L  + VD G +RKNE E +   FK   + PL  VDA E+F+ KLK +VDPE KRK+IG 
Sbjct: 241 KLVPIFVDTGLLRKNEREQVEHAFKNVLHVPLITVDAREKFLSKLKGVVDPEEKRKIIGH 300

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVF+EEAKK   A+FL QGTLYPDVIES+S   GPS  IKSHHNVGGLP+ M  +L+
Sbjct: 301 TFIEVFDEEAKKHKDAKFLAQGTLYPDVIESVS-VKGPSKTIKSHHNVGGLPDWMQFELI 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG EL LP   V RHP PGPGLAIR +GE+ EE +NILRE+DAI  +
Sbjct: 360 EPLRELFKDEVRKLGIELGLPSELVYRHPFPGPGLAIRIMGEVNEEDLNILREADAILIQ 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+   G+Y  +WQAF VLL V++VGVMGD RTY+   ++R V+S DGMTA F H    FL
Sbjct: 420 ELKAWGLYNDVWQAFAVLLNVRSVGVMGDNRTYDNTVAIRCVSSTDGMTATFSHLPHEFL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 480 ERVSTRIINEVDGINRVVYDISSKPPATIEWE 511


>gi|168182080|ref|ZP_02616744.1| GMP synthase (glutamine-hydrolyzing) [Clostridium botulinum Bf]
 gi|237796735|ref|YP_002864287.1| GMP synthase [Clostridium botulinum Ba4 str. 657]
 gi|259647673|sp|C3KUC5|GUAA_CLOB6 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|182674773|gb|EDT86734.1| GMP synthase (glutamine-hydrolyzing) [Clostridium botulinum Bf]
 gi|229263393|gb|ACQ54426.1| GMP synthase [Clostridium botulinum Ba4 str. 657]
          Length = 510

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K M EK 
Sbjct: 66  RVQKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFKDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VGN++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWTMSSFAEQQIKAIKEKVGNKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|188997529|ref|YP_001931780.1| GMP synthase, large subunit [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932596|gb|ACD67226.1| GMP synthase, large subunit [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 511

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 369/511 (72%), Gaps = 4/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+TQLIARR+RE  VY E++ F  +++   + NP+ II SG PAS  + D+P
Sbjct: 5   IVILDFGSQYTQLIARRIRELNVYSEILPFNASVEEILKHNPKGIIFSGGPASVYEPDAP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +  +++ +  +P+LGICYG Q++    GG+   +   E+G+A +E+  +  L   +    
Sbjct: 65  KPDEKVYDLGLPILGICYGLQLITHHFGGEVIKADKHEYGKAELEVLDHEDLFYNI---P 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              QVWMSH D+V  +PEGFEVI  + + PFA + ++++K + VQFHPEV HT+ G +++
Sbjct: 122 HYTQVWMSHADKVIKLPEGFEVIGRTFNAPFAAVRNKEKKIWGVQFHPEVSHTLLGKEML 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF   +   + +W M ++  E    I++ VG+++ ICA+SGGVDS+VAA L++ AIG N
Sbjct: 182 KNFAVRICKCKQDWTMGNFLMEKQVEIRKMVGDKKAICALSGGVDSSVAAVLVHNAIGDN 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VD+G +RK E E +   F+   +  L VVDA +RF++ LK I DPE KRK+IG L
Sbjct: 242 LTCIFVDNGLLRKGEREQVEKTFRDNFHISLIVVDAKDRFLKALKGITDPEQKRKIIGNL 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKK+   ++L QGTLYPDVIES+S   GPS++IK+HHNVGGLPE M++KL+E
Sbjct: 302 FIEVFEEEAKKLKDVEYLVQGTLYPDVIESVSV-KGPSAVIKTHHNVGGLPERMNLKLIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LGKEL LP+  + R P PGPGLAIR IGE+ E  +NILRE+DAI  EE
Sbjct: 361 PLRELFKDEVRELGKELGLPEEIIYRQPFPGPGLAIRVIGEVNENDLNILREADAIVLEE 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+Y+ +WQ+F VLLP+ TVGVMGD RTYE V ++RAV S DGMTAD+     + L 
Sbjct: 421 IKKAGLYKDLWQSFAVLLPIYTVGVMGDYRTYEKVIAIRAVESTDGMTADWARLPYDLLD 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +  RI+NEVKG+NRVVYDI+SKPPATIEWE
Sbjct: 481 TMMRRIINEVKGVNRVVYDISSKPPATIEWE 511


>gi|187776788|ref|ZP_02993261.1| hypothetical protein CLOSPO_00304 [Clostridium sporogenes ATCC
           15579]
 gi|187775447|gb|EDU39249.1| hypothetical protein CLOSPO_00304 [Clostridium sporogenes ATCC
           15579]
          Length = 510

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE+I +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIIPYTTSIEKIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ + +IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K + EK 
Sbjct: 66  RVEKELFDLDIPVLGICYGDQLMAHSLDGEVTSPEKREYGKTEVNLDNSSLLFKNIKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF+ IA++D  P A + + ++K Y VQFHPEV HT+ G Q++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKTIATTDECPCAAMENGEKKLYGVQFHPEVEHTLFGKQML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ ++  ++ +W MSS+ +E +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNICDLKGDWTMSSFAEEQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|331270376|ref|YP_004396868.1| GMP synthase, large subunit [Clostridium botulinum BKT015925]
 gi|329126926|gb|AEB76871.1| GMP synthase, large subunit [Clostridium botulinum BKT015925]
          Length = 517

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 372/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  K++NP+AII +G P S     +P
Sbjct: 13  VLVVDFGGQYNQLIARRVREHNVYCEIIPYTTSIEDIKKKNPKAIIFTGGPNSVYGEGAP 72

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I K+I +  IP+LGICYG Q+   +LGGK ++   RE+G+  ++I     L  G+ E+ 
Sbjct: 73  RIEKQIFDLEIPVLGICYGHQLTAYTLGGKVESPDIREYGKTEVKIDNKSPLFDGIKEE- 131

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D V  IP GF++IA++D  P A +A+E+R+ Y VQFHPEV HT+ G +++
Sbjct: 132 --DQSWMSHTDYVSEIPVGFKIIATTDQCPVAAMANEERRIYGVQFHPEVEHTLFGQKML 189

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +A ++ +W M+S+ +E +  IKE VG+++V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 190 GNFLFKIANLKGDWSMASFAEEKIKAIKELVGDKKVLCALSGGVDSSVAAVLVHKAIGKQ 249

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + + ++FK   +  L  V+A+ERF+ KLK + DPETKRK+IG+ 
Sbjct: 250 LTCVFVDHGLLRKDEGDQVEAIFKKQFDMNLIRVNAAERFLGKLKGVSDPETKRKIIGEE 309

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M   L+E
Sbjct: 310 FIRVFEEEAGKLGQIDFLVQGTIYPDVVESGT---NTSATIKSHHNVGGLPEDMQFSLIE 366

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I RE+DAI+REE
Sbjct: 367 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEITREADAIFREE 426

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +++VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 427 IALAGLEEKIWQYFACLPNIRSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 486

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPP+TIEWE
Sbjct: 487 KVSRRIVNEVKGVNRIVYDVTSKPPSTIEWE 517


>gi|91225130|ref|ZP_01260352.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio alginolyticus 12G01]
 gi|91190073|gb|EAS76344.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio alginolyticus 12G01]
          Length = 517

 Score =  565 bits (1455), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 369/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +PLLG+CYG Q M + LGGK   S  REFG A +++   C+
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVAGSNEREFGYAQVKVSGECA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|269965178|ref|ZP_06179312.1| GMP synthase/glutamine amidotransferase protein [Vibrio
           alginolyticus 40B]
 gi|269830164|gb|EEZ84391.1| GMP synthase/glutamine amidotransferase protein [Vibrio
           alginolyticus 40B]
          Length = 517

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 369/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +PLLG+CYG Q M + LGGK   S  REFG A +++   C+
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVAGSNEREFGYAQVKVSGECA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|254228658|ref|ZP_04922082.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25]
 gi|262395109|ref|YP_003286963.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25]
 gi|151938837|gb|EDN57671.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25]
 gi|262338703|gb|ACY52498.1| GMP synthase (glutamine-hydrolyzing) [Vibrio sp. Ex25]
          Length = 517

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 368/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +PLLG+CYG Q M + LGGK   S  REFG A +++   C+
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVAGSNEREFGYAQVKVSGECA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA +RF+  LK   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEDRFLEALKGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DEMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|189485394|ref|YP_001956335.1| GMP synthase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|170287353|dbj|BAG13874.1| GMP synthase [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 509

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 279/512 (54%), Positives = 362/512 (70%), Gaps = 5/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKE-QNPQAIILSGSPASSLDIDS 68
           +LI+DFGSQ+TQLIARR+RE KVYCE+      +  F   ++ + IILSG   S    D+
Sbjct: 2   ILILDFGSQYTQLIARRIREEKVYCELCPGNKPIKSFSGIKDLKGIILSGGYESVYSKDA 61

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P    EI E ++P+LGICYG Q++ +  GGK   S+ REFG A + +K N SL  G+   
Sbjct: 62  PWPDPEIWELDVPILGICYGMQLIAELHGGKVAPSKRREFGLANVNVKCNSSLFNGL--- 118

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            S++ +WMSHGD++  IP+GFE+ A SD++P+A I +  +  Y VQFHPEV H+V G  +
Sbjct: 119 SSEETLWMSHGDKLSKIPKGFEITAKSDNSPYAAIENTAKNIYGVQFHPEVKHSVNGRTI 178

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+  + G++ +W M SY  E V RI +QVG  +V+CA+SGGVDS+VAA ++Y+AIG 
Sbjct: 179 LKNFIFKICGLKRDWTMKSYIVEEVKRIHKQVGKSKVLCALSGGVDSSVAAVMLYKAIGK 238

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L CV VDHG  +  E E +  +F       L +V A + F+ KLK I DPE KRK+IG 
Sbjct: 239 QLICVYVDHGLQKLGETERVRKVFGRMFGKNLIIVSAKKIFLSKLKGITDPEQKRKIIGH 298

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVF+ E KK+ G  FL QGT+Y DVIES+S  G  S I KSHHNVGGLPE M MKLV
Sbjct: 299 TFIEVFDGEVKKLKGINFLLQGTIYSDVIESVSIKGAKSPI-KSHHNVGGLPEKMKMKLV 357

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ LFKDEVR+LGKEL +P   ++R P PGPGLAIR +GEIT+E++NIL+E+D I  E
Sbjct: 358 EPLRFLFKDEVRVLGKELGVPSEIIDRQPFPGPGLAIRTLGEITKEKLNILKEADNIVTE 417

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y KIWQ+F ++LPV+TVGVMGD RTYEYV ++RAV S D MTAD+       L
Sbjct: 418 EIIKAGLYEKIWQSFAIILPVKTVGVMGDARTYEYVIAIRAVNSEDAMTADWVKLPYELL 477

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           S+++ RI+NEVKG NRVVYDI+ KPPATIEWE
Sbjct: 478 SKISSRIINEVKGTNRVVYDISDKPPATIEWE 509


>gi|197121929|ref|YP_002133880.1| GMP synthase [Anaeromyxobacter sp. K]
 gi|196171778|gb|ACG72751.1| GMP synthase, large subunit [Anaeromyxobacter sp. K]
          Length = 518

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/518 (53%), Positives = 361/518 (69%), Gaps = 8/518 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ+TQLIARR+RE  VYCE+       +  +   P+ ++LSG PAS L  
Sbjct: 5   SEKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+  + + E  +P+LGICYG Q++   LGG+   +  REFG A IE+K    L +G+ 
Sbjct: 65  GSPRCDRVVFELGVPVLGICYGLQVLAAELGGRVDQAAHREFGPATIEVKATSPLFQGL- 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +   VWMSHGD+VE +P GFE IA++ S P+A + D  R++Y VQFHPEVVHT  G 
Sbjct: 124 --PATLDVWMSHGDRVEALPPGFEPIAATASAPYAAVEDRARRFYGVQFHPEVVHTPRGK 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NF + V G    W M  Y +  V +I+ QV +  VICA+SGGVDS VAA L++ AI
Sbjct: 182 DVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ VD+G +R  E + +  +F    + PL  VDAS RF+  L  + DPE KRK+I
Sbjct: 242 GDRLRCIFVDNGVLRAGERQQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKII 301

Query: 307 GQLFIEVFEEEAKKIGG----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           G  FI VFE+E +++      A+FL QGTLYPDVIES+SF G PS+ IKSHHNVGGLPE 
Sbjct: 302 GHEFIAVFEQEVERLAAHGARAKFLVQGTLYPDVIESVSFRG-PSATIKSHHNVGGLPEK 360

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           M++ LVEPL+ELFKDEVR LG EL LP++ V R P PGPGLAIR +GE+TEER+ +LR +
Sbjct: 361 MNLSLVEPLRELFKDEVRQLGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLAVLRRA 420

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           D I +EE+  AG+Y K+WQ F VLLPV++VGVMGDERTYE  C++RAV S DGMT D+  
Sbjct: 421 DTIVQEEVRAAGLYEKLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWAR 480

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
                L++++ RI+NEV+GINRVVYDI+SKPPATIEWE
Sbjct: 481 LPYELLARMSSRIINEVRGINRVVYDISSKPPATIEWE 518


>gi|328953818|ref|YP_004371152.1| GMP synthase (glutamine-hydrolyzing) [Desulfobacca acetoxidans DSM
           11109]
 gi|328454142|gb|AEB09971.1| GMP synthase (glutamine-hydrolyzing) [Desulfobacca acetoxidans DSM
           11109]
          Length = 515

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/512 (52%), Positives = 366/512 (71%), Gaps = 4/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           KVLI+DFGSQ+TQLIARR+RE +VYCE+  +   L+  +   P+ IILSG P S  +  +
Sbjct: 8   KVLILDFGSQYTQLIARRIRELQVYCEIHPYLMPLEQIEAFAPRGIILSGGPRSVYEPGA 67

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P + +E+LE   P+LGICYG Q++   LGGK   + SRE+GR    I  +  L  G+   
Sbjct: 68  PLVSREVLELGPPVLGICYGLQLLNHILGGKVSPAASREYGRKNFTISDHQDLFAGL--- 124

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
              + VWMSHGD ++ I  G E+I SSD+ P   + D++R+ + VQFHPEV HT  G ++
Sbjct: 125 SPHESVWMSHGDHIDEIAPGLEIIGSSDTCPAGAVRDQRRRIFGVQFHPEVKHTPNGGKI 184

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+  + G+Q  W M S+ +     +++++G ERVICA+SGGVDS+V A L++ AIG 
Sbjct: 185 LANFLFGICGLQPLWNMRSFVEATTQALRQKIGTERVICALSGGVDSSVTAVLLHRAIGD 244

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ V++G +R+ E E ++ LF+      L  VDAS+ F++ L+ IVDPE KR+ IG+
Sbjct: 245 RLTCIFVNNGVLRQGEAEKVVRLFRENYRLNLVYVDASKSFLKLLEGIVDPEEKRRRIGR 304

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI VF EEA K+G  ++L QGTLYPDVIES+SF  GPS+ IK+HHNVGGLPE M ++L+
Sbjct: 305 EFIRVFAEEAGKLGQVKYLAQGTLYPDVIESVSF-KGPSATIKTHHNVGGLPEVMPLELI 363

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G EL LP+  + RHP PGPGLAIR +GE+T ER+ ILR++DAI  E
Sbjct: 364 EPLRELFKDEVREVGSELGLPEEMIWRHPFPGPGLAIRILGEVTPERLAILRQADAIVLE 423

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+  AG YR++WQAF VLLP++TVGVMGDERTYE V +LR V S D MTAD+     + L
Sbjct: 424 EMKAAGFYRQVWQAFAVLLPIKTVGVMGDERTYENVIALRVVDSTDAMTADWSRLPYDLL 483

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++A RI+NEVK +NRVVYDI+SKPP+TIEWE
Sbjct: 484 ARLANRIINEVKHVNRVVYDISSKPPSTIEWE 515


>gi|162451952|ref|YP_001614319.1| GMP synthase [Sorangium cellulosum 'So ce 56']
 gi|161162534|emb|CAN93839.1| GMP synthase (glutamine-hydrolysing) [Sorangium cellulosum 'So ce
           56']
          Length = 524

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 376/517 (72%), Gaps = 4/517 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           R   V+I+DFGSQ+TQLIARRVRES VYCE+  F   +   +   P+A+ILSG PAS   
Sbjct: 10  RRDFVVILDFGSQYTQLIARRVRESGVYCEIHRFDVPIAELRRLAPRALILSGGPASVYG 69

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSR-EFGRAFIEIKKNCSLLKG 124
            ++P+  +E+LE  +P LGICYG Q+M   LGGK + + +  E+G A + +++   +   
Sbjct: 70  DNAPRCSREVLELGVPTLGICYGLQLMAYHLGGKVERAHTGGEYGPATVRVERPTGIFS- 128

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
            + +G    VWMSHGD++  +PEGF  + ++  +P   +A E+ K Y +QFHPEVVHT  
Sbjct: 129 RFAEGDAIDVWMSHGDRLTAMPEGFVSLGTTTGSPLCAVARERDKLYGLQFHPEVVHTPR 188

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVG-NERVICAVSGGVDSTVAAFLIY 243
           G +++ +F+  VAG+   W  +S+ +E ++ ++E+ G ++RVI  +SGGVDS+VAA L  
Sbjct: 189 GKEILQSFLFDVAGLSPTWTPASFVEEAIAAVREKAGPSDRVILGLSGGVDSSVAAVLCQ 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            A+G  LTC+ VD+G +R+ E E++   F+G+ +  L  VDAS RF+  L+ +VDPE KR
Sbjct: 249 RALGDRLTCIFVDNGLLREGEAESVERTFRGHFHMNLDAVDASARFLEGLRGVVDPEQKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           KVIG+LFIEVFEEEAK++ GA++L QGTLYPDVIES+SF  GPS++IKSHHNVGGLPE M
Sbjct: 309 KVIGRLFIEVFEEEAKRVQGAKWLVQGTLYPDVIESVSF-KGPSAVIKSHHNVGGLPERM 367

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           ++ L+EPL+ELFKDEVR  G+ L +P   + R P PGPGLA+RC+GE+T E++ +LRE+D
Sbjct: 368 NLGLIEPLRELFKDEVRAAGEALGMPRDILYRQPFPGPGLAVRCLGEVTPEKLRVLREAD 427

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ +EI  AG+Y  +WQ+F VLLPV++VGVMGDERTY+   +LRAV S DGMTAD+   
Sbjct: 428 AIFDQEIRAAGLYESLWQSFCVLLPVRSVGVMGDERTYDEAIALRAVHSTDGMTADWARL 487

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + +++V+ RI+NEV+G+NRVV D++SKPP+TIEWE
Sbjct: 488 PYDLIARVSSRIINEVRGVNRVVLDVSSKPPSTIEWE 524


>gi|220916722|ref|YP_002492026.1| GMP synthase, large subunit [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954576|gb|ACL64960.1| GMP synthase, large subunit [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 518

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 277/518 (53%), Positives = 361/518 (69%), Gaps = 8/518 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ+TQLIARR+RE  VYCE+       +  +   P+ ++LSG PAS L  
Sbjct: 5   SEKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+  + + E  +P+LGICYG Q+    LGG+   +  REFG A IE+K    L +G+ 
Sbjct: 65  GSPRCDRVVFELGVPVLGICYGLQVFAAELGGRVDQAAHREFGPATIEVKATSPLFQGL- 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +   VWMSHGD+VE +P GFE IA++ S P+A + D  R++Y VQFHPEVVHT  G 
Sbjct: 124 --PATLDVWMSHGDRVEALPPGFEPIAATASAPYAAVEDRARRFYGVQFHPEVVHTPRGK 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NF + V G    W M  Y +  V +I+ QV +  VICA+SGGVDS VAA L++ AI
Sbjct: 182 DVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ VD+G +R  E + +  +F    + PL  VDAS RF+  L  + DPE KRK+I
Sbjct: 242 GDRLRCIFVDNGVLRAGERQQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKII 301

Query: 307 GQLFIEVFEEEAKKIGG----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           G  FI VFE+E +++      A+FL QGTLYPDVIES+SF G PS+ IKSHHNVGGLPE 
Sbjct: 302 GHEFIAVFEQEVERLAAHGARAKFLVQGTLYPDVIESVSFRG-PSATIKSHHNVGGLPEK 360

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           M++ LVEPL+ELFKDEVR LG EL LP++ V R P PGPGLAIR +GE+TEER+ +LR +
Sbjct: 361 MNLSLVEPLRELFKDEVRQLGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLAVLRRA 420

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           D I +EE+  AG+Y K+WQ F VLLPV++VGVMGDERTYE  C++RAV S DGMT D+  
Sbjct: 421 DTIVQEEVRAAGLYEKLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWAR 480

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + L++++ RI+NEV+GINRVVYDI+SKPPATIEWE
Sbjct: 481 LPYDLLARLSSRIINEVRGINRVVYDISSKPPATIEWE 518


>gi|148381238|ref|YP_001255779.1| GMP synthase [Clostridium botulinum A str. ATCC 3502]
 gi|153933266|ref|YP_001385613.1| GMP synthase [Clostridium botulinum A str. ATCC 19397]
 gi|153935009|ref|YP_001389019.1| GMP synthase [Clostridium botulinum A str. Hall]
 gi|226738421|sp|A7FYP0|GUAA_CLOB1 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738422|sp|A5I720|GUAA_CLOBH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|148290722|emb|CAL84853.1| GMP synthase [glutamine-hydrolyzing] [Clostridium botulinum A str.
           ATCC 3502]
 gi|152929310|gb|ABS34810.1| GMP synthase [Clostridium botulinum A str. ATCC 19397]
 gi|152930923|gb|ABS36422.1| GMP synthase [Clostridium botulinum A str. Hall]
          Length = 510

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K M EK 
Sbjct: 66  RVQKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFKDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLLRKDEGDQVERIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|153940088|ref|YP_001392640.1| GMP synthase [Clostridium botulinum F str. Langeland]
 gi|170756813|ref|YP_001782918.1| GMP synthase [Clostridium botulinum B1 str. Okra]
 gi|226738423|sp|B1IFD1|GUAA_CLOBK RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226738424|sp|A7GIN0|GUAA_CLOBL RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|152935984|gb|ABS41482.1| GMP synthase [Clostridium botulinum F str. Langeland]
 gi|169122025|gb|ACA45861.1| GMP synthase [Clostridium botulinum B1 str. Okra]
 gi|295320625|gb|ADG01003.1| GMP synthase [Clostridium botulinum F str. 230613]
 gi|322807605|emb|CBZ05180.1| gmp synthase [glutamine-hydrolyzing] [Clostridium botulinum H04402
           065]
          Length = 510

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K M EK 
Sbjct: 66  RVQKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFKDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|258405113|ref|YP_003197855.1| GMP synthase [Desulfohalobium retbaense DSM 5692]
 gi|257797340|gb|ACV68277.1| GMP synthase, large subunit [Desulfohalobium retbaense DSM 5692]
          Length = 515

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/513 (52%), Positives = 362/513 (70%), Gaps = 2/513 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           ++VLI+DFGSQ+TQLIARRVRE+ VY E+      +D  +   P A+ILSG P+S  D D
Sbjct: 5   NRVLILDFGSQYTQLIARRVREAGVYSEIHPCTTPIDELQAMKPSALILSGGPSSVTDPD 64

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P +   ILE +IP+LGICYG Q++   LGG    +Q RE+GRA +E+ +   L  GM  
Sbjct: 65  APAVDPAILEWDIPILGICYGMQLLATLLGGDVVPAQDREYGRAEVEVIEKSPLWSGMHF 124

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           +    +VWMSHGD+V   PEGF V+A +     A +    R+ Y +QFHPEVVHT  G Q
Sbjct: 125 Q-DPVKVWMSHGDKVMAPPEGFTVLARTPQVDVAAMGSADRRIYGLQFHPEVVHTEDGDQ 183

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+  VA +  +W M+S+ + +   +   +G+ +V+C +SGG+DSTV A L+++AIG
Sbjct: 184 ILRNFLFDVAELTPDWTMASFVETMRDSLPTLIGDGKVVCGLSGGIDSTVVAVLLHKAIG 243

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ VD+G +R++E E ++   + + +  L+ V A +RF+ +L  + DPE KRK+IG
Sbjct: 244 KQLHCIFVDNGLLRQDEGEEVVQYLRRHFDLNLKYVQAQDRFLSRLHGVEDPEEKRKIIG 303

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FIEVFEEEAK+I   Q+L QGTLYPDVIES+SF  GPS++IKSHHNVGGLPE M M L
Sbjct: 304 HTFIEVFEEEAKEIKDVQYLAQGTLYPDVIESVSF-KGPSAVIKSHHNVGGLPERMQMDL 362

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPL+ELFKDEVR +  EL LPD  V RHP PGPGLAIR IGEIT ER+ ILR++D I  
Sbjct: 363 VEPLRELFKDEVRKVAVELGLPDFLVWRHPFPGPGLAIRVIGEITPERLEILRKADKIVH 422

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
            E+  +G Y K+WQ F VLLP++TVGVMGDERTYE+V +LR V S+D MTAD+     + 
Sbjct: 423 NELMASGWYYKVWQGFAVLLPLKTVGVMGDERTYEHVIALRVVDSVDAMTADWTRLPPDL 482

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L +++ RI+NEVKG+NRVVYD++SKPP TIEWE
Sbjct: 483 LGRISNRIINEVKGVNRVVYDVSSKPPGTIEWE 515


>gi|153953103|ref|YP_001393868.1| GMP synthase [Clostridium kluyveri DSM 555]
 gi|219853754|ref|YP_002470876.1| hypothetical protein CKR_0411 [Clostridium kluyveri NBRC 12016]
 gi|226738426|sp|A5N5D9|GUAA_CLOK5 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|254800093|sp|B9DYY7|GUAA_CLOK1 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|146345984|gb|EDK32520.1| GuaA [Clostridium kluyveri DSM 555]
 gi|219567478|dbj|BAH05462.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 510

 Score =  563 bits (1451), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/511 (52%), Positives = 368/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVRE+ VYCE++ +  ++D  KE+NP+ II +G P S  D ++P
Sbjct: 6   VIVVDFGGQYNQLIARRVRENNVYCEIVPYTYSVDKIKEKNPRGIIFTGGPNSVYDDNAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I ++I E  +P+LGICYG Q++C +LGGK +++Q RE+G+  + +  +  L  G+    
Sbjct: 66  KISEDIFEIGVPVLGICYGHQLICTTLGGKVESAQVREYGKTDVVLNNSSGLFSGI---D 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             +  WMSH D V + PEGF++I  S  +P A + +  +K Y VQFHPEV HT  G +++
Sbjct: 123 KNESCWMSHTDFVSYPPEGFKIIGKSGESPVAAVENIDKKIYGVQFHPEVEHTPFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +  ++ +W MSS+  E +  IKE+VG+++VICA+SGGVDS+VAA ++++A+G  
Sbjct: 183 SNFLFDICNLKGDWSMSSFVDEKIKSIKEEVGDKKVICAMSGGVDSSVAAMIVHKAVGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   N     V+A +RF++KLK+I DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEDIFKKQFNMNFIRVNAEKRFLQKLKDISDPEKKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPDV+ES     G S+ IKSHHNVGGLPE MD KL+E
Sbjct: 303 FIRVFEEEAKKLGEIAFLVQGTIYPDVVESGL---GTSATIKSHHNVGGLPEDMDFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +G ITEE++ I R++DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGNITEEKLQITRDADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KA +   IWQ F  L  +++VGVMGDERTY Y  +LRAV S D MT+D+       L 
Sbjct: 420 IAKANLDETIWQYFACLPNIRSVGVMGDERTYCYTIALRAVISTDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYDITSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKGVNRIVYDITSKPPATIEWE 510


>gi|261252188|ref|ZP_05944761.1| GMP synthase [glutamine-hydrolyzing] [Vibrio orientalis CIP 102891]
 gi|260935579|gb|EEX91568.1| GMP synthase [glutamine-hydrolyzing] [Vibrio orientalis CIP 102891]
          Length = 517

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/520 (52%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +PLLG+CYG Q M + LGGK   S  REFG A +++    S
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPLLGVCYGMQTMAEQLGGKVSTSNEREFGYAAVQVSGESS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IPEGF     +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EASQDVWMSHGDKVVEIPEGFVKAGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLTALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLENAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|226950720|ref|YP_002805811.1| GMP synthase [Clostridium botulinum A2 str. Kyoto]
 gi|254800092|sp|C1FLV2|GUAA_CLOBJ RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226844589|gb|ACO87255.1| GMP synthase [Clostridium botulinum A2 str. Kyoto]
          Length = 510

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K M EK 
Sbjct: 66  RVQKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFKDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENVEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGNISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|254506805|ref|ZP_05118945.1| GMP synthase [Vibrio parahaemolyticus 16]
 gi|219550386|gb|EED27371.1| GMP synthase [Vibrio parahaemolyticus 16]
          Length = 517

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 369/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    S
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVSTSDEREFGYAAVQVSGESS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP+GF  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EASQDVWMSHGDKVVEIPQGFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|86158770|ref|YP_465555.1| GMP synthase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85775281|gb|ABC82118.1| GMP synthase (glutamine-hydrolyzing) [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 518

 Score =  562 bits (1449), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 279/518 (53%), Positives = 361/518 (69%), Gaps = 8/518 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ+TQLIARR+RE  VYCE+       +  +   P+ ++LSG PAS L  
Sbjct: 5   SEKILILDFGSQYTQLIARRLRELGVYCEIHPCTAKAEAIRAFRPRGVVLSGGPASVLAE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+  + + E  +P+LGICYG Q+    LGG+   +  REFG A IE+K    L +G+ 
Sbjct: 65  GSPRCDRVVFELGVPVLGICYGLQVFAAELGGRVDQAAHREFGPATIEVKATSPLFQGL- 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +   VWMSHGD+VE +P GFE IA+S S PFA + D  R++Y VQFHPEVVHT  G 
Sbjct: 124 --PATLDVWMSHGDRVEALPPGFEPIAASPSAPFAAVEDRARRFYGVQFHPEVVHTPRGK 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NF + V G    W M  Y +  V +I+ QV +  VICA+SGGVDS VAA L++ AI
Sbjct: 182 DVLRNFAYGVCGCSGTWSMRGYAEAAVEQIRAQVKDGHVICALSGGVDSAVAALLVHRAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+ VD+G +R  E + +  +F    + PL  VDAS RF+  L  + DPE KRK+I
Sbjct: 242 GDRLRCIFVDNGVLRAGERKQVEDVFGAMFHLPLVTVDASRRFLGALAGVTDPERKRKII 301

Query: 307 GQLFIEVFEEEAKKIGG----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           G  FI VFE+E +++      A+FL QGTLYPDVIES+SF G PS+ IKSHHNVGGLPE 
Sbjct: 302 GHEFIAVFEQEVERLAAHGARARFLVQGTLYPDVIESVSFRG-PSATIKSHHNVGGLPEK 360

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           M++ LVEPL+ELFKDEVR LG EL LP++ V R P PGPGLAIR +GE+TEER+++LR +
Sbjct: 361 MNLALVEPLRELFKDEVRELGLELGLPEAIVRRQPFPGPGLAIRVLGEVTEERLSVLRRA 420

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           D I +EE+  AG+Y K+WQ F VLLPV++VGVMGDERTYE  C++RAV S DGMT D+  
Sbjct: 421 DTIVQEEVRAAGLYEKLWQGFAVLLPVRSVGVMGDERTYESTCAIRAVESTDGMTGDWAR 480

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + L +++ RI+NEV+GINRVVYDI+SKPPATIEWE
Sbjct: 481 LPYDLLGRMSSRIINEVRGINRVVYDISSKPPATIEWE 518


>gi|170761419|ref|YP_001788611.1| GMP synthase [Clostridium botulinum A3 str. Loch Maree]
 gi|226738425|sp|B1L1J7|GUAA_CLOBM RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|169408408|gb|ACA56819.1| GMP synthase [Clostridium botulinum A3 str. Loch Maree]
          Length = 510

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 372/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L K M EK 
Sbjct: 66  RVRKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFKDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK      L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFEMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|300856861|ref|YP_003781845.1| GMP synthase [Clostridium ljungdahlii DSM 13528]
 gi|300436976|gb|ADK16743.1| GMP synthase [Clostridium ljungdahlii DSM 13528]
          Length = 510

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 271/512 (52%), Positives = 369/512 (72%), Gaps = 8/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVRE+ VYCE++ +  ++D  KE+NP  II +G P S    ++P
Sbjct: 6   VVVVDFGGQYNQLIARRVRENNVYCEILPYTCSIDKIKEKNPNGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I +EI +  +P+LGICYG Q++C  LGGK K+++ RE+G+  IE+  N +L   +    
Sbjct: 66  RISEEIFKLGVPILGICYGHQLICNILGGKVKSAEVREYGKTKIELDANSALFSNI---- 121

Query: 130 SKQQV-WMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            K Q+ WMSH D V   P+GF+VIA ++  P A I +  +K Y VQFHPEV HT  G ++
Sbjct: 122 DKNQISWMSHTDVVSEPPKGFKVIAKTNGCPVAAIENTDKKVYGVQFHPEVEHTPFGRRM 181

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+  V  ++ +W MSS+  E +  I+E+VGN++VICA+SGGVDS+VAA L+++A+G 
Sbjct: 182 LSNFLFKVCNLKGDWSMSSFAGEKIKLIREKVGNKKVICAMSGGVDSSVAAVLVHKAVGK 241

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG +RK+E + +  +FK   +     V+A +RF+ KL+ + DPE KRK+IG+
Sbjct: 242 QLTCIFVDHGLLRKDEGDQVEHVFKKQFDMNFIRVNAKDRFLGKLEGVSDPEKKRKIIGE 301

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI VFEEEA+K+G   FL QGT+YPDV+ES     G S+ IKSHHNVGGLPE MD KL+
Sbjct: 302 EFIRVFEEEARKLGDISFLVQGTIYPDVVESGL---GTSATIKSHHNVGGLPEDMDFKLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I RE+DAI+RE
Sbjct: 359 EPLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLAITREADAIFRE 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+  KIWQ F  L  +++VGVMGDERTY Y  +LRAV S D MT+D+     + L
Sbjct: 419 EIANAGLDEKIWQYFACLPNIRSVGVMGDERTYCYTVALRAVVSSDAMTSDWARIPYDVL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RIVNEVKG+NR+VYD+TSKPP+TIEWE
Sbjct: 479 DKVSRRIVNEVKGVNRIVYDVTSKPPSTIEWE 510


>gi|168179058|ref|ZP_02613722.1| GMP synthase [Clostridium botulinum NCTC 2916]
 gi|182670215|gb|EDT82191.1| GMP synthase [Clostridium botulinum NCTC 2916]
          Length = 510

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 265/511 (51%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE++VYCE++ +  +++  KE+ P+ II +G P S    ++P
Sbjct: 6   VLVVDFGGQYNQLIARRVRENRVYCEIVPYTTSIEDIKEKAPKGIIFTGGPNSVYGENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KE+ +  IP+LGICYG Q+M  SL G+  + + RE+G+  + +  +  L + M EK 
Sbjct: 66  RVQKELFDLGIPVLGICYGDQLMAHSLEGEVTSPEKREYGKTDVNLDNSSLLFRDMKEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSH D +  +P+GF++IA++D  P A + + ++K Y VQFHPEV HT+ G +++
Sbjct: 125 --DQCWMSHTDYISKVPKGFKIIATTDECPCAAMENAEKKLYGVQFHPEVEHTLFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ +V  ++ +W MSS+ ++ +  IKE+VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNVCNLKGDWSMSSFAEQQIKAIKEKVGDKKVICALSGGVDSSVAAVIVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVEKIFKDQFDMNLIRVNAQDRFLGKLKGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ KL+E
Sbjct: 303 FIRVFEEEAKKLGDISFLVQGTIYPDIVESGT---NTSATIKSHHNVGGLPEDMEFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEVTEEKLAITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+D+       L 
Sbjct: 420 IAKAGLEEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVK +NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKEVNRIVYDVTSKPPATIEWE 510


>gi|220905738|ref|YP_002481049.1| GMP synthase [Cyanothece sp. PCC 7425]
 gi|219862349|gb|ACL42688.1| GMP synthase, large subunit [Cyanothece sp. PCC 7425]
          Length = 537

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 366/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           + I+DFGSQ+++LIARR+RE++VY EV++++      +  N + IILSG P+S  D  +P
Sbjct: 24  IAILDFGSQYSELIARRIRETQVYSEVLSYRTTAAQLQTLNLKGIILSGGPSSVYDAKAP 83

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGG+ + S   E+G+A + I     LL  +    
Sbjct: 84  LCDPEIWNLGIPVLGVCYGMQLMVQQLGGEVERSALGEYGKASLLIDDPTDLLTNV---E 140

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++  +WMSHGD V  +P GF+ +A +D+TP A IAD KRK Y VQFHPEVVH++GG  LI
Sbjct: 141 NETTMWMSHGDSVSQLPAGFKTLAHTDNTPCAAIADHKRKLYGVQFHPEVVHSLGGQALI 200

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W    + +E +  I+ +VG++RV+ A+SGGVDS+  AFL+Y AIG  
Sbjct: 201 RNFVYHICQCEPTWTTELFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLYRAIGNQ 260

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRKNE E ++ LF+   + P+  V+ASERF+ +L+ + DPE KRK IG  
Sbjct: 261 LTCMFIDQGFMRKNEPERLVKLFREQFHIPVEYVNASERFLERLEGVTDPEEKRKRIGHE 320

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE++++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 321 FIQVFEEESRRLGPFDYLAQGTLYPDVIESADTNVDPETGERVAVKIKSHHNVGGLPKDL 380

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ L LP+  V+RHP PGPGLAIR +G+IT ER++ILRE+D
Sbjct: 381 RFKLVEPLRKLFKDEVRKVGRSLGLPEEIVQRHPFPGPGLAIRILGDITPERLHILREAD 440

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI+++G+Y++ WQAF VLLP+++VGVMGD RTY Y   LR V+S DGMTAD+   
Sbjct: 441 FIVRQEINRSGLYQEFWQAFAVLLPIRSVGVMGDHRTYAYPIVLRLVSSEDGMTADWSRA 500

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L +++ RIVNEV G+NRVVYDITSKPP TIEWE
Sbjct: 501 PYELLEKISNRIVNEVPGVNRVVYDITSKPPGTIEWE 537


>gi|302388936|ref|YP_003824757.1| GMP synthase (glutamine-hydrolyzing) [Thermosediminibacter oceani
           DSM 16646]
 gi|302199564|gb|ADL07134.1| GMP synthase (glutamine-hydrolyzing) [Thermosediminibacter oceani
           DSM 16646]
          Length = 511

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 263/512 (51%), Positives = 372/512 (72%), Gaps = 7/512 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
            V+++DFG Q++QLIARRVRE+ +YCE++ +   +D   ++ P+AI+ SG PAS    ++
Sbjct: 7   NVIVLDFGGQYSQLIARRVREASIYCEILPYNTPMDEILKRKPKAIVFSGGPASVYSENA 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P   K I ++ IP+LGICYG Q+MC  LGG+ + +++ E+GRA + +++   +  G+ EK
Sbjct: 67  PVCDKRIFDTGIPILGICYGMQLMCHMLGGRVEPAETAEYGRAELVVEEEDGIFSGL-EK 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
                VWMSHGD +  +PEGF  +A + +TP A I +  R  + VQFHPEVVHT  G ++
Sbjct: 126 --NLTVWMSHGDSIITLPEGFRTLARTKNTPHAAIGN-GRNLFGVQFHPEVVHTPRGREI 182

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           ++NF+  +AG    W M ++ +E +  I+E+VGN R +CA+SGGVDS+VAA + + A+G 
Sbjct: 183 LNNFLFGIAGCTGTWSMKTFVEEQIRLIRERVGNGRALCALSGGVDSSVAAVITHRALGD 242

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
           NLTC+ VDHG +RK+E   +I  FK   +  L  VDAS+RF+++L+ + DPE KR++IG+
Sbjct: 243 NLTCIFVDHGLLRKDEARKVIETFKDKFHINLIAVDASDRFLKRLEGVTDPEAKRRIIGE 302

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI VFE+EAKK+G   FL QGTLYPDVIES +     +++IK+HHNVGGLP+ ++ +L+
Sbjct: 303 EFIRVFEDEAKKLGKIDFLVQGTLYPDVIESGT---QTAAVIKTHHNVGGLPQDLNFELI 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR +G +L LP+  V R P PGPGLA+R +GE+T E+++ILRE+DAI  E
Sbjct: 360 EPLRDLFKDEVRKVGLQLGLPEEIVYRQPFPGPGLAVRVLGEVTREKLSILREADAIVTE 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAG+ R++WQAF VL  V++VGVMGDERTY Y  ++RAVTS DGMTAD+     + L
Sbjct: 420 EVKKAGLDRELWQAFAVLTDVKSVGVMGDERTYAYTVAIRAVTSEDGMTADWARLPYDLL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             ++ RIVNEV G+NRVVYDITSKPPATIEWE
Sbjct: 480 DNMSTRIVNEVPGVNRVVYDITSKPPATIEWE 511


>gi|325294272|ref|YP_004280786.1| GMP synthase (glutamine-hydrolyzing) [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064720|gb|ADY72727.1| GMP synthase (glutamine-hydrolyzing) [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 517

 Score =  561 bits (1447), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 282/523 (53%), Positives = 372/523 (71%), Gaps = 9/523 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K    SK+LI+DFGSQ+TQLIARR+RE  +YCE+  F  +++  KE  P+ IILSG P
Sbjct: 1   MVKDIHESKILILDFGSQYTQLIARRLREKHIYCEIHPFNISIEKIKEFKPKGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
           AS    DSP+I KEI E  +P+LGICYG Q++     G+   ++  E+GRA +EI  +  
Sbjct: 61  ASVYAPDSPKISKEIFELGVPVLGICYGMQLITYLFDGEVVRAERHEYGRAELEILDSSD 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   + EK     VWMSHGD+V  IP  FE IA +++ P+A I +++++ + VQFHPEV 
Sbjct: 121 LFAELPEKFV---VWMSHGDRVLRIPPTFEPIAKTENAPYAAIRNKEKRIFGVQFHPEVK 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           H+  G ++++NF   + G + +W M ++ +  + +I+E VG++ VICA+SGGVDS+V A 
Sbjct: 178 HSQYGDKVLENFAVKICGCEPSWTMENFIEYEIKKIREIVGDKNVICALSGGVDSSVVAA 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFK---GYPNFPLRVVDASERFIRKLKNIV 297
           L+++AIG  L  + VD G +RK E E++   F+      NF  R VDAS  F+ +LK + 
Sbjct: 238 LLHKAIGDQLYPIFVDTGLLRKGERESVEKTFREKFQMKNF--RTVDASSLFLERLKGVT 295

Query: 298 DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVG 357
           DPE KRK+IG  FIEVFE+ AK+I  A FL QGTLYPDVIES+S   GPS+ IKSHHNVG
Sbjct: 296 DPEKKRKIIGHTFIEVFEKAAKEIPNAHFLAQGTLYPDVIESVSV-KGPSATIKSHHNVG 354

Query: 358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN 417
           GLPE ++ KL+EPL+ELFKDEVR LGKEL LP+  ++R P PGPGLAIR +GE+  E I 
Sbjct: 355 GLPERLNFKLIEPLRELFKDEVRELGKELGLPEEIIKRQPFPGPGLAIRIVGEVKPEYIK 414

Query: 418 ILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMT 477
           ILRE+DAI  EEI KAG+Y KIWQ+F V LPVQTVGVMGD RTY+YV ++RAV S+DGMT
Sbjct: 415 ILREADAIVLEEIKKAGLYDKIWQSFAVFLPVQTVGVMGDVRTYDYVIAIRAVESVDGMT 474

Query: 478 ADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           AD+       L +++ RI+NEV+G+NRVVYDITSKPP TIEWE
Sbjct: 475 ADWVKLPYELLERISNRIINEVEGVNRVVYDITSKPPGTIEWE 517


>gi|315180967|gb|ADT87881.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio furnissii NCTC 11218]
          Length = 517

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVSGSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKNL---ETTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  LK   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLDALKGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 DKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|260771387|ref|ZP_05880312.1| GMP synthase [glutamine-hydrolyzing] [Vibrio furnissii CIP 102972]
 gi|260613513|gb|EEX38707.1| GMP synthase [glutamine-hydrolyzing] [Vibrio furnissii CIP 102972]
          Length = 517

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKNL---ETTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  LK   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLDALKGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 DKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|323499811|ref|ZP_08104770.1| GMP synthase [Vibrio sinaloensis DSM 21326]
 gi|323315052|gb|EGA68104.1| GMP synthase [Vibrio sinaloensis DSM 21326]
          Length = 517

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 368/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    S
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVSTSDEREFGYAAVQVSGESS 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IPEGF  +  +D+ P+A +A+E++KY+ VQFHPEV 
Sbjct: 121 IFKDL---EASQDVWMSHGDKVVEIPEGFVKVGETDTCPYAAMANEEKKYFGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK   A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKRANAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|254456598|ref|ZP_05070027.1| GMP synthetase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083600|gb|EDZ61026.1| GMP synthetase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 520

 Score =  561 bits (1445), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/512 (53%), Positives = 354/512 (69%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQFTQLIARRVRE  V+ E+++ K       +Q  + IILSG P +   ID 
Sbjct: 9   KILIVDFGSQFTQLIARRVRELGVFSEIVSHKKIKLKDIDQTIKGIILSGGPLNVYQIDK 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
               K+IL+ NIP+LGIC+G QI+ +  GGK K S+ REFG A I  K N  L    ++K
Sbjct: 69  YSFDKKILQLNIPILGICFGHQILSKLNGGKVKQSKHREFGLANIYKKNNSLLTSNFFKK 128

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            + ++VWMSH DQV  IP  F  +ASS ++ FA + D  +K+Y VQFHPEV HT  G ++
Sbjct: 129 SNTKKVWMSHADQVSKIPRNFRAVASSTNSKFAIVEDRIKKFYGVQFHPEVTHTENGKKI 188

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           I NFV  +  I+ NW       +++  ++ QVG+ +VICA+SGGVDS+V A L+ +AIG 
Sbjct: 189 ISNFVFLICKIKKNWSSKDQKLKLIKDVRSQVGSNKVICALSGGVDSSVVAQLLNKAIGK 248

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L C+ V+ G +RKNE   ++  FK      L  V+A + F++KL N+ DPE KRK+IG 
Sbjct: 249 KLFCIFVNTGLLRKNEEIQVVQTFKKRLKMNLIYVNAEKEFLKKLSNVSDPEKKRKIIGN 308

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           LFI++FE  AKKI   +FL QGTLYPD+IES S  G  +S IKSHHNVGGLP+ M +KLV
Sbjct: 309 LFIKIFERYAKKIKNVKFLAQGTLYPDLIESKSVTGSQTSKIKSHHNVGGLPKRMKLKLV 368

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPLK LFKDEVR LG EL L +  + RHP PGPGLAIR  G IT E+I IL+E+D  + +
Sbjct: 369 EPLKFLFKDEVRKLGLELNLNNEIISRHPFPGPGLAIRMPGVITNEKIKILKEADHYFIQ 428

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
            +   G+Y KIWQA+  LLPV+TVGVMGD RTYEY+C LRA+TS DGMTADFY    +F+
Sbjct: 429 ALRDHGLYHKIWQAYAALLPVKTVGVMGDNRTYEYLCLLRAITSEDGMTADFYEFKKSFM 488

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             ++ +IVN ++GINRVVYD+TSKPP+TIE E
Sbjct: 489 QIISNKIVNSIRGINRVVYDVTSKPPSTIELE 520


>gi|110802816|ref|YP_699536.1| GMP synthase [Clostridium perfringens SM101]
 gi|110683317|gb|ABG86687.1| GMP synthase [Clostridium perfringens SM101]
          Length = 509

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/511 (51%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  KE+NP+ II +G P S    ++P
Sbjct: 5   VLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + KEI   N+P+LGICYG Q+M   LGGK   +  RE+G+  + +  +  L  G+    
Sbjct: 65  TLDKEIFNLNVPILGICYGDQLMAHLLGGKVATAPVREYGKTNVTLDNSSKLFAGI---E 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           + +  WMSH D +   PEGF++IA +D  P A + +E+R+ Y VQFHPEV HT  G  ++
Sbjct: 122 ADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMM 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G++++W M+S+ +E ++ IK+ VG++++ICA+SGGVDS+VAA ++++A+G  
Sbjct: 182 RNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQ 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPETKRK+IG+ 
Sbjct: 242 LTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G  +FL QGT+YPDV+ES +     S++IKSHHNVGGLPE M+  L+E
Sbjct: 302 FIRVFEEEAGKLGDIKFLVQGTIYPDVVESGT---DTSAVIKSHHNVGGLPEDMEFSLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TE+++ ++RE+DAI+REE
Sbjct: 359 PLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  +IWQ F VL  +Q+VGVMGDERTY +   LRAVTS DGMT+++ H     + 
Sbjct: 419 IALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVID 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 479 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509


>gi|37678960|ref|NP_933569.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio vulnificus YJ016]
 gi|320157264|ref|YP_004189643.1| GMP synthase [Vibrio vulnificus MO6-24/O]
 gi|44887991|sp|Q7MNE1|GUAA_VIBVY RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|37197702|dbj|BAC93540.1| GMP synthase [Vibrio vulnificus YJ016]
 gi|319932576|gb|ADV87440.1| GMP synthase (glutamine-hydrolyzing) [Vibrio vulnificus MO6-24/O]
          Length = 517

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 270/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVSTSDEREFGYAAVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP GF  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EATQDVWMSHGDKVVEIPAGFTKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|268679235|ref|YP_003303666.1| GMP synthase, large subunit [Sulfurospirillum deleyianum DSM 6946]
 gi|268617266|gb|ACZ11631.1| GMP synthase, large subunit [Sulfurospirillum deleyianum DSM 6946]
          Length = 511

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/511 (52%), Positives = 362/511 (70%), Gaps = 5/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFGSQ+TQLIAR++RES VYCE++ +   ++  +++NP+ IILSG PAS    D+ 
Sbjct: 6   ILVLDFGSQYTQLIARKLRESGVYCEIVPYNEKIEDIQKRNPKGIILSGGPASVYAKDAY 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              +++ E  +P+LGICYG Q++ Q  GG    +  +E+G+A ++ + +  + K   +  
Sbjct: 66  HPDEKVYELGLPILGICYGMQLLTQHFGGSVIPATHQEYGKAELKFESDHKIFK---DTT 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q VWMSHGD+VE +P+GFE I  S+++P+A IADEKR  YA QFHPEV H+  G++L+
Sbjct: 123 CGQIVWMSHGDRVEALPQGFEKIGFSENSPYAAIADEKRNMYAFQFHPEVYHSEQGTKLL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF  H+ G +  W M S+ KE +++I+ QVG+++V+C VSGGVDS+V A L+ EAIG  
Sbjct: 183 KNFAKHICGCESTWNMGSFAKEQIAKIQAQVGDKKVLCGVSGGVDSSVVATLLAEAIGDK 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L  V VD+G +R NE   + ++FK     PL  VDASE+F+ +L  + DPE KRK+IG+ 
Sbjct: 243 LVSVFVDNGLLRANERAQVEAMFKSR-GVPLITVDASEKFLSRLAGVSDPEKKRKIIGET 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVF+EEAKK  G QFL QGTLY DVIES+S   GPS  IKSHHNVGGLP+ M  +L+E
Sbjct: 302 FIEVFDEEAKKHNGIQFLAQGTLYTDVIESVSV-KGPSKTIKSHHNVGGLPDWMSFELIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+E+FKDEVR LG EL LP   + RHP PGPGLAIR +GE+T++ + +LR +D I  EE
Sbjct: 361 PLREIFKDEVRTLGAELGLPRDMLNRHPFPGPGLAIRIMGEVTKDDLTLLRAADVIMLEE 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           +   G Y K WQAFTVLL V++VGVMGD RTY+    +R V + DGMTA F H     L 
Sbjct: 421 LRSTGYYEKTWQAFTVLLNVKSVGVMGDNRTYDNTICVRIVDATDGMTATFAHIPHTILE 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 481 NISRRIINEVSGINRVVYDISSKPPATIEWE 511


>gi|149194572|ref|ZP_01871668.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Caminibacter mediatlanticus TB-2]
 gi|149135316|gb|EDM23796.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Caminibacter mediatlanticus TB-2]
          Length = 511

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/512 (53%), Positives = 362/512 (70%), Gaps = 4/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VY E++ + + L   KE+ P+ II SG PAS  + D+
Sbjct: 4   EILILDFGSQYTQLIARRLREEGVYSEIVPYFDGLKAAKEKKPKGIIFSGGPASVYEKDA 63

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
            ++ KEI    +P+LGICYG Q++    GG+   +   E+G+A + I     L K +   
Sbjct: 64  YRVDKEIYNLGLPILGICYGMQLITVDFGGEVVRADHHEYGKAELFIDDEHKLFKNV--- 120

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            +   VWMSH D+VE +P+GF+ IA + + P+A I + +++ YA+QFHPEV H+V GS++
Sbjct: 121 SNPTIVWMSHSDRVEKLPDGFKRIAHTKNAPYAAIVNYEKEIYAIQFHPEVTHSVEGSKI 180

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF   V  +   W M+ + KE + +IKE+VG+ +VICA+SGGVDS+V A L++EAIG 
Sbjct: 181 LRNFAREVCNVTTKWDMAHFAKEQIKKIKEEVGDNKVICALSGGVDSSVTAALLHEAIGD 240

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L  + VD G +RKNE E +   FK   + PL  VDA ++F+ +LK + DPE KRK+IG 
Sbjct: 241 KLIPIFVDTGLLRKNEREEVEHAFKNVLHVPLITVDAKDKFLSRLKGVTDPEEKRKIIGH 300

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIEVF+EEAKK   A+FL QGTLYPDVIES+S   GPS  IKSHHNVGGLPE M  +L+
Sbjct: 301 TFIEVFDEEAKKHKDAKFLAQGTLYPDVIESVS-VKGPSKTIKSHHNVGGLPEWMKFELI 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG EL LP   V RHP PGPGLAIR +GE+ E+ + ILRE+DAI  +
Sbjct: 360 EPLRELFKDEVRKLGLELGLPKDLVYRHPFPGPGLAIRIMGEVNEKDLEILREADAILIQ 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+   G+Y K+WQAF VLL V++VGVMGD RTY+   ++R V+S DGMTA F H    FL
Sbjct: 420 ELKAWGLYDKVWQAFAVLLNVKSVGVMGDNRTYDNTVAIRCVSSTDGMTATFSHLPHEFL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 480 ERVSTRIINEVDGINRVVYDISSKPPATIEWE 511


>gi|27363886|ref|NP_759414.1| GMP synthase [Vibrio vulnificus CMCP6]
 gi|31340140|sp|Q8DF07|GUAA_VIBVU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|27360003|gb|AAO08941.1| GMP synthase (glutamine-hydrolyzing) [Vibrio vulnificus CMCP6]
          Length = 517

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVSTSDEREFGYAAVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP GF  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EATQDVWMSHGDKVVEIPAGFTKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  + G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGICGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|15640787|ref|NP_230417.1| GMP synthase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121585763|ref|ZP_01675558.1| GMP synthase [Vibrio cholerae 2740-80]
 gi|121726010|ref|ZP_01679309.1| GMP synthase [Vibrio cholerae V52]
 gi|147675501|ref|YP_001216253.1| GMP synthase [Vibrio cholerae O395]
 gi|153817288|ref|ZP_01969955.1| GMP synthase [Vibrio cholerae NCTC 8457]
 gi|153821377|ref|ZP_01974044.1| GMP synthase [Vibrio cholerae B33]
 gi|227080947|ref|YP_002809498.1| GMP synthase [Vibrio cholerae M66-2]
 gi|229505618|ref|ZP_04395128.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae BX 330286]
 gi|229510710|ref|ZP_04400189.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae B33]
 gi|229517832|ref|ZP_04407276.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae RC9]
 gi|229608636|ref|YP_002879284.1| GMP synthase [Vibrio cholerae MJ-1236]
 gi|254847905|ref|ZP_05237255.1| GMP synthase [Vibrio cholerae MO10]
 gi|255744574|ref|ZP_05418525.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholera CIRS 101]
 gi|262161291|ref|ZP_06030402.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae INDRE 91/1]
 gi|262168784|ref|ZP_06036479.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae RC27]
 gi|13627138|sp|Q9KTW2|GUAA_VIBCH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|226739762|sp|A5F3F1|GUAA_VIBC3 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|254800124|sp|C3LT21|GUAA_VIBCM RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|9655215|gb|AAF93933.1| GMP synthase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121550126|gb|EAX60142.1| GMP synthase [Vibrio cholerae 2740-80]
 gi|121631492|gb|EAX63862.1| GMP synthase [Vibrio cholerae V52]
 gi|126512204|gb|EAZ74798.1| GMP synthase [Vibrio cholerae NCTC 8457]
 gi|126521087|gb|EAZ78310.1| GMP synthase [Vibrio cholerae B33]
 gi|146317384|gb|ABQ21923.1| GMP synthase [Vibrio cholerae O395]
 gi|227008835|gb|ACP05047.1| GMP synthase [Vibrio cholerae M66-2]
 gi|227012592|gb|ACP08802.1| GMP synthase [Vibrio cholerae O395]
 gi|229344547|gb|EEO09521.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae RC9]
 gi|229350675|gb|EEO15616.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae B33]
 gi|229357841|gb|EEO22758.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae BX 330286]
 gi|229371291|gb|ACQ61714.1| GMP synthase (glutamine-hydrolyzing) [Vibrio cholerae MJ-1236]
 gi|254843610|gb|EET22024.1| GMP synthase [Vibrio cholerae MO10]
 gi|255737605|gb|EET92999.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholera CIRS 101]
 gi|262022902|gb|EEY41608.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae RC27]
 gi|262029041|gb|EEY47694.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae INDRE 91/1]
          Length = 517

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A ++I    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKISGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---DLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE E ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|119713382|gb|ABL97445.1| GMP synthetase [uncultured marine bacterium EB80_69G07]
          Length = 520

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/513 (52%), Positives = 357/513 (69%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           +K+LIIDFGSQFTQLIARR+RES VY E+I+ K   +   + + + IILSG P +   I+
Sbjct: 8   NKILIIDFGSQFTQLIARRIRESGVYSEIISHKKVKNKNIDNSIKGIILSGGPLNVYQIN 67

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
                K I+E+ IP+LGIC+G QI+ +  GG+ K S+ REFG A I  K+   L K  + 
Sbjct: 68  KYSFDKRIIENQIPVLGICFGHQILSKLNGGRVKQSKYREFGLANIRKKRESILTKNFFN 127

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           K +  +VWMSH DQV  +P+ F VIASS ++ FA I ++K+ +Y VQFHPEV HT  G +
Sbjct: 128 KKNINKVWMSHADQVSKLPKNFNVIASSQNSKFAIIENKKKNFYGVQFHPEVTHTENGKK 187

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           LI+NF+  +  I+ NW       +++  ++  VG  +VICA+SGGVDS+V A L+ +AIG
Sbjct: 188 LINNFIFLICKIKRNWSSKDQKIKLIKDVQNLVGKNKVICALSGGVDSSVVAQLLNKAIG 247

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ V+ G +RKNE   ++  FK      L  V+A   F+RKL N+ DPE KRK+IG
Sbjct: 248 KKLFCIFVNTGLLRKNEEIQVVKTFKKKLKINLIYVNAENEFLRKLNNVSDPEKKRKIIG 307

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
            LFI++FE  AK+I   +FL QGTLYPD+IES S  G  +S IKSHHNVGGLP+ M +KL
Sbjct: 308 NLFIKIFERYAKRIKNVKFLAQGTLYPDLIESKSVTGSQTSKIKSHHNVGGLPKKMKLKL 367

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           VEPLK LFKDEVR LG EL+L    + RHP PGPGLAIR  G IT+E+I IL+E+D  + 
Sbjct: 368 VEPLKFLFKDEVRKLGLELKLSKEIISRHPFPGPGLAIRMPGIITKEKIKILKEADNYFI 427

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           + + +  +Y KIWQA+  LLPV+TVGVMGD RTYEY+C LRA+TS DGMTADFY    +F
Sbjct: 428 QALREHNLYNKIWQAYAALLPVKTVGVMGDNRTYEYLCLLRAITSEDGMTADFYDFKKSF 487

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +  ++ +IVN ++G+NRVVYD+TSKPP+TIE E
Sbjct: 488 IQMISNKIVNSIRGVNRVVYDVTSKPPSTIELE 520


>gi|28211997|ref|NP_782941.1| GMP synthase [Clostridium tetani E88]
 gi|44887955|sp|Q891G7|GUAA_CLOTE RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|28204440|gb|AAO36878.1| GMP synthase (glutamine-hydrolyzing) [Clostridium tetani E88]
          Length = 510

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 371/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V IIDFG Q++QLIARRVRE+ VYCE+I +  +++  KE+NP+ II SG P S    +SP
Sbjct: 6   VFIIDFGGQYSQLIARRVRENNVYCEIIPYSTSIEKIKEKNPKGIIFSGGPNSVYGENSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I KEI E ++P+LGICYGQQ+    LGGK ++++ RE+G+  + +   C+L +G+    
Sbjct: 66  RISKEIFEIDVPVLGICYGQQLASFILGGKVESAKVREYGKTAVNLDNKCALFEGI---D 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q+ WMSH D V  IP GF ++A +D    A +A+E +K Y VQFHPEV HT  G +++
Sbjct: 123 KVQECWMSHTDYVSEIPSGFNIVAYTDGCKVAAMANEDKKIYGVQFHPEVEHTPFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ ++  ++ +W ++S+ +E +  I+E VG+++VICA+SGGVDS+VAA ++++AIG  
Sbjct: 183 KNFLFNICELKGDWSVTSFAEEKIKEIRELVGDKKVICALSGGVDSSVAAVIVHKAIGDQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + + S+FK      L  V+A +RF+ KLK + +PE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVESIFKEKFQMNLIRVNAQDRFLGKLKGVTEPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   +L QGT+YPDV+ES +     S+ IKSHHNVGGLPE ++ +L+E
Sbjct: 303 FIRVFEEEANKLGKIDYLVQGTIYPDVVESGT---DTSATIKSHHNVGGLPEDIEFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGL IR +GE+TEE++ I+RE+DAI+REE
Sbjct: 360 PLRELFKDEVRRVGEELGIPHKLVWRQPFPGPGLGIRVLGEVTEEKLEIVREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +++VGVMGDERTY +   LRAV S DGMT+D+       L 
Sbjct: 420 IANAGLDEKIWQYFACLPNIRSVGVMGDERTYSHTIGLRAVNSSDGMTSDWAKIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+IRIVNEVKG+NR+VYDITSKPP+TIEWE
Sbjct: 480 KVSIRIVNEVKGVNRIVYDITSKPPSTIEWE 510


>gi|182625513|ref|ZP_02953284.1| GMP synthase [Clostridium perfringens D str. JGS1721]
 gi|177909201|gb|EDT71666.1| GMP synthase [Clostridium perfringens D str. JGS1721]
          Length = 509

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/511 (51%), Positives = 372/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  KE+NP+ II +G P S    ++P
Sbjct: 5   VLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + KEI   N+P+LGICYG Q+M   LGGK   +  RE+G+  + +  +  L  G+    
Sbjct: 65  TLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDTAPVREYGKTNVTLDNSSKLFAGI---E 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           + +  WMSH D +   PEGF++IA +D  P A + +E+R+ Y VQFHPEV HT  G  ++
Sbjct: 122 ADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMM 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G++++W M+S+ +E ++ IK  VG++++ICA+SGGVDS+VAA ++++A+G  
Sbjct: 182 RNFLYNICGLENSWSMASFAEEKIAEIKNIVGDKKLICALSGGVDSSVAAVMVHKAVGKQ 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPETKRK+IG+ 
Sbjct: 242 LTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G  +FL QGT+YPDV+ES +     S++IKSHHNVGGLPE M+  L+E
Sbjct: 302 FIRVFEEEAGKLGDIKFLVQGTIYPDVVESGT---DTSAVIKSHHNVGGLPEDMEFSLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TE+++ ++RE+DAI+REE
Sbjct: 359 PLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  +IWQ F VL  +Q+VGVMGDERTY +   LRAVTS DGMT+++ H     + 
Sbjct: 419 IALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVID 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 479 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509


>gi|297587726|ref|ZP_06946370.1| GMP synthase (glutamine-hydrolyzing) [Finegoldia magna ATCC 53516]
 gi|297574415|gb|EFH93135.1| GMP synthase (glutamine-hydrolyzing) [Finegoldia magna ATCC 53516]
          Length = 510

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 277/512 (54%), Positives = 368/512 (71%), Gaps = 8/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVR+  VYCEV+ +K ALD  KE+ P  II +G P S  + +SP
Sbjct: 6   VIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           QI KEI E NIP+LG+CYG Q++ +  GG  + +++REFG+   +I    ++LKGM ++ 
Sbjct: 66  QIDKEIFELNIPVLGMCYGMQLISKDFGGVVEKAKNREFGKTNAKISNQSTILKGMSDES 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               VWMSH D V   PEGF++I ++DS P A IA+E +K +AVQ+HPEV HTV G  LI
Sbjct: 126 I---VWMSHTDFVSQKPEGFDIIQTTDSCPVAAIANEDKKIFAVQYHPEVNHTVEGKTLI 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ +     +W M ++ +E + +I++ VG+++V+ A+SGGVDS+V A L+  AIG N
Sbjct: 183 KNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLALSGGVDSSVCASLLSRAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MRKNE + + + FK      +RV DA +RF+ KLK I DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLMRKNEGDEVEAAFKNDELNFVRV-DAKDRFLDKLKGISDPEQKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFE+EAKKIG   FL QGT+YPDVIES     G +S+IKSHHNVGGLP+ +D K L+
Sbjct: 302 FIRVFEDEAKKIGSVDFLAQGTIYPDVIESGQ---GDASVIKSHHNVGGLPDVVDFKDLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG EL +P+  V R P PGPGL IR +GEITEE++ +LRE+D I+R+
Sbjct: 359 EPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMGEITEEKLEVLREADFIFRD 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAGI + I Q F V+   +TVGVMGD RTY+Y  +LRAVT+ D MTAD+       L
Sbjct: 419 EVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALRAVTTTDFMTADWARIPYEVL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + ++RI+NEV  INR+VYDITSKPPATIEWE
Sbjct: 479 DKTSVRIINEVDHINRIVYDITSKPPATIEWE 510


>gi|18311257|ref|NP_563191.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Clostridium perfringens str. 13]
 gi|110800712|ref|YP_696947.1| GMP synthase [Clostridium perfringens ATCC 13124]
 gi|168205103|ref|ZP_02631108.1| GMP synthase [Clostridium perfringens E str. JGS1987]
 gi|168211656|ref|ZP_02637281.1| GMP synthase [Clostridium perfringens B str. ATCC 3626]
 gi|168213184|ref|ZP_02638809.1| GMP synthase [Clostridium perfringens CPE str. F4969]
 gi|168216761|ref|ZP_02642386.1| GMP synthase [Clostridium perfringens NCTC 8239]
 gi|24211752|sp|Q8XI46|GUAA_CLOPE RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|18145940|dbj|BAB81981.1| GMP synthetase [Clostridium perfringens str. 13]
 gi|110675359|gb|ABG84346.1| GMP synthase [Clostridium perfringens ATCC 13124]
 gi|170663325|gb|EDT16008.1| GMP synthase [Clostridium perfringens E str. JGS1987]
 gi|170710386|gb|EDT22568.1| GMP synthase [Clostridium perfringens B str. ATCC 3626]
 gi|170715290|gb|EDT27472.1| GMP synthase [Clostridium perfringens CPE str. F4969]
 gi|182381223|gb|EDT78702.1| GMP synthase [Clostridium perfringens NCTC 8239]
          Length = 509

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/511 (51%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  KE+NP+ II +G P S    ++P
Sbjct: 5   VLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKEKNPKGIIFTGGPNSVYGENTP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + KEI   N+P+LGICYG Q+M   LGGK   +  RE+G+  + +  +  L  G+    
Sbjct: 65  TLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDTAPVREYGKTNVTLDNSSKLFAGI---E 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           + +  WMSH D +   PEGF++IA +D  P A + +E+R+ Y VQFHPEV HT  G  ++
Sbjct: 122 ADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMM 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G++++W M+S+ +E ++ IK+ VG++++ICA+SGGVDS+VAA ++++A+G  
Sbjct: 182 RNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQ 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPETKRK+IG+ 
Sbjct: 242 LTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G  +FL QGT+YPDV+ES +     S++IKSHHNVGGLPE M+  L+E
Sbjct: 302 FIRVFEEEAGKLGDIKFLVQGTIYPDVVESGT---DTSAVIKSHHNVGGLPEDMEFSLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TE+++ ++RE+DAI+REE
Sbjct: 359 PLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  +IWQ F VL  +Q+VGVMGDERTY +   LRAVTS DGMT+++ H     + 
Sbjct: 419 IALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVID 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 479 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509


>gi|169347058|ref|ZP_02866000.1| GMP synthase [Clostridium perfringens C str. JGS1495]
 gi|169296741|gb|EDS78870.1| GMP synthase [Clostridium perfringens C str. JGS1495]
          Length = 509

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/511 (51%), Positives = 373/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +  +++  KE+NP+ II +G P S    ++P
Sbjct: 5   VLVVDFGGQYNQLIARRVRECGVYCEIIPYTYSIEKIKERNPKGIIFTGGPNSVYGENTP 64

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + KEI   N+P+LGICYG Q+M   LGGK   +  RE+G+  + +  +  L  G+    
Sbjct: 65  TLDKEIFNLNVPVLGICYGDQLMAHLLGGKVDTAPVREYGKTNVTLDNSSKLFAGI---E 121

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           + +  WMSH D +   PEGF++IA +D  P A + +E+R+ Y VQFHPEV HT  G  ++
Sbjct: 122 ADETCWMSHTDYIAEAPEGFKIIAHTDVCPVAAMENEERRLYGVQFHPEVEHTPFGQNMM 181

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G++++W M+S+ +E ++ IK+ VG++++ICA+SGGVDS+VAA ++++A+G  
Sbjct: 182 RNFLYNICGLENSWSMASFAEEKIAEIKKIVGDKKLICALSGGVDSSVAAVMVHKAVGKQ 241

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPETKRK+IG+ 
Sbjct: 242 LTCIFVDHGLLRKDEGDQVEKIFKEGFDMNLIRVNAQDRFLGKLKGVSDPETKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G  +FL QGT+YPDV+ES +     S++IKSHHNVGGLPE M+  L+E
Sbjct: 302 FIRVFEEEAGKLGDIKFLVQGTIYPDVVESGT---DTSAVIKSHHNVGGLPEDMEFSLIE 358

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TE+++ ++RE+DAI+REE
Sbjct: 359 PLRELFKDEVRAVGEELGIPHHLVWRQPFPGPGLAIRVLGEVTEDKLEVVREADAIFREE 418

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  +IWQ F VL  +Q+VGVMGDERTY +   LRAVTS DGMT+++ H     + 
Sbjct: 419 IALAGLESEIWQYFAVLPNIQSVGVMGDERTYCHTVGLRAVTSSDGMTSNWAHIPYEVID 478

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 479 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 509


>gi|323143708|ref|ZP_08078378.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain
           [Succinatimonas hippei YIT 12066]
 gi|322416511|gb|EFY07175.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain
           [Succinatimonas hippei YIT 12066]
          Length = 522

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/518 (52%), Positives = 365/518 (70%), Gaps = 7/518 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           S K+LI+DFGSQ TQLIARRVRE  VYCE++ +   L + +E  PQ IILSG P S+ + 
Sbjct: 8   SEKILILDFGSQVTQLIARRVREIGVYCEIMPWDADLKHMQEFAPQGIILSGGPESTTEE 67

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+ P  + E+ +P+LGICYG Q M   LGGK + S  REFG A +EIK  C L  G+ 
Sbjct: 68  GSPRAPAWVFEAGVPVLGICYGLQTMAVQLGGKVEGSNLREFGYAAVEIKSECPLFDGLT 127

Query: 127 EKGSKQQ--VWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +   K +  VWMSHGD+V  IPEGFEV+ S+D+ P+A + D+KR ++ VQFHPEV HT  
Sbjct: 128 DHEGKHELDVWMSHGDKVTAIPEGFEVVGSTDTCPYAAVYDKKRNFFGVQFHPEVTHTKQ 187

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G + +  FV  V  +   W   +   + V+RI+ +VG+ +V+  +SGGVDS+V A L+++
Sbjct: 188 GGEFLRRFVIEVCKLNALWSPMAIIDDAVARIRREVGDAKVLLGLSGGVDSSVTALLLHK 247

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV--DASERFIRKLKNIVDPETK 302
           AIG  LTCV VD+G +R NE + +  +F    +  L +V  DASERF+  LK I DPE K
Sbjct: 248 AIGDKLTCVFVDNGLLRLNEGQQVKDMFA---DMGLNIVYADASERFLSALKGISDPEAK 304

Query: 303 RKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           RK IG  FI+VF +EA+K+ G  FL QGT+YPDVIES +   G + +IKSHHNVGGLP+ 
Sbjct: 305 RKAIGHTFIDVFADEARKLEGVDFLAQGTIYPDVIESAAAKTGKAHVIKSHHNVGGLPDD 364

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           +  KLVEPL+ELFKDEVR +G +L LP+  V+RHP PGPGL +R +GE+  E +++LR++
Sbjct: 365 LKFKLVEPLRELFKDEVRRIGVKLGLPEKMVQRHPFPGPGLGVRVLGEVKREYLDLLRQA 424

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           DAI+ EE++ +G Y+K+ QAFTV LPV++VGVMGD R Y+YV +LRAV +ID MTA +  
Sbjct: 425 DAIFMEELNNSGWYQKVSQAFTVFLPVRSVGVMGDGRRYDYVVALRAVKTIDFMTAKWAE 484

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + L +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 485 LPYDLLGRVSNRIINEVNGISRVVYDVSGKPPATIEWE 522


>gi|28897391|ref|NP_796996.1| GMP synthase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838554|ref|ZP_01991221.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ3810]
 gi|153839137|ref|ZP_01991804.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ3810]
 gi|260876350|ref|ZP_05888705.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AN-5034]
 gi|260898621|ref|ZP_05907117.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           Peru-466]
 gi|260899279|ref|ZP_05907674.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ4037]
 gi|31340118|sp|Q87S07|GUAA_VIBPA RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|28805603|dbj|BAC58880.1| GMP synthase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747349|gb|EDM58323.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ3810]
 gi|149748069|gb|EDM58928.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ3810]
 gi|308086960|gb|EFO36655.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           Peru-466]
 gi|308093061|gb|EFO42756.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AN-5034]
 gi|308106591|gb|EFO44131.1| GMP synthase (glutamine-hydrolyzing) [Vibrio parahaemolyticus
           AQ4037]
 gi|328472587|gb|EGF43450.1| GMP synthase [Vibrio parahaemolyticus 10329]
          Length = 517

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 368/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSNEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  LK   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLEALKGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV+GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517


>gi|237739593|ref|ZP_04570074.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 2_1_31]
 gi|229423201|gb|EEO38248.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 2_1_31]
          Length = 512

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 275/517 (53%), Positives = 369/517 (71%), Gaps = 8/517 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIIILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYT 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI--KKNCSLLK 123
             +P +  ++ E NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  K NC L K
Sbjct: 62  EGAPSLDIKLFEQNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKDNC-LYK 120

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +    +K  VWMSHGD V  +   F++IA +DS+  A I ++ +  YA Q+HPEV H+ 
Sbjct: 121 NI---PNKTTVWMSHGDHVTEMAPNFKIIAHTDSS-IAAIENKDKNIYAFQYHPEVTHSQ 176

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++ NFV  +A  + NW M +Y +  V +IKE VGN++VI  +SGGVDS+VAA LI 
Sbjct: 177 HGFDMLKNFVFGIAKAEQNWSMENYIESTVKQIKETVGNKQVILGLSGGVDSSVAAALIN 236

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +AIG  LTC+ VD G +RK+E + ++ ++    N  ++ V+A ERF+ KL  + DPETKR
Sbjct: 237 KAIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFNMNIKCVNAEERFLSKLAGVTDPETKR 296

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE +
Sbjct: 297 KIIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDL 355

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+D
Sbjct: 356 KFELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREAD 415

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H 
Sbjct: 416 AIFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHL 475

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 476 PYDFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|258514039|ref|YP_003190261.1| GMP synthase [Desulfotomaculum acetoxidans DSM 771]
 gi|257777744|gb|ACV61638.1| GMP synthase, large subunit [Desulfotomaculum acetoxidans DSM 771]
          Length = 510

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 357/511 (69%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLI+DFG Q+TQLIARR+RE KVYCE++ F   L+      P+ I+ SG P+S     +P
Sbjct: 6   VLILDFGGQYTQLIARRIRECKVYCEILPFSTPLEKITAGKPKGIVFSGGPSSVYSDRAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               ++ E  IP+LGICYG Q+M   LGGK   ++ RE+G++ I +     LL G+ +  
Sbjct: 66  SADPKLYELGIPVLGICYGMQLMAHQLGGKVSPARQREYGKSVINVLSKDELLTGLEDA- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             +  WMSHGD VE  P GF V A +   P A +++  +K YAVQFHPEVVHT  G  ++
Sbjct: 125 --EPCWMSHGDLVESPPPGFGVSACTSLAPVAAMSNRAQKLYAVQFHPEVVHTPKGMDIL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G   +W M S+ +  V+ + + VGN +V+CA+SGGVDS+VAA L++ AIG  
Sbjct: 183 KNFLYNICGCHASWTMESFLETEVAEVHKTVGNRQVLCALSGGVDSSVAAVLVHRAIGDQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK E E +IS F+   +  L  VDA ERF+ +L+ + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLLRKGEAEQVISTFRDKFHINLIAVDAEERFLSRLQGVTDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   +L QGTLYPDV+ES +     +++IKSHHNVGGLPE M +KL+E
Sbjct: 303 FIRVFEEEAAKLGQIDYLVQGTLYPDVVESGT---ATAAVIKSHHNVGGLPEDMKLKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR+LG+EL +P+  V R P PGPGLAIR +GEIT++++ +LRE+DAI  +E
Sbjct: 360 PLRWLFKDEVRVLGEELGIPEEVVWRQPFPGPGLAIRILGEITKDKLEVLREADAIVLDE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+YR IWQAF VL  +++VGVMGDERTY Y   LRAV S DGMTAD+       L 
Sbjct: 420 IKKAGLYRSIWQAFAVLPQMKSVGVMGDERTYAYTAVLRAVQSNDGMTADWVRLPYEVLE 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++ RIVNE+K INRVVYDITSKPP TIEWE
Sbjct: 480 SISSRIVNELKEINRVVYDITSKPPGTIEWE 510


>gi|169824011|ref|YP_001691622.1| GMP synthase [Finegoldia magna ATCC 29328]
 gi|254800099|sp|B0S0S7|GUAA_FINM2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|167830816|dbj|BAG07732.1| GMP synthase [Finegoldia magna ATCC 29328]
          Length = 510

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/512 (53%), Positives = 367/512 (71%), Gaps = 8/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVR+  VYCEV+ +K ALD  KE+ P  II +G P S  + +SP
Sbjct: 6   VIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           QI KEI E NIP+LG+CYG Q++ +  GG  + +++REFG+   +I    S+LKGM    
Sbjct: 66  QIEKEIFELNIPILGMCYGMQLISKDFGGVVEKAKNREFGKTNAKISNQSSILKGM---S 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSH D V   PEGF++I ++DS P A IA+E +K +AVQ+HPEV HTV G  LI
Sbjct: 123 DESIVWMSHTDFVSEKPEGFDIIQTTDSCPVAAIANEDKKIFAVQYHPEVNHTVEGKTLI 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ +     +W M ++ +E + +I++ VG+++V+ A+SGGVDS+V A L+  AIG N
Sbjct: 183 KNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLALSGGVDSSVCAALLSRAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MRKNE + + + FK      +RV +A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLMRKNEGDEVEAAFKNDELNFVRV-NAKDRFLNKLKGVSDPEQKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFE+EAKKIG   FL QGT+YPDVIES     G +S+IKSHHNVGGLP+ +D K L+
Sbjct: 302 FIRVFEDEAKKIGSVDFLAQGTIYPDVIESGQ---GDASVIKSHHNVGGLPDVVDFKDLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG EL +P+  V R P PGPGL IR +GEITEE++ +LRE+D I+R+
Sbjct: 359 EPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMGEITEEKLEVLREADFIFRD 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAGI + I Q F V+   +TVGVMGD RTY+Y  +LRAVT+ D MTAD+       L
Sbjct: 419 EVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALRAVTTTDFMTADWARIPYEVL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + ++RI+NEV  INR+VYDITSKPPATIEWE
Sbjct: 479 DKTSVRIINEVDHINRIVYDITSKPPATIEWE 510


>gi|327398195|ref|YP_004339064.1| GMP synthase [Hippea maritima DSM 10411]
 gi|327180824|gb|AEA33005.1| GMP synthase (glutamine-hydrolyzing) [Hippea maritima DSM 10411]
          Length = 506

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/513 (53%), Positives = 369/513 (71%), Gaps = 8/513 (1%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
            K++I+DFGSQ+TQLIAR++RE  VY E+I F    D   + + + IILSGSP+S  + D
Sbjct: 2   DKIVILDFGSQYTQLIARKIRELGVYAEIIPFNKDFD---KVDVKGIILSGSPSSIYEND 58

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P   KEI   N+P+LGICYG Q++    GG    +Q RE+G A +++ K   L+     
Sbjct: 59  APLPKKEIFNLNLPILGICYGMQVVANRFGGVIAKAQKREYGLAKLKLLKENPLID---R 115

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           +     VWMSHGD++E +PEGFE +A +D++PFA I +  ++ +AVQFHPEV H+  G +
Sbjct: 116 EIDNTIVWMSHGDRLESLPEGFEAVAKTDNSPFAAIQNLNKRIWAVQFHPEVYHSQKGKR 175

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           L+ NFV  +   + NW M ++  + + +IK+ V ++RVI AVSGGVDS+V A L+ +AIG
Sbjct: 176 LLSNFVFEICNAKANWNMGNFLTQQIEKIKQTVKDKRVIGAVSGGVDSSVVAVLMNKAIG 235

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
                V V+ G +RKNE E +++LFK   N  +R  DASE F+ +LK I DPE KRK+IG
Sbjct: 236 DRFVGVFVNTGLLRKNEPEYVLNLFKKL-NVNIRYEDASELFLERLKGIEDPEKKRKIIG 294

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
             FI+VF + AK+   A+FL QGTLYPD+IES+S   GPS+ IKSHHNVGGLP+ ++ KL
Sbjct: 295 HTFIDVFAKIAKEYNNAEFLAQGTLYPDIIESVSV-KGPSATIKSHHNVGGLPKDLNFKL 353

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR LG++L + + F+ RHP PGPGLAIR IG+IT+ER+ ILRE+DAI  
Sbjct: 354 IEPLRELFKDEVRQLGRQLGIDEEFINRHPFPGPGLAIRIIGKITKERLKILREADAILI 413

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EEI KA IY  IWQAF VLLPV +VGVMGD+RTYE V ++RAV S+DGMTA+F   D   
Sbjct: 414 EEIKKANIYNDIWQAFAVLLPVSSVGVMGDKRTYENVLAIRAVDSVDGMTANFSKIDYEL 473

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L +++ RI+NEV+GINRVVYDI+SKPPATIEWE
Sbjct: 474 LGKISSRIINEVEGINRVVYDISSKPPATIEWE 506


>gi|153217375|ref|ZP_01951126.1| GMP synthase [Vibrio cholerae 1587]
 gi|153800595|ref|ZP_01955181.1| GMP synthase [Vibrio cholerae MZO-3]
 gi|153824618|ref|ZP_01977285.1| GMP synthase [Vibrio cholerae MZO-2]
 gi|153828256|ref|ZP_01980923.1| GMP synthase [Vibrio cholerae 623-39]
 gi|229523410|ref|ZP_04412817.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae TM 11079-80]
 gi|229530102|ref|ZP_04419492.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae 12129(1)]
 gi|254225031|ref|ZP_04918645.1| GMP synthase [Vibrio cholerae V51]
 gi|254285486|ref|ZP_04960450.1| GMP synthase [Vibrio cholerae AM-19226]
 gi|262192491|ref|ZP_06050642.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae CT 5369-93]
 gi|124113606|gb|EAY32426.1| GMP synthase [Vibrio cholerae 1587]
 gi|124123884|gb|EAY42627.1| GMP synthase [Vibrio cholerae MZO-3]
 gi|125622418|gb|EAZ50738.1| GMP synthase [Vibrio cholerae V51]
 gi|148876210|gb|EDL74345.1| GMP synthase [Vibrio cholerae 623-39]
 gi|149741836|gb|EDM55865.1| GMP synthase [Vibrio cholerae MZO-2]
 gi|150424348|gb|EDN16285.1| GMP synthase [Vibrio cholerae AM-19226]
 gi|229333876|gb|EEN99362.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae 12129(1)]
 gi|229339773|gb|EEO04788.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae TM 11079-80]
 gi|262031650|gb|EEY50237.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae CT 5369-93]
 gi|327483551|gb|AEA77958.1| GMP synthase (glutamine-hydrolyzing) [Vibrio cholerae LMA3894-4]
          Length = 517

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A ++I    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKISGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---DLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE E ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|284048040|ref|YP_003398379.1| GMP synthase, large subunit [Acidaminococcus fermentans DSM 20731]
 gi|283952261|gb|ADB47064.1| GMP synthase, large subunit [Acidaminococcus fermentans DSM 20731]
          Length = 514

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 366/511 (71%), Gaps = 5/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG+Q++QLIARRVRE  VYCE+I +   LD  K +NP+AIILSG P S    ++P
Sbjct: 9   VLVVDFGAQYSQLIARRVRECGVYCEIIPYNYTLDKIKAKNPKAIILSGGPNSVYAENTP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + + I E  IP+LGICYG Q M ++LGG   ++ S E+G+  + +     L  G+ EK 
Sbjct: 69  SVDEGIFEMGIPVLGICYGDQFMTKALGGVVAHAGSGEYGKTAVVLDNETRLFSGL-EKN 127

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +    WMSH D  E  PEGF VIA+++  P A + +E++K Y VQFHPEV+HT  G Q+ 
Sbjct: 128 N--VCWMSHQDYAEKAPEGFSVIATTEECPIAAMQNEEKKLYGVQFHPEVMHTPFGKQMF 185

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ ++  +  +W MSS+ +  +  I+E+VG++ V+CA+SGGVDS+VAA L+++A+G  
Sbjct: 186 SNFLFNICNLSGDWTMSSFAQNKIREIREKVGDKNVLCAMSGGVDSSVAAVLVHKAVGKQ 245

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 246 LTCVFVDHGLLRKDEGDQVEQVFKRDFDMNLIRVNAQDRFLSKLKGVSDPEKKRKIIGEE 305

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEE+KKIG   FL QGT+YPDV+ES     G S+ IKSHHNVGGLP+ M + L+E
Sbjct: 306 FIRVFEEESKKIGHVDFLVQGTIYPDVVESGG--TGTSATIKSHHNVGGLPKDMKLGLIE 363

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE+++I+RE+DAI+REE
Sbjct: 364 PLRELFKDEVRAVGEELGIPSELVWRQPFPGPGLAIRVLGEVTEEKLHIVREADAIFREE 423

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R IWQ F  L  +++VGVMGD RTY    +LRAV S DGMT+D+ H   + L 
Sbjct: 424 IAKAGLDRSIWQYFACLPNIRSVGVMGDFRTYSNTIALRAVNSTDGMTSDWSHIPYHVLD 483

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            V+ RIVNEV G+NRVVYDITSKPPATIEWE
Sbjct: 484 IVSRRIVNEVPGVNRVVYDITSKPPATIEWE 514


>gi|86608644|ref|YP_477406.1| GMP synthase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557186|gb|ABD02143.1| GMP synthase, glutamine-hydrolyzing [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 536

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/518 (51%), Positives = 367/518 (70%), Gaps = 10/518 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE+ VY E+++++   +  ++  PQ IILSG P S  +  +P
Sbjct: 22  IVILDFGSQYSELIARRIRETHVYSEILSYRTTAEQLRQLQPQGIILSGGPNSVYEPAAP 81

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGGK + +Q  E+GRA + I     LL  + E  
Sbjct: 82  VCDPEIWNLGIPVLGVCYGMQLMVQQLGGKVEAAQKGEYGRAALHILDPTDLLTNLPENS 141

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               +WMSHGD V  +P GF  +AS+D+TP A IAD +R+ Y VQFHPEV H+  G+ LI
Sbjct: 142 I---MWMSHGDSVTELPPGFHTLASTDNTPCAAIADPRRRLYGVQFHPEVAHSEAGAFLI 198

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+ G +  W  +++ +E +  ++ +VGN++V+ A+SGGVDS+  AFL+++AIG  
Sbjct: 199 RNFVYHICGCEPTWTTAAFLEEAIREVRARVGNKKVLLALSGGVDSSTLAFLLHKAIGDQ 258

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV +D GFMRK+E + ++ LF+   + P+  VD  ERF+R+L+ + DPE KRK IG  
Sbjct: 259 LTCVFIDQGFMRKDEPQRLLRLFQEQFHIPVHYVDGQERFLRQLQGVTDPEEKRKRIGAE 318

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE++++G  ++L QGTLYPDVIES +    P +       IKSHHNVGGLPE++
Sbjct: 319 FIRVFEEESQRLGPFEYLAQGTLYPDVIESANTHVDPVTGERIAVKIKSHHNVGGLPENL 378

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR L + L LP+  V RHP PGPGLAIR +GE+T+ER+  LRE+D
Sbjct: 379 RFKLVEPLRKLFKDEVRQLARSLGLPEEIVGRHPFPGPGLAIRIVGEVTKERLETLREAD 438

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLP-VQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
            I R+EI+++G Y K+WQAF VLLP V++VGVMGD+RTY     +R VTS DGMTAD+  
Sbjct: 439 MIVRQEINRSGYYPKLWQAFAVLLPEVRSVGVMGDKRTYACPVVVRLVTSEDGMTADWAR 498

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + L+ ++ RIVNEV GINRVVYDITSKPP TIEWE
Sbjct: 499 VPYDLLATISNRIVNEVPGINRVVYDITSKPPGTIEWE 536


>gi|229525412|ref|ZP_04414817.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae bv. albensis
           VL426]
 gi|229338993|gb|EEO04010.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae bv. albensis
           VL426]
          Length = 517

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A ++I    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKISGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---DLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE E ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGNRLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|229513093|ref|ZP_04402559.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae TMA 21]
 gi|229349986|gb|EEO14940.1| GMP synthase [glutamine-hydrolyzing] [Vibrio cholerae TMA 21]
          Length = 517

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A ++I    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKISGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---DLTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE E ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGSKLTCVFVDNGLLRLNEGEQVMEMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|91762215|ref|ZP_01264180.1| GMP synthetase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718017|gb|EAS84667.1| GMP synthetase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 521

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/514 (52%), Positives = 358/514 (69%), Gaps = 1/514 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDI 66
           SK+LIIDFGSQFTQLIARRVRE  V+ E+++ K   +    + N   IILSG P +  + 
Sbjct: 8   SKILIIDFGSQFTQLIARRVRELGVFSEIVSHKKIKIAQITKDNIAGIILSGGPLNVYEN 67

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D  +  K+IL+  IP+LGIC+G QI+ + LGGK K S+ REFG A I    N +L K  +
Sbjct: 68  DKFKFDKKILKLGIPILGICFGHQILSKLLGGKVKKSKHREFGLATINKVSNSTLTKNFF 127

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            K ++  VWMSH DQV  +P+ F++IAS+ ++    I + K  +Y VQFHPEV HT  G 
Sbjct: 128 NKNNRSDVWMSHADQVSKMPKNFKIIASTKNSKLTIIENIKENFYGVQFHPEVTHTNKGK 187

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            L+ NFV  +  I+ NW       ++++ IKEQVG+ +VIC +SGGVDS+V A L+ +AI
Sbjct: 188 ILLRNFVFLICKIKKNWSSKDQKLKLINEIKEQVGDNKVICGLSGGVDSSVVAQLLSKAI 247

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NLTC+ V++G +RKNE   +++ FK      L  V+A + FIRKL N+ DPE KRK+I
Sbjct: 248 GKNLTCIFVNNGLLRKNEEIQVVNTFKKKLKINLIYVNAEKEFIRKLTNVSDPEKKRKII 307

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFI++FE  A +I   +FL QGTLYPD+IES S  G  +S IKSHHNVGGLP+ M +K
Sbjct: 308 GNLFIKIFERYANRIKNVKFLAQGTLYPDLIESKSVTGSQTSKIKSHHNVGGLPKRMKLK 367

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPLK LFKDEVR LG EL L +  + RHP PGPGLAIR  G IT E+I IL+E+D  +
Sbjct: 368 LVEPLKFLFKDEVRKLGLELNLSNDIISRHPFPGPGLAIRMPGIITNEKIKILKEADFYF 427

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            + + + G+Y KIWQA+  LLPV+TVGVMGD RTYE++C LRA+TS DGMTADF+     
Sbjct: 428 IKALREHGLYDKIWQAYAALLPVKTVGVMGDNRTYEHICLLRAITSEDGMTADFFDFPKG 487

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           F+  ++ +I+N ++GINRVVYD+TSKPP+TIE E
Sbjct: 488 FMQSISNQIINNIRGINRVVYDVTSKPPSTIELE 521


>gi|258627197|ref|ZP_05721985.1| GMP synthase/glutamine amidotransferase protein [Vibrio mimicus
           VM603]
 gi|258580499|gb|EEW05460.1| GMP synthase/glutamine amidotransferase protein [Vibrio mimicus
           VM603]
          Length = 517

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 364/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|255526450|ref|ZP_05393361.1| GMP synthase, large subunit [Clostridium carboxidivorans P7]
 gi|296184824|ref|ZP_06853235.1| GMP synthase (glutamine-hydrolyzing) [Clostridium carboxidivorans
           P7]
 gi|255509832|gb|EET86161.1| GMP synthase, large subunit [Clostridium carboxidivorans P7]
 gi|296050606|gb|EFG90029.1| GMP synthase (glutamine-hydrolyzing) [Clostridium carboxidivorans
           P7]
          Length = 510

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/511 (52%), Positives = 363/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ Q IARRVRE+ VYCE+I +   +D  KE+NP+ II +G P S     +P
Sbjct: 6   VLVVDFGGQYNQTIARRVRENNVYCEIIPYTYTIDKIKEKNPKGIIFTGGPNSVYGEGAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I KEI    +P+LGICYG+Q++  +LGGK ++   RE+G+A +++    +L  GM E+ 
Sbjct: 66  RIDKEIFNLGVPVLGICYGEQLIAYTLGGKVESPDVREYGKANVKLNSKSALFDGMDEE- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q  WMSH D V H PEGF VIA++   P A + + ++K Y VQFHPEV HT  G ++ 
Sbjct: 125 --QSCWMSHTDYVSHAPEGFNVIATTSQCPVAAMENTEKKIYGVQFHPEVEHTPFGKKMF 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  V  ++ +W M+S+ ++ +  IKE+VG+++VICA+SGGVDS+VAA L++ AIG  
Sbjct: 183 SNFLFKVCNLKGDWSMTSFAEDQIKAIKEKVGDKKVICALSGGVDSSVAAVLVHRAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + + ++FK   +  L  V+A +RF+ KL  + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDQVETIFKKQFDMNLIRVNAKDRFLGKLAGVSDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M  KL+E
Sbjct: 303 FIRVFEEEANKLGEISFLVQGTIYPDVVESGT---NTSATIKSHHNVGGLPEDMQFKLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  +Q+VGVMGDERTY +  +LRAVTS D MT+++       L 
Sbjct: 420 IANAGLDEKIWQYFACLPNIQSVGVMGDERTYCHTIALRAVTSSDAMTSEWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            V+ RIVNEV G+NR+VYD+TSKPPATIEWE
Sbjct: 480 IVSRRIVNEVHGVNRIVYDVTSKPPATIEWE 510


>gi|261212132|ref|ZP_05926418.1| GMP synthase [glutamine-hydrolyzing] [Vibrio sp. RC341]
 gi|260838740|gb|EEX65391.1| GMP synthase [glutamine-hydrolyzing] [Vibrio sp. RC341]
          Length = 517

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTQNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|150015222|ref|YP_001307476.1| GMP synthase [Clostridium beijerinckii NCIMB 8052]
 gi|259647752|sp|A6LQ90|GUAA_CLOB8 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|149901687|gb|ABR32520.1| GMP synthase, large subunit [Clostridium beijerinckii NCIMB 8052]
          Length = 510

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 369/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE  VYCE+I +   ++  K +NP+ II +G P S    D+P
Sbjct: 6   VLVVDFGGQYNQLIARRVRECGVYCEIIPYDYTIEKIKAKNPKGIIFTGGPNSVYGEDTP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + KE+ E  +P+LGICYG Q+M   LGGK   +  RE+G+  +++ K+  L +G+   G
Sbjct: 66  TVEKEVFELGVPVLGICYGDQLMAHLLGGKVATAPVREYGKTNVKVDKSSKLFEGIETDG 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
                WMSH D +E  P+GF+VIA+++  P A + +E+++ Y VQFH EV HT  G +++
Sbjct: 126 I---AWMSHTDYIEEAPKGFKVIATTEVCPVAAMENEEKRLYGVQFHAEVEHTQFGQKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF+H++ G++++W M S+ +E +  IKE VG+++V+CA+SGGVDS+VAA ++++AIG N
Sbjct: 183 ENFIHNICGLENSWSMGSFAEEKIKEIKELVGDKKVLCALSGGVDSSVAAMIVHKAIGHN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK+E + +  +FK   +  ++ V+ ++RF+ KL  + DPETKRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKDEGDTVERVFKKEFDMNIKRVNVADRFLGKLAGVSDPETKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEAKK+G   +L QGT+YPD++ES +     S+ IKSHHNVGGLPE M  +L+E
Sbjct: 303 FIRVFEEEAKKVGQIDYLVQGTIYPDIVESGT---KTSATIKSHHNVGGLPEDMQFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGLAIR +GEITEE++ I+RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLAIRVLGEITEEKLEIVREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  A +   IWQ F  L  +++VGVMGDERTY +  +LRAVTS D MT+++       L 
Sbjct: 420 IANANLDESIWQYFACLPNIRSVGVMGDERTYSHTIALRAVTSSDAMTSEWARIPYEILD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            V+ RIVNEVKG+NR+VYDITSKPPATIEWE
Sbjct: 480 LVSRRIVNEVKGVNRIVYDITSKPPATIEWE 510


>gi|153833546|ref|ZP_01986213.1| GMP synthase (glutamine-hydrolyzing) [Vibrio harveyi HY01]
 gi|156973390|ref|YP_001444297.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio harveyi ATCC BAA-1116]
 gi|226739764|sp|A7MU26|GUAA_VIBHB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|148870197|gb|EDL69138.1| GMP synthase (glutamine-hydrolyzing) [Vibrio harveyi HY01]
 gi|156524984|gb|ABU70070.1| hypothetical protein VIBHAR_01077 [Vibrio harveyi ATCC BAA-1116]
          Length = 517

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA +RF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEDRFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|16331412|ref|NP_442140.1| GMP synthase [Synechocystis sp. PCC 6803]
 gi|1346218|sp|P49057|GUAA_SYNY3 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|1001583|dbj|BAA10210.1| GMP synthetase [Synechocystis sp. PCC 6803]
          Length = 542

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/523 (50%), Positives = 369/523 (70%), Gaps = 9/523 (1%)

Query: 4   RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASS 63
           R +   ++I+DFGSQ+++LIARR+RE++VY EV++++      +E  P+ IILSG P S 
Sbjct: 23  RLKGQIIVILDFGSQYSELIARRIRETEVYSEVLSYRTTAQQLREIKPKGIILSGGPNSV 82

Query: 64  LDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK 123
            D  +P+   EI +  +P+LG+CYG Q+M + LGG+ + ++  E+G+A + I     LL 
Sbjct: 83  YDQGAPECDPEIFQLGVPVLGVCYGMQLMVKQLGGRVERAKRGEYGKASLHIDDPTDLLT 142

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +    +   +WMSHGD    +P GFE++A +D+TP A IAD ++  + VQFHPEVVH+V
Sbjct: 143 NVENDST---MWMSHGDSCVDLPTGFEILAHTDNTPCAAIADHQKALFGVQFHPEVVHSV 199

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
           GG  LI NFV+H+   +  W  +++ +E +  ++ QVG+ RV+ A+SGGVDS+  AFL++
Sbjct: 200 GGIALIRNFVYHICHCEPTWTTAAFIEESIREVRSQVGDRRVLLALSGGVDSSTLAFLLH 259

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTC+ +D GFMRK E E ++ LF    + P++ V+A +RF+++L+ + DPE KR
Sbjct: 260 RAIGDNLTCMFIDQGFMRKGEPERLVELFDHQFHIPVQYVNARDRFLKQLEGVTDPEEKR 319

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVG 357
           ++IG  FI+VFEEE+ ++G   +L QGTLYPDVIES      P +       IKSHHNVG
Sbjct: 320 RLIGHEFIQVFEEESNRLGPFDYLAQGTLYPDVIESADSNVDPKTGERVAVKIKSHHNVG 379

Query: 358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN 417
           GLP+++  KLVEPL++LFKDEVR LG+ + LP+  V RHP PGPGLAIR IGE+T ER+N
Sbjct: 380 GLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLN 439

Query: 418 ILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMT 477
           ILR++D I R+EI K GIY   WQAF VLLP+++VGVMGD+RTY +   LR +TS DGMT
Sbjct: 440 ILRDADFIVRDEISKRGIYHDYWQAFAVLLPIRSVGVMGDKRTYAHPVVLRFITSEDGMT 499

Query: 478 ADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           AD+     + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 500 ADWARVPYDILEAISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542


>gi|51891639|ref|YP_074330.1| GMP synthase [Symbiobacterium thermophilum IAM 14863]
 gi|81389576|sp|Q67S57|GUAA_SYMTH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|51855328|dbj|BAD39486.1| GMP synthetase [Symbiobacterium thermophilum IAM 14863]
          Length = 513

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/512 (51%), Positives = 361/512 (70%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q++ LIARRVRE++VYCE+  F   +  ++E   + II SG PAS    D+P
Sbjct: 8   IVVVDFGGQYSHLIARRVREAQVYCEIWPFTAPVQRYREAGVKGIIFSGGPASVEQADAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKGMWEK 128
           +I   I E  IP+LGICYG Q+M   LGG+ +  Q  E+GRA + +      LL+G+   
Sbjct: 68  RIDPAIYELGIPILGICYGMQLMALQLGGEVRRGQQGEYGRATLRLADAEHPLLRGL--- 124

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G +  VWMSH D V  +P GF V+ ++++T  A + D+ R+ Y VQFHPEVVHT  G ++
Sbjct: 125 GRESLVWMSHFDSVTRVPSGFRVLGATENTAVAVMGDDARRLYGVQFHPEVVHTAQGREI 184

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NF+ ++AG + +W   S+    V  I+ QVG+ RV+CA+SGGVDS+VAA L+++A+G 
Sbjct: 185 LRNFLFNIAGCRGDWTTESFITRQVEEIRRQVGSGRVLCALSGGVDSSVAAVLVHKAVGD 244

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VDHG MRK E E ++  F+ + +  L  VDASERF+ KL+ + DPE KRK+IG 
Sbjct: 245 QLTCIFVDHGLMRKGEPEQVVRTFRDHFHIHLVHVDASERFLSKLRGVTDPEQKRKIIGN 304

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI +FE+EA+K+G   FL QGT+YPDVIES +     + +IKSHHNVGGLPE M  +L+
Sbjct: 305 EFIRLFEDEARKLGQIDFLVQGTVYPDVIESGT---ETARVIKSHHNVGGLPEDMRFQLI 361

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EP ++LFKDEVR +G+ L +P+  V RHP PGPGL +R +GE+T E++ ILRE+D I+ E
Sbjct: 362 EPFRQLFKDEVRAVGRALGVPEEIVGRHPFPGPGLGVRVLGEVTPEKLEILREADRIFVE 421

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y ++WQAFTVL  V++VGVMGDERTY Y   LRAVTS D MTADFY    + L
Sbjct: 422 EIRKAGLYDELWQAFTVLPDVRSVGVMGDERTYAYPVVLRAVTSEDAMTADFYRLPWDLL 481

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++A RIVNEV  +NRVVYD+TSKPP TIEWE
Sbjct: 482 ERIASRIVNEVPHVNRVVYDVTSKPPGTIEWE 513


>gi|294783350|ref|ZP_06748674.1| GMP synthase [Fusobacterium sp. 1_1_41FAA]
 gi|294480228|gb|EFG28005.1| GMP synthase [Fusobacterium sp. 1_1_41FAA]
          Length = 512

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/517 (52%), Positives = 369/517 (71%), Gaps = 8/517 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIIILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYT 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI--KKNCSLLK 123
             +P +  ++ E NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  K NC L K
Sbjct: 62  EGAPSLDIKLFEQNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNNC-LYK 120

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +    +K  VWMSHGD V  +   F++IA +DS+  A I ++ +  YA Q+HPEV H+ 
Sbjct: 121 NI---PNKTTVWMSHGDHVTEMAPNFKIIAHTDSS-IAAIENKDKNIYAFQYHPEVTHSQ 176

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++ NFV  +A  + NW M +Y +  V +IKE VGN++VI  +SGGVDS+VAA LI 
Sbjct: 177 HGFDMLKNFVFGIAKAEQNWSMENYIESTVKQIKETVGNKQVILGLSGGVDSSVAAALIN 236

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +AIG  LTC+ VD G +RK+E + ++ ++    +  ++ V+A ERF+ KL  + DPETKR
Sbjct: 237 KAIGRQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCVNAEERFLSKLAGVTDPETKR 296

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE +
Sbjct: 297 KIIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDL 355

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+D
Sbjct: 356 KFELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREAD 415

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H 
Sbjct: 416 AIFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHL 475

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 476 PYDFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|300864149|ref|ZP_07109043.1| GMP synthase [Oscillatoria sp. PCC 6506]
 gi|300337839|emb|CBN54189.1| GMP synthase [Oscillatoria sp. PCC 6506]
          Length = 537

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 367/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++   +     NP+ IILSG P+S  D  +P
Sbjct: 24  LVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLATLNPKGIILSGGPSSVYDEGAP 83

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M + LGGK + ++  E+G+A + I     LL  + E G
Sbjct: 84  HCDPEIWNLGIPVLGVCYGMQLMVKQLGGKVERAKRAEYGKASLSINDPTDLLTNV-EDG 142

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD    +P GFEV+A +D+TP A IA+  +K Y VQFHPEVVH++GG  LI
Sbjct: 143 AT--MWMSHGDSCVELPAGFEVLAHTDNTPSAAIANYDKKLYGVQFHPEVVHSIGGLALI 200

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 201 RNFVYHICDCEPTWTTEAFVEESIREIRARVGDKRVLLALSGGVDSSTLAFLLHKAIGAQ 260

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF    +  ++ V+A +RF+ K+  + DPE KRK IG  
Sbjct: 261 LTCMFIDQGFMRKYEPERLVKLFHEQFHIDVQYVNARDRFLAKIAGVTDPEVKRKHIGHE 320

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 321 FIQVFEEESKRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 380

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KL+EPL++LFKDEVR LG+ + LP+  V RHP PGPGLAIR +GE+T ER+NILR++D
Sbjct: 381 RFKLIEPLRKLFKDEVRKLGRSIGLPEEIVNRHPFPGPGLAIRILGEVTAERLNILRDAD 440

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI++ G+Y ++WQAF VLLPV++VGVMGD+RTY Y   LR V S DGMTAD+   
Sbjct: 441 FIVRQEINRQGMYSELWQAFAVLLPVRSVGVMGDQRTYAYPIVLRLVKSEDGMTADWARV 500

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL  V+ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 501 PYDFLETVSNRIVNEVKGVNRVVYDITSKPPGTIEWE 537


>gi|269962400|ref|ZP_06176750.1| GMP synthase/glutamine amidotransferase protein [Vibrio harveyi
           1DA3]
 gi|269832896|gb|EEZ87005.1| GMP synthase/glutamine amidotransferase protein [Vibrio harveyi
           1DA3]
          Length = 517

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA +RF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEDRFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|302343799|ref|YP_003808328.1| GMP synthase, large subunit [Desulfarculus baarsii DSM 2075]
 gi|301640412|gb|ADK85734.1| GMP synthase, large subunit [Desulfarculus baarsii DSM 2075]
          Length = 517

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/514 (51%), Positives = 364/514 (70%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ TQLIARRVRE++VYCE+      L+  K  NP+ +ILSG PAS   +
Sbjct: 6   AEKILILDFGSQTTQLIARRVREARVYCEIHPCTMPLERVKAFNPRGVILSGGPASVYAV 65

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P++   + E   P+LGICYG QI+   LGG     + RE+G A + +++   L  G  
Sbjct: 66  DAPKVDPGVFELGAPVLGICYGMQIITHLLGGVVARGEKREYGPAKLSLRQAIGLF-GEL 124

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           ++     VWMSHGD++E +P GF+V+A+S+++P A + D  R+ Y VQFHPEV HT  G+
Sbjct: 125 DQAQPVPVWMSHGDRIEQLPPGFQVLATSENSPVAAMGDPARRIYGVQFHPEVAHTPQGA 184

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ +FV      Q  W M ++ +  ++  K ++G ++V+CA+SGGVDS+V A L+++AI
Sbjct: 185 TMLASFVLGECRCQPIWTMHNFAEATIADFKARLGGKKVLCALSGGVDSSVVALLLHKAI 244

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G +L C+ VD+G +R  EV  + ++F+      L V  A+E F+ +L  +VDPE KR++I
Sbjct: 245 GPDLHCIFVDNGLLRAGEVNEVSNVFREVFGVNLVVAKAAELFLSRLAGVVDPEQKRRII 304

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FIEVFE EAKKIG   +L QGTLYPDVIES+SF G PS++IKSHHNVGGLPEHM M+
Sbjct: 305 GHTFIEVFEAEAKKIGKVDYLAQGTLYPDVIESVSFRG-PSAVIKSHHNVGGLPEHMKME 363

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDE R +G+EL LP++ V R P PGPGLAIR +GE++  ++  LR++D I 
Sbjct: 364 LVEPLRELFKDECREVGRELGLPETIVGRQPFPGPGLAIRIMGEVSGPKLATLRQADGIV 423

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EE+  AG+Y K+WQ+F VL+PV+TVGVMGDERTYE V +LR V S+D MTAD+      
Sbjct: 424 LEEMRAAGLYDKVWQSFAVLVPVKTVGVMGDERTYEDVIALRVVDSVDAMTADWTRVPYQ 483

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L+ ++ RI+NEV G+NRVV DI+SKPPATIEWE
Sbjct: 484 VLATISSRIINEVAGVNRVVLDISSKPPATIEWE 517


>gi|262172162|ref|ZP_06039840.1| GMP synthase [glutamine-hydrolyzing] [Vibrio mimicus MB-451]
 gi|261893238|gb|EEY39224.1| GMP synthase [glutamine-hydrolyzing] [Vibrio mimicus MB-451]
          Length = 517

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 363/520 (69%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L  I +PE
Sbjct: 238 LVHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALDGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|262196644|ref|YP_003267853.1| GMP synthase, large subunit [Haliangium ochraceum DSM 14365]
 gi|262079991|gb|ACY15960.1| GMP synthase, large subunit [Haliangium ochraceum DSM 14365]
          Length = 525

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/512 (52%), Positives = 369/512 (72%), Gaps = 3/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VLI+DFGSQ+TQLIARRVRE  VY E+  ++  LD  +  +P AI+LSG P+S     +P
Sbjct: 16  VLILDFGSQYTQLIARRVREHGVYSEIHPYRMPLDEIRAMDPVAIVLSGGPSSCYAEGAP 75

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + +E+     P+LGICYG Q+  + LGG  + +   E+GRA + + +   L   + +  
Sbjct: 76  SVSEELFALGKPILGICYGAQLTAKLLGGTVEPADKHEYGRAAVRVSEEGGLFANL-KAA 134

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   VWMSHGD+V  +P GF++I  SD++P A  AD +RK + VQFHPEV HT  G +++
Sbjct: 135 APLHVWMSHGDRVTALPPGFQLIGDSDNSPSAAFADLERKIFCVQFHPEVAHTPRGMEIL 194

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEAIGI 248
            NF+  V G   +W MSS+ +E  + ++ +VG++ RVICA+SGGVDS+V A L+++AIG 
Sbjct: 195 GNFLFRVVGCVGDWSMSSFAEEAAAAVRAEVGDDGRVICALSGGVDSSVVAALLHKAIGD 254

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTC+ VD+G +R  E E + S+F+ +    L V+DA +RF+ +L +I DPE KRK+IG+
Sbjct: 255 RLTCIFVDNGLLRAGERETVASVFRDHFRIDLHVIDAEQRFLDRLADITDPEHKRKLIGR 314

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI VFEEE++ I  A +L QGTLYPDVIES+SF  GPS++IKSHHNVGGLPE M +KL+
Sbjct: 315 EFIAVFEEESQHIENAAYLAQGTLYPDVIESVSF-KGPSAVIKSHHNVGGLPERMKLKLI 373

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR+LG EL LP   + R P PGPGLA+RC+G +T  R++ LR++DAI  E
Sbjct: 374 EPLRELFKDEVRVLGAELGLPRHILMRQPFPGPGLAVRCLGALTAPRLSSLRQADAIIEE 433

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+  AG+Y +IWQ+F VLLPV++VGVMGD RTYE   ++RAV S+DGMTAD+     + L
Sbjct: 434 EVRAAGLYEQIWQSFGVLLPVRSVGVMGDMRTYEEALAVRAVHSLDGMTADWVQLPYDLL 493

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++V+ R++NEV+GINRVVYDITSKPP TIEWE
Sbjct: 494 ARVSTRVINEVRGINRVVYDITSKPPGTIEWE 525


>gi|219667493|ref|YP_002457928.1| GMP synthase [Desulfitobacterium hafniense DCB-2]
 gi|219537753|gb|ACL19492.1| GMP synthase, large subunit [Desulfitobacterium hafniense DCB-2]
          Length = 510

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/511 (52%), Positives = 358/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE+ VY E+I++K  ++  K +NP+ II SG PAS     +P
Sbjct: 6   VLVLDFGGQYNQLIARRVREAHVYSEMISYKTPVEEIKARNPKGIIFSGGPASVNQEGAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ + I E  IP+ GICYG Q+M   LGGK  + + RE+G+A + + +   L KG+   G
Sbjct: 66  KVDEAIYELGIPIFGICYGMQLMTVQLGGKVMHPEVREYGKAMLHVDQAKGLWKGL---G 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            ++Q WMSHGD V  +PEGF + A +D TP A + DE R +Y VQFHPEV HT  G  ++
Sbjct: 123 GERQCWMSHGDSVTELPEGFVIAAHTDHTPVAAMMDETRHFYGVQFHPEVKHTPDGQAML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            +F+  + G    W M S+    V  I+E+VG+ +V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 183 KHFLFDICGCHGEWTMESFIDAQVKAIREKVGDRQVLCALSGGVDSSVAAVLVHKAIGDQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHGFMRKNE E +  +F    +  L  VDA ERF+ K+  + DPETKR  IG  
Sbjct: 243 LTCVFVDHGFMRKNEPEQVKKIFTEQFHLKLIFVDARERFMAKIGGVSDPETKRIGIGNE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI +FE+EA+K+G   FL QGTLYPD++ES +     +  IKSHHNVGGLPE M  +L+E
Sbjct: 303 FIRLFEDEARKLGQIDFLVQGTLYPDIVESGT---DTAETIKSHHNVGGLPEDMQFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL  LFKDEVR +G EL +PD  V R P PGPGLAIR IGE+TEE+++ILRE+DA+  EE
Sbjct: 360 PLDMLFKDEVREVGAELGIPDEIVWRQPFPGPGLAIRIIGEVTEEKLDILREADAVIVEE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y+++WQ+F VL  +++VGVMGD RTY Y   +RAVTS D MTAD+     + + 
Sbjct: 420 IRNAGLYKEVWQSFAVLPTIKSVGVMGDGRTYAYPIVVRAVTSEDAMTADWARLPYDLME 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 480 KISTRIVNEVKGVNRVVYDITSKPPGTIEWE 510


>gi|158337547|ref|YP_001518722.1| GMP synthase [Acaryochloris marina MBIC11017]
 gi|158307788|gb|ABW29405.1| GMP synthase [Acaryochloris marina MBIC11017]
          Length = 541

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 367/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++ +++  ++ NP+ IILSG P S     +P
Sbjct: 28  IVILDFGSQYSELIARRIRETQVYSEVLSYRTSIEQLRQLNPKGIILSGGPNSVYAQHAP 87

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGG+ + S + E+G+A + I     LL  + ++ 
Sbjct: 88  ACDPEIWNLGIPVLGVCYGMQLMVQQLGGQVEASDAAEYGKASLIIDDPTDLLTNVEDQT 147

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD V  +PEGF+V+A + +TP A +A   R+ Y VQFHPEVVH+ GG  LI
Sbjct: 148 T---MWMSHGDSVTALPEGFKVLAHTANTPQAAVAHHDRQLYGVQFHPEVVHSQGGQALI 204

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  ++ +VGN+RV+ A+SGGVDS+  AFL+++AIG N
Sbjct: 205 CNFVYHICECEPTWTTEAFVEEAIREVRAKVGNKRVLLALSGGVDSSTLAFLLHKAIGDN 264

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E +I LF+   + P+  V A +RF+ +L  I DPE KRK IG  
Sbjct: 265 LTCMFIDQGFMRKLEPERLIKLFRDQFHIPVEYVMARDRFLERLNGITDPEEKRKRIGHE 324

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE++++G   +L QGTLYPDVIES      P++       IKSHHNVGGLP+ +
Sbjct: 325 FIQVFEEESRRLGPFDYLAQGTLYPDVIESADTNVDPATGERVAVKIKSHHNVGGLPKDL 384

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ L LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 385 RFKLVEPLRKLFKDEVRKVGRSLGLPEEIVNRHPFPGPGLAIRIIGEVTAERLNILRDAD 444

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+E++++G Y + WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 445 LIVRQEVNRSGNYSEFWQAFAVLLPVRSVGVMGDQRTYAYPVVLRFVSSEDGMTADWSRA 504

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L  ++ RIVNEVKG+NRV YDITSKPP TIEWE
Sbjct: 505 PYELLETISNRIVNEVKGVNRVAYDITSKPPGTIEWE 541


>gi|262402847|ref|ZP_06079408.1| GMP synthase [glutamine-hydrolyzing] [Vibrio sp. RC586]
 gi|262351629|gb|EEZ00762.1| GMP synthase [glutamine-hydrolyzing] [Vibrio sp. RC586]
          Length = 517

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTQNGLQMLENFVLGVCGCECLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|89896684|ref|YP_520171.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Desulfitobacterium hafniense Y51]
 gi|89336132|dbj|BAE85727.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 510

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/511 (52%), Positives = 357/511 (69%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE+ VY E+I++K  ++  K +NP+ II SG PAS     +P
Sbjct: 6   VLVLDFGGQYNQLIARRVREAHVYSEMISYKTPVEEIKARNPKGIIFSGGPASVNQEGAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ + I E  IP+ GICYG Q+M   LGGK  + + RE+G+A + + +   L KG+   G
Sbjct: 66  KVDEAIYELGIPIFGICYGMQLMTVQLGGKVMHPEVREYGKAMLHVDQAKGLWKGL---G 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            ++Q WMSHGD V  +PEGF + A +D TP A + DE R +Y VQFHPEV HT  G  ++
Sbjct: 123 GERQCWMSHGDSVTELPEGFVIAAHTDHTPVAAMTDETRHFYGVQFHPEVKHTPDGQAML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            +F+  + G    W M S+    V  I+E+VG  +V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 183 KHFLFDICGCHGEWTMESFIDAQVKAIREKVGERQVLCALSGGVDSSVAAVLVHKAIGDQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHGFMRKNE E +  +F    +  L  VDA ERF+ K+  + DPETKR  IG  
Sbjct: 243 LTCVFVDHGFMRKNEPEQVKKIFTEQFHLKLIFVDARERFMAKIGGVSDPETKRIGIGNE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI +FE+EA+K+G   FL QGTLYPD++ES +     +  IKSHHNVGGLPE M  +L+E
Sbjct: 303 FIRLFEDEARKLGQIDFLVQGTLYPDIVESGT---DTAETIKSHHNVGGLPEDMQFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL  LFKDEVR +G EL +PD  V R P PGPGLAIR IGE+TEE+++ILRE+DA+  EE
Sbjct: 360 PLDMLFKDEVREVGAELGIPDEIVWRQPFPGPGLAIRIIGEVTEEKLDILREADAVIVEE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+Y+++WQ+F VL  +++VGVMGD RTY Y   +RAVTS D MTAD+     + + 
Sbjct: 420 IRNAGLYKEVWQSFAVLPTIKSVGVMGDGRTYAYPIVVRAVTSEDAMTADWARLPYDLME 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 480 KISTRIVNEVKGVNRVVYDITSKPPGTIEWE 510


>gi|148980239|ref|ZP_01815947.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrionales bacterium SWAT-3]
 gi|145961333|gb|EDK26642.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrionales bacterium SWAT-3]
          Length = 517

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/520 (51%), Positives = 368/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRIREIGVYCELWSWDVDEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ GICYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   +    S Q VWMSHGD+V  IP  F  IA +D+ P+A +A+E++KY+ VQFHPEV 
Sbjct: 121 LFADL---ESTQDVWMSHGDKVVEIPADFTKIAETDTCPYAAMANEEKKYFGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G ++++NFV +V G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLKMLENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L + AIG  LTCV VD+G +R NE + ++ +F       +  VDA +RF++ L+   +PE
Sbjct: 238 LAHRAIGDKLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIIKVDAEDRFLKALEGEAEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKIIGHVFVDIFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|258619965|ref|ZP_05715005.1| GMP synthase/glutamine amidotransferase protein [Vibrio mimicus
           VM573]
 gi|258587698|gb|EEW12407.1| GMP synthase/glutamine amidotransferase protein [Vibrio mimicus
           VM573]
          Length = 517

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 363/520 (69%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEANSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSDEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKIGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G    W   S  ++ V+RIKEQVGN+ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLQMLENFVLGVCGCDRLWTSESIIEDAVARIKEQVGNDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF++ L+ I +PE
Sbjct: 238 LVHRAIGDRLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLKALEGIDEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG++F+EVF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKTIGRVFVEVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMKMGLVEPLRELFKDEVRKIGLELGLPYEMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|260776623|ref|ZP_05885518.1| GMP synthase [glutamine-hydrolyzing] [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607846|gb|EEX34111.1| GMP synthase [glutamine-hydrolyzing] [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 517

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/520 (51%), Positives = 366/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKQGKQMLENFVLGVCGCEGLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGNKLTCVFVDNGLLRLNEGQQVMDMFGDQFGLNIIKVDAEERFLAALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|86606329|ref|YP_475092.1| GMP synthase [Synechococcus sp. JA-3-3Ab]
 gi|86554871|gb|ABC99829.1| GMP synthase, glutamine-hydrolyzing [Synechococcus sp. JA-3-3Ab]
          Length = 538

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/518 (51%), Positives = 366/518 (70%), Gaps = 10/518 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE+ VY E+++++   +  ++  PQ IILSG P S  +  +P
Sbjct: 24  IVILDFGSQYSELIARRIRETHVYSEILSYRTTAEQLRQLRPQGIILSGGPNSVYEPGAP 83

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGGK + +Q  E+GRA + I     LL  + E  
Sbjct: 84  ACDLEIWNLGIPILGVCYGMQLMVQQLGGKVEPAQKGEYGRAALHILDPTDLLTNLPESS 143

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               +WMSHGD V  +P GF  +A +D+TPFA IAD  R+ Y VQFHPEV H+  G+ LI
Sbjct: 144 I---MWMSHGDSVTELPPGFHSLAYTDNTPFAAIADPARRLYGVQFHPEVAHSEAGTFLI 200

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+ G +  W   ++ +E +  ++ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 201 RNFVYHICGCEPTWTTEAFLEEAIREVRARVGDKRVLLALSGGVDSSTLAFLLHKAIGDQ 260

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV +D GFMRK+E + ++ LF+   + P+  VD  ERF+R+L+ + DPE KRK IG  
Sbjct: 261 LTCVFIDQGFMRKDEPQRLLRLFQEQFHIPVHYVDGQERFLRQLQGVTDPEEKRKRIGAE 320

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE++++G  ++L QGTLYPDVIES +    P +       IKSHHNVGGLPE++
Sbjct: 321 FIRVFEEESQRLGPFEYLAQGTLYPDVIESANTNVDPVTGERIAVKIKSHHNVGGLPENL 380

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR L + L LP+  V RHP PGPGLAIR +GE+T+ER+ ILRE+D
Sbjct: 381 RFKLVEPLRKLFKDEVRQLARSLGLPEEIVGRHPFPGPGLAIRIVGEVTKERLEILREAD 440

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLP-VQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
            I R+EI+++G Y K+WQAF VLLP V++VGVMGD+RTY     +R VTS DGMTAD+  
Sbjct: 441 MIVRQEINRSGYYPKLWQAFAVLLPEVRSVGVMGDKRTYACPVVVRLVTSEDGMTADWAR 500

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              + L+ ++ RIVNEV G+NRVVYDITSKPP TIEWE
Sbjct: 501 VPYDLLATISNRIVNEVPGVNRVVYDITSKPPGTIEWE 538


>gi|71083355|ref|YP_266074.1| GMP synthase [Candidatus Pelagibacter ubique HTCC1062]
 gi|91206816|sp|Q4FMW8|GUAA_PELUB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|71062468|gb|AAZ21471.1| GMP synthetase [Candidatus Pelagibacter ubique HTCC1062]
          Length = 521

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/514 (52%), Positives = 358/514 (69%), Gaps = 1/514 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN-ALDYFKEQNPQAIILSGSPASSLDI 66
           SK+LIIDFGSQFTQLIARRVRE  V+ E+++ K   +    + N   IILSG P +  + 
Sbjct: 8   SKILIIDFGSQFTQLIARRVRELGVFSEIVSHKKIKIAQITKDNIAGIILSGGPLNVYEN 67

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D  +  K+IL+  IP+LGIC+G QI+ + LGGK K S+ REFG A I    N +L K  +
Sbjct: 68  DKFKFDKKILKLGIPILGICFGHQILSKLLGGKVKKSKHREFGLATINKVSNSTLTKNFF 127

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
            K ++  VWMSH DQV  +P+ F++IAS+ ++    I + K  +Y VQFHPEV HT  G 
Sbjct: 128 NKNNRSDVWMSHADQVSKMPKNFKIIASTKNSKLTIIENIKENFYGVQFHPEVTHTNKGK 187

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            L+ NFV  +  I+ NW       ++++ IK+QVG+ +VIC +SGGVDS+V A L+ +AI
Sbjct: 188 ILLRNFVFLICKIKKNWSSKDQKLKLINEIKDQVGDNKVICGLSGGVDSSVVAQLLSKAI 247

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NLTC+ V++G +RKNE   +++ FK      L  V+A + FIRKL N+ DPE KRK+I
Sbjct: 248 GKNLTCIFVNNGLLRKNEEIQVVNTFKKKLKINLIYVNAEKEFIRKLTNVSDPEKKRKII 307

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G LFI++FE  A +I   +FL QGTLYPD+IES S  G  +S IKSHHNVGGLP+ M +K
Sbjct: 308 GNLFIKIFERYANRIKNVKFLAQGTLYPDLIESKSVTGSQTSKIKSHHNVGGLPKRMKLK 367

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPLK LFKDEVR LG EL L +  + RHP PGPGLAIR  G IT E+I IL+E+D  +
Sbjct: 368 LVEPLKFLFKDEVRKLGLELNLSNDIISRHPFPGPGLAIRMPGIITNEKIKILKEADFYF 427

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            + + + G+Y KIWQA+  LLPV+TVGVMGD RTYE++C LRA+TS DGMTADF+     
Sbjct: 428 IKALREHGLYDKIWQAYAALLPVKTVGVMGDNRTYEHICLLRAITSEDGMTADFFDFPKG 487

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           F+  ++ +I+N ++GINRVVYD+TSKPP+TIE E
Sbjct: 488 FMQSISNQIINNIRGINRVVYDVTSKPPSTIELE 521


>gi|323491641|ref|ZP_08096820.1| GMP synthase [Vibrio brasiliensis LMG 20546]
 gi|323314217|gb|EGA67302.1| GMP synthase [Vibrio brasiliensis LMG 20546]
          Length = 517

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV  V G +  W   S  ++ V+RIKEQVG + VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGEDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA +RF++ L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMEMFGDKFGLNIIKVDAEDRFLKALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 DKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|218245564|ref|YP_002370935.1| GMP synthase [Cyanothece sp. PCC 8801]
 gi|257058608|ref|YP_003136496.1| GMP synthase [Cyanothece sp. PCC 8802]
 gi|226738435|sp|B7JXM2|GUAA_CYAP8 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|218166042|gb|ACK64779.1| GMP synthase, large subunit [Cyanothece sp. PCC 8801]
 gi|256588774|gb|ACU99660.1| GMP synthase, large subunit [Cyanothece sp. PCC 8802]
          Length = 542

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 368/517 (71%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++  ++  ++ NP+ IILSG P S  D  +P
Sbjct: 29  LVILDFGSQYSELIARRIRETQVYSEVLSYRTTIEQIRQLNPRGIILSGGPNSVYDNRAP 88

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   EI    +P+LG+CYG Q+M Q LGG+ + ++  E+G+A + I     LL  + E G
Sbjct: 89  QCDPEIFHLGVPILGVCYGMQLMVQQLGGQVERAKRGEYGKASLFIDDPTDLLTNV-EDG 147

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGF+++A +++T  A IA  ++K + VQFHPEVVH+VGG  LI
Sbjct: 148 ST--MWMSHGDSCTQLPEGFDILAHTENTSCAAIAHHQKKLFGVQFHPEVVHSVGGIALI 205

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL++ AIG N
Sbjct: 206 RNFVYHICQCEPTWTTEAFVEESIREIRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDN 265

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F    + P+  V+A  RF+ +L  + DPETKR++IG  
Sbjct: 266 LTCMFIDQGFMRKGEPERLVEIFDKQFHIPVEYVNARTRFLEQLAGVTDPETKRRLIGHE 325

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE++++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+++
Sbjct: 326 FIQVFEEESERLGPFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKNL 385

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR LG+ + LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 386 RFKLVEPLRKLFKDEVRKLGRAIGLPEEIVRRHPFPGPGLAIRIIGEVTAERLNILRDAD 445

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI K G+Y   WQAF VLLPV++VGVMGD RTY +   LR +TS DGMTAD+   
Sbjct: 446 FIVRDEISKQGMYHDFWQAFAVLLPVRSVGVMGDRRTYAHPIVLRLITSEDGMTADWAKV 505

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 506 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542


>gi|290475585|ref|YP_003468473.1| GMP synthetase (glutamine aminotransferase) [Xenorhabdus bovienii
           SS-2004]
 gi|289174906|emb|CBJ81707.1| GMP synthetase (glutamine aminotransferase) [Xenorhabdus bovienii
           SS-2004]
          Length = 525

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+  +    +  +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWTWNVTEEQIREFNPSGIILSGGPESTTENNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P  P+ +  + +P+LGICYG Q M   LGGK  NS  REFG A +EIK +C L +G+ + 
Sbjct: 69  PCAPEYVFHAGVPVLGICYGMQTMSMQLGGKVGNSTEREFGYAQVEIKDDCELFRGIQDV 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S+       VWMSHGD+V  IPEGF  +AS+D+ PFA +A++++++Y VQFHPEV HT 
Sbjct: 129 QSESGKPLLDVWMSHGDKVTAIPEGFITVASTDTCPFAIMANDEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  +   +  W  +S   +IV R++ Q+G++ VI A+SGGVDS+V A L+ 
Sbjct: 189 QGLNILQRFVLDICQCEVLWTPASIIDDIVERLRTQIGDDHVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++++F+G  +  L  V A ERF+  L  I +PE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEADQVMAMFEGKFDLNLVHVKAEERFLSALAGIDEPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +FI+VF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KTIGHVFIDVFDEEASKQTQVKWLAQGTIYPDVIESAASATGNAHVIKSHHNVGGLPDDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRRIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NE+ GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEINGISRVVYDISGKPPATIEWE 525


>gi|303234345|ref|ZP_07320984.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [Finegoldia magna BVS033A4]
 gi|302494461|gb|EFL54228.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [Finegoldia magna BVS033A4]
          Length = 510

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 275/512 (53%), Positives = 367/512 (71%), Gaps = 8/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVR+  VYCEV+ +K AL+  KE+ P  II +G P S  + +SP
Sbjct: 6   VIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALNAIKEKQPIGIIFTGGPNSVYEENSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           QI KEI E NIP+LG+CYG Q++ +  GG  + +++REFG+   +I    S+LKGM    
Sbjct: 66  QIEKEIFELNIPILGMCYGMQLISKDFGGVVEKAKNREFGKTNAKISNQSSILKGM---S 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSH D V   PEGF++I ++DS P A IA+E +K +AVQ+HPEV HTV G  LI
Sbjct: 123 DESIVWMSHTDFVSEKPEGFDIIQTTDSCPVAAIANEDKKIFAVQYHPEVNHTVEGKTLI 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ +     +W M ++ +E + +I++ VG+++V+ A+SGGVDS+V A L+  AIG N
Sbjct: 183 KNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLALSGGVDSSVCAALLSRAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MRKNE + + + FK      +RV +A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLMRKNEGDEVEAAFKNDELNFVRV-NAKDRFLNKLKGVSDPEQKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFE+EAKKIG   FL QGT+YPDVIES     G +S+IKSHHNVGGLP+ +D K L+
Sbjct: 302 FIRVFEDEAKKIGSVDFLAQGTIYPDVIESGQ---GDASVIKSHHNVGGLPDVVDFKDLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG EL +P+  V R P PGPGL IR +GEITEE++ +LRE+D I+R+
Sbjct: 359 EPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMGEITEEKLEVLREADFIFRD 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAGI + I Q F V+   +TVGVMGD RTY+Y  +LRAVT+ D MTAD+       L
Sbjct: 419 EVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALRAVTTTDFMTADWARIPYEVL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + ++RI+NEV  INR+VYDITSKPPATIEWE
Sbjct: 479 DKTSVRIINEVDHINRIVYDITSKPPATIEWE 510


>gi|302379961|ref|ZP_07268440.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [Finegoldia magna ACS-171-V-Col3]
 gi|302312187|gb|EFK94189.1| GMP synthase (glutamine-hydrolyzing), C-terminal domain protein
           [Finegoldia magna ACS-171-V-Col3]
          Length = 510

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 275/512 (53%), Positives = 367/512 (71%), Gaps = 8/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVR+  VYCEV+ +K ALD  KE+ P  II +G P S  + +SP
Sbjct: 6   VIVVDFGGQYNQLIARRVRDLNVYCEVVPYKKALDVIKEKQPIGIIFTGGPNSVYEENSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           QI KEI E NIP+LG+CYG Q++ +  GG  + +++REFG+   +I    S+LK M ++ 
Sbjct: 66  QIEKEIFELNIPILGMCYGMQLISKDFGGVVEKAKNREFGKTNAKISNQSSILKDMSDES 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               VWMSH D V   PEGF++I ++DS P A IA+E +K +AVQ+HPEV HTV G  LI
Sbjct: 126 I---VWMSHTDFVSQKPEGFDIIQTTDSCPVAAIANEDKKIFAVQYHPEVNHTVEGKTLI 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ +     +W M ++ +E + +I++ VG+++V+ A+SGGVDS+V A L+  AIG N
Sbjct: 183 KNFLYEICKADGDWTMENFLEEQIQKIRKTVGDKKVLLALSGGVDSSVCAALLSRAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG MRKNE + + + FK      +RV +A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLMRKNEGDEVEAAFKNDELNFVRV-NAKDRFLNKLKGVSDPEQKRKIIGEE 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFE+EAKKIG   FL QGT+YPDVIES     G +S+IKSHHNVGGLP+ +D K L+
Sbjct: 302 FIRVFEDEAKKIGSVDFLAQGTIYPDVIESGQ---GDASVIKSHHNVGGLPDVVDFKDLI 358

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG EL +P+  V R P PGPGL IR +GEITEE++ +LRE+D I+R+
Sbjct: 359 EPLRDLFKDEVRRLGLELEMPEYLVYRQPFPGPGLGIRVMGEITEEKLEVLREADFIFRD 418

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAGI + I Q F V+   +TVGVMGD RTY+Y  +LRAVT+ D MTAD+       L
Sbjct: 419 EVAKAGIDKDINQYFAVITNNRTVGVMGDFRTYDYTLALRAVTTTDFMTADWARIPYEVL 478

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + ++RI+NEV  INR+VYDITSKPPATIEWE
Sbjct: 479 DKTSVRIINEVDHINRIVYDITSKPPATIEWE 510


>gi|37522184|ref|NP_925561.1| GMP synthase [Gloeobacter violaceus PCC 7421]
 gi|44887933|sp|Q7NHC2|GUAA_GLOVI RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|35213184|dbj|BAC90556.1| GMP synthetase [Gloeobacter violaceus PCC 7421]
          Length = 551

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/517 (51%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V I+DFGSQ+++LIARR+RE+KVY EV++++  +   +   P+ IILSG P S  +  +P
Sbjct: 38  VAILDFGSQYSELIARRIRETKVYSEVLSYQTPIAEIRRLAPKGIILSGGPNSVYEAYAP 97

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q    + E  IP+LG+CYG Q+M Q LGG  + ++  E+G+A + I     L   + E G
Sbjct: 98  QCDPALWELGIPILGVCYGMQLMVQQLGGAVERAERAEYGKASLFINDPTDLFTNV-EDG 156

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSH D V  +PEGFE++A +++TP A IA   R  Y VQFHPEVVH+ GG  L+
Sbjct: 157 TT--MWMSHADSVLRMPEGFELLAHTENTPCAAIAHHSRHLYGVQFHPEVVHSRGGMALL 214

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+ G +  W  +++ +E +  ++ +VG++RV+ A+SGGVDS+  AFL++ AIG N
Sbjct: 215 RNFVYHICGCEPEWTTAAFIEEAIREVRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDN 274

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRKNE E ++ LFK   + P+  VDA+ERFI +L+ + DPE KRK+IG  
Sbjct: 275 LTCMFIDQGFMRKNEPERLVKLFKEQFHIPVAYVDAAERFIVRLEGVSDPEQKRKIIGAE 334

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFE E++++G   +L QGTLYPD+IES      P +       IKSHHNVGGLPE++
Sbjct: 335 FIRVFESESQRLGPFDYLAQGTLYPDIIESAGENIDPKTGERVAVKIKSHHNVGGLPENL 394

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPLK LFKDEVR +G+ L LP+  V+R P PGPGLAIR +GE+T+++++ILRE+D
Sbjct: 395 RFKLVEPLKRLFKDEVRQVGRALGLPEEIVQRQPFPGPGLAIRVLGELTKDKVDILREAD 454

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+E++++G Y   WQ+F VLLPV+TVGVMGD RTY Y  +LR VTS DGMTAD+   
Sbjct: 455 FILRQEVNRSGRYNDYWQSFAVLLPVKTVGVMGDRRTYAYALALRFVTSEDGMTADWARV 514

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L Q+A RIVNEV GINRVV DITSKPP TIEWE
Sbjct: 515 PYDLLEQIANRIVNEVPGINRVVLDITSKPPGTIEWE 551


>gi|32475335|ref|NP_868329.1| GMP synthase [Rhodopirellula baltica SH 1]
 gi|44887935|sp|Q7UFS3|GUAA_RHOBA RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|32445876|emb|CAD78607.1| GMP synthase [Rhodopirellula baltica SH 1]
          Length = 587

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/512 (51%), Positives = 358/512 (69%), Gaps = 3/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++L++DFGSQ+ QLIARRVRE  VYC+++    + +   E  P+ IILSG P S  +  +
Sbjct: 79  RILVLDFGSQYAQLIARRVREQNVYCQIVRHDISAERIAELAPKGIILSGGPNSVYEEGA 138

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+  + + +  IP+LGICYG Q+ CQ+LGGK  N+ SRE+GRA  E     S+ +GM E 
Sbjct: 139 PKCDEGLFDLGIPVLGICYGMQLACQALGGKVDNTPSREYGRAMCEFTDRDSIFRGMQES 198

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
              +QVWMSHGDQV  I + F  +A + + P+A I   +R  + +QFHPEV HT  G Q+
Sbjct: 199 ---EQVWMSHGDQVSQIADQFTAMAKTSTCPYAAIRHNERPVFGMQFHPEVTHTPHGGQI 255

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  V G   +W +  +    +  I++QVGN+RVIC +SGGVDS+V A L+Y+AIG 
Sbjct: 256 LRNFVIDVCGCDGSWKLGDFADAAIESIRKQVGNKRVICGLSGGVDSSVVAALLYKAIGP 315

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L+C+LVD+G +RKNE + ++  F  +    L +V+A +RF+  L  I +P+ KR+ IG 
Sbjct: 316 QLSCILVDNGLLRKNEQQIVLEEFSNHFKTDLHIVEAEDRFLADLAGIDEPQEKRRRIGH 375

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FIE F++EA KI  A FL QGTLYPDVIES +   GP++ IK HHNVGGLPE +  +L+
Sbjct: 376 AFIECFKDEAAKIEDAHFLAQGTLYPDVIESGADKDGPAATIKLHHNVGGLPEELGFELI 435

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR LG EL LP+  V RHP PGPGLA+RC+GEIT +++ +LRE+DAI  E
Sbjct: 436 EPLRDLFKDEVRRLGLELGLPEQLVWRHPFPGPGLAVRCLGEITRDKLVVLREADAIVVE 495

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+YR+  QAF VLLPVQ+VGVMGD RTY+   ++R V + D MTAD+ H     L
Sbjct: 496 EIENAGLYRETSQAFAVLLPVQSVGVMGDARTYDNAVAVRCVNTDDFMTADWSHLPYELL 555

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++ RI+NEVKG+NRV YDI+SKPPATIEWE
Sbjct: 556 ARISTRIINEVKGVNRVCYDISSKPPATIEWE 587


>gi|186681209|ref|YP_001864405.1| GMP synthase [Nostoc punctiforme PCC 73102]
 gi|226739650|sp|B2J9G3|GUAA_NOSP7 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|186463661|gb|ACC79462.1| GMP synthase, large subunit [Nostoc punctiforme PCC 73102]
          Length = 540

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/517 (51%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++   +  ++ NP+ IILSG P+S    ++P
Sbjct: 27  IIILDFGSQYSELIARRIRETQVYSEVLSYRTTSEQLRQLNPKGIILSGGPSSVYGDNAP 86

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M   LGG+   +   E+G+A + I     LL  + E G
Sbjct: 87  HCDPEIWNLGIPVLGVCYGMQLMVNQLGGEVAKADRGEYGKASLYIDDPTDLLTNV-EDG 145

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD V  +P GFE++A +++TP A IAD +RK Y VQFHPEVVH++GG  LI
Sbjct: 146 TT--MWMSHGDSVTQMPSGFELLAHTENTPCAAIADHERKLYGVQFHPEVVHSIGGIALI 203

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W  +++ +E +  I+ +VG +RV+ A+SGGVDS+  AFL+Y+AIG  
Sbjct: 204 RNFVYHICDCEPTWTTAAFVEEAIREIRTRVGEKRVLLALSGGVDSSTLAFLLYKAIGEQ 263

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV +D GFMRK E E ++ LF+   + P+  V+A +RF+ K+  + DPE KR+ IG  
Sbjct: 264 LTCVFIDQGFMRKYEPERLVKLFQEQFHIPVEYVNARDRFLAKVAGVTDPEEKRRRIGHE 323

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEE +K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 324 FINVFEETSKRLGHFDYLAQGTLYPDVIESADTNADPQTGERVAVKIKSHHNVGGLPKDL 383

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V+R P PGPGLAIR +GE+T ER+NILR++D
Sbjct: 384 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVQRQPFPGPGLAIRILGEVTSERLNILRDAD 443

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI++ G+Y   WQAF VLLP+++VGVMGD+RTY Y   LR VTS DGMTAD+   
Sbjct: 444 LIVRQEINQRGMYHDFWQAFAVLLPIRSVGVMGDQRTYAYPIVLRIVTSEDGMTADWARV 503

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 504 PYDVLEVISTRIVNEVKGVNRVVYDITSKPPGTIEWE 540


>gi|15895957|ref|NP_349306.1| GMP synthase [Clostridium acetobutylicum ATCC 824]
 gi|24211761|sp|Q97FM9|GUAA_CLOAB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|15025732|gb|AAK80646.1|AE007767_11 GMP synthase [Clostridium acetobutylicum ATCC 824]
 gi|325510109|gb|ADZ21745.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Clostridium acetobutylicum EA 2018]
          Length = 510

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/511 (52%), Positives = 365/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE  VYCE++ +  ++D  KE+ P A+I +G   S    DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVREHNVYCEIVPYTYSIDKIKEKKPSAVIFTGGQNSVYGEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ KEI +  +P+LGICYG Q++  +LGG+   S+ RE+G+  + +   C L +G+    
Sbjct: 66  RMDKEIFDLGVPVLGICYGHQLITYTLGGEVMGSEIREYGKTDVTLDSVCELFEGI---D 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +   WMSH D+V  +PEGF+V+  ++  P A +A+ ++K Y VQFHPEV+HT  G QL 
Sbjct: 123 IENSCWMSHTDRVAKVPEGFKVVGHTNVCPVAAMANTEKKIYGVQFHPEVLHTPFGEQLF 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  + G++++W MSS+ KE +  IK+ VG+++V+CA+SGGVDS+VAA L+++AIG  
Sbjct: 183 SNFLFKICGLKEDWSMSSFAKEKIQEIKDIVGDKKVLCALSGGVDSSVAAVLVHKAIGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + + S+F+   +  L  V+A +RF+ KLK I DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLLRKDEGDQVESIFRKQFDMNLIRVNAKDRFLGKLKGISDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPDV+ES +     S+ IKSHHNVGGLPE M  +L+E
Sbjct: 303 FIRVFEEEANKLGQIDFLVQGTIYPDVVESGT---DTSATIKSHHNVGGLPEDMQFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+EL +P   V R P PGPGL IR +GE+TEE++ I+RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEELGIPHKLVWRQPFPGPGLGIRVLGEVTEEKLEIVREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+  KIWQ F  L  + +VGVMGD RTY    +LRAVTS D MT+D+       L 
Sbjct: 420 IANAGLEEKIWQYFACLPNIHSVGVMGDGRTYCETIALRAVTSSDAMTSDWARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYD+TSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKGVNRIVYDVTSKPPATIEWE 510


>gi|119512578|ref|ZP_01631655.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Nodularia spumigena CCY9414]
 gi|119462778|gb|EAW43738.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Nodularia spumigena CCY9414]
          Length = 539

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 368/517 (71%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++   ++ ++ NP+ IILSG P+S  D  +P
Sbjct: 26  IVILDFGSQYSELIARRIRETQVYSEVLSYRTTPEHLRKLNPKGIILSGGPSSVYDDHAP 85

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M + L G+   +   E+G+A + I     LL  + E+G
Sbjct: 86  HCDPEIWNLGIPILGVCYGMQLMVKQLDGEVAKADRGEYGKASLYIDDPTDLLTNV-EEG 144

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD V  +P GFE++A +D+TP A IAD ++K Y VQFHPEVVH++GG  LI
Sbjct: 145 TT--MWMSHGDSVTKMPTGFELLAHTDNTPCAAIADHEKKLYGVQFHPEVVHSLGGLPLI 202

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+Y+AIG  
Sbjct: 203 RNFVYHICDCEPTWTTEAFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLYKAIGEQ 262

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV +D GFMRK E E ++ LFK   + P+  V A +RF+  ++ I DPE KR+ IG  
Sbjct: 263 LTCVFIDQGFMRKLEPERLLKLFKEQFHIPVEYVMARDRFLNMIEGITDPEEKRRRIGHE 322

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEE +K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 323 FIQVFEETSKRLGHFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDL 382

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V+R P PGPGLAIR +GE+T ER+NILR++D
Sbjct: 383 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVQRQPFPGPGLAIRILGEVTPERLNILRDAD 442

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI+K G+Y  +WQAF VLLP+++VGVMGD+RTY Y   LR VTS DGMTAD+   
Sbjct: 443 LIVRQEINKRGLYHDVWQAFAVLLPIRSVGVMGDKRTYAYPIVLRIVTSEDGMTADWARI 502

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 503 PYDILEDISNRIVNEVKGVNRVVYDITSKPPGTIEWE 539


>gi|262066732|ref|ZP_06026344.1| GMP synthase [Fusobacterium periodonticum ATCC 33693]
 gi|291379531|gb|EFE87049.1| GMP synthase [Fusobacterium periodonticum ATCC 33693]
          Length = 512

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/515 (52%), Positives = 366/515 (71%), Gaps = 4/515 (0%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIIILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGM 125
             +P +  ++ E NIP+LG+CYG Q++    GGK   +  +EFG+A +E+    ++L   
Sbjct: 62  EGAPSLDIKLFEKNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDENNIL--Y 119

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
            +  +K  VWMSHGD V  +   F++IA +DS+  A I ++ +  YA Q+HPEV H+  G
Sbjct: 120 KDIPNKTTVWMSHGDHVTEMAPNFKIIAHTDSS-IAAIENKDKNIYAFQYHPEVTHSQHG 178

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
             ++ NFV  +A  + NW M +Y +  V  IKE VGN++VI  +SGGVDS+VAA LI +A
Sbjct: 179 FDMLKNFVFEIAKAEQNWSMENYIESTVKNIKETVGNKQVILGLSGGVDSSVAAALINKA 238

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTC+ VD G +RK+E + ++ ++    +  ++ V+A ERF+ KL  + DPETKRK+
Sbjct: 239 IGRQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCVNAEERFLTKLAGVTDPETKRKI 298

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE +  
Sbjct: 299 IGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLKF 357

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DAI
Sbjct: 358 ELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADAI 417

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           + EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H   
Sbjct: 418 FIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLPY 477

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 478 DFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|56751331|ref|YP_172032.1| GMP synthase [Synechococcus elongatus PCC 6301]
 gi|81595982|sp|Q5N2F8|GUAA_SYNP6 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|56686290|dbj|BAD79512.1| GMP synthetase [Synechococcus elongatus PCC 6301]
          Length = 534

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 366/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++   D  ++ +P+ IILSG P S  D  +P
Sbjct: 21  LIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAP 80

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGG+   ++  E+G+A + I     LL  + E G
Sbjct: 81  VCDPEIWNLGIPVLGVCYGMQLMVQQLGGQVDRAERGEYGKAALVIDDPTDLLTNV-EPG 139

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD V+ +PEGFE++A +D+TP A IAD +RK+Y VQFHPEVVH+V G  LI
Sbjct: 140 ST--MWMSHGDSVKTMPEGFELLAHTDNTPCAAIADHQRKFYGVQFHPEVVHSVHGMALI 197

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL++ AIG  
Sbjct: 198 RNFVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDQ 257

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F       +  + A +RF+++L+ I DPE KRK IG  
Sbjct: 258 LTCMFIDQGFMRKGEPERLMEVFNEKFKIHVEYIQARDRFLQRLEGITDPEEKRKRIGHE 317

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE++++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 318 FIRVFEEESRRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 377

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL+ LFKDEVR +G+ L LP+  V+RHP PGPGLAIR +GE+T E++NILR++D
Sbjct: 378 QFKLVEPLRRLFKDEVRQVGRSLGLPEEIVKRHPFPGPGLAIRILGEVTAEKLNILRDAD 437

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+E+++ G Y + WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 438 LIVRQEVNRQGYYDEFWQAFAVLLPVKSVGVMGDKRTYAYPVVLRFVSSEDGMTADWSRA 497

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 498 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 534


>gi|83590931|ref|YP_430940.1| GMP synthase [Moorella thermoacetica ATCC 39073]
 gi|91206810|sp|Q2RGP2|GUAA_MOOTA RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|83573845|gb|ABC20397.1| GMP synthase (glutamine-hydrolyzing) [Moorella thermoacetica ATCC
           39073]
          Length = 516

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/511 (53%), Positives = 358/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG Q+ QLIARRVRE+ VY E+I +   L+    + P+ II SG PAS   + +P
Sbjct: 12  VLVLDFGGQYNQLIARRVREAGVYSEMIPYNTPLEKILARRPRGIIFSGGPASVYSLGAP 71

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I + + ES IP+LGICYG Q+M   LGG+ + +  RE+G+  +EI     L  G+ E  
Sbjct: 72  RIDRALYESGIPILGICYGMQLMAHDLGGRVEGASGREYGKTQLEITAADPLFAGLPES- 130

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSHGD +   P GF+V A S  TP A ++D  RK Y VQFHPEV HT  G +++
Sbjct: 131 --IQCWMSHGDYISAPPPGFQVTARSAYTPVAAMSDPARKLYGVQFHPEVKHTPMGQEIL 188

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
             F+  V G + +W +SS+ ++ V+ I+ QVGN RV+CA+SGGVDS+VAA L++ A+G  
Sbjct: 189 RRFLFQVCGCRGDWSVSSFIEDQVAAIRRQVGNGRVLCALSGGVDSSVAAALVHRAVGDR 248

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV V+HG +R+ E E +   F       +  VDAS RF+ KL  + DPE KRK+IG  
Sbjct: 249 LTCVFVNHGLLRQGEAEQVQRAFGQAMGMNIVYVDASRRFLEKLTGVTDPEEKRKIIGHE 308

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA+K+G   FL QGTLYPDVIES +     +++IKSHHNVGGLPE M+++L+E
Sbjct: 309 FIRVFEEEARKLGRVDFLVQGTLYPDVIESGT---ETAAVIKSHHNVGGLPEDMELELIE 365

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR +G+EL LP+  V R P PGPGLAIR +GE+T E++ ILR++DAI  EE
Sbjct: 366 PLRLLFKDEVRRVGEELGLPEEIVWRQPFPGPGLAIRILGEVTPEKLEILRQADAIVTEE 425

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I +AG+YR+IWQ+F VL  +++VGVMGDERTY Y   LRAVTS D MTAD+     + L 
Sbjct: 426 IRRAGLYREIWQSFAVLPSMKSVGVMGDERTYAYPIVLRAVTSDDAMTADWARLPYDLLE 485

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++ RIVNEV+ INRVVYDITSKPPATIEWE
Sbjct: 486 RISSRIVNEVRHINRVVYDITSKPPATIEWE 516


>gi|15605784|ref|NP_213161.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Aquifex aeolicus VF5]
 gi|6225492|sp|O66601|GUAA_AQUAE RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|2982942|gb|AAC06558.1| GMP synthase [Aquifex aeolicus VF5]
          Length = 510

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 364/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L+++FGSQ+ QLIARRVRE  VY E++ +   ++  K++NP  II SG PAS     +P
Sbjct: 6   ILVVNFGSQYVQLIARRVRELGVYSEIVHWDTPVEEIKKKNPYGIIFSGGPASVYAEGAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              K I E  +P+LGICYG Q++   LGGK   S+ +E+GRA + I K   + +G+    
Sbjct: 66  LPDKRIYELGVPILGICYGLQVITHQLGGKVVRSEKQEYGRARLRIIKEDVIFEGI---P 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSH D+V  +PEGFEV+A S+++P+A IA+ ++K Y  QFHPEV HTV G +++
Sbjct: 123 KESDVWMSHADKVVELPEGFEVLAVSENSPYAVIANREKKIYGFQFHPEVTHTVFGKEML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V   + NW M  +  E +  I++ VG+ +VI A+SGGVDSTVAA L + AIG  
Sbjct: 183 ANFIYGVCKAEKNWEMGDFIHEKIEEIRKTVGDAKVIAALSGGVDSTVAAVLTHRAIGDK 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L C  +DHG +R  E E +    +     PL VVDASE F+ KLK + DPE KRK+IG+ 
Sbjct: 243 LHCFFIDHGLLRYKEREEVEKNLRSL-GLPLTVVDASEEFLEKLKGVEDPEEKRKIIGRT 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFE EAKKI GA+FL QGTLYPDV+ES    G  S+ IK+HHNVGGLPE M++KL+E
Sbjct: 302 FIEVFEREAKKIEGAEFLLQGTLYPDVVESAGIKG--SAKIKTHHNVGGLPERMNLKLLE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           P +ELFKDEVR +GK L +P+  + RHP PGPGLAIR IGE+ ++ + ILR++D I+ +E
Sbjct: 360 PFRELFKDEVRKIGKLLGVPEEILRRHPFPGPGLAIRIIGEVNKKDLEILRKADYIFIQE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           + K G+Y ++WQAF VLLPV++VGVMGD RTYE V +LRAV S+DGMTAD+     +FL 
Sbjct: 420 LKKEGLYDRVWQAFAVLLPVKSVGVMGDVRTYEKVVALRAVESVDGMTADWARLPYDFLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V  RI+NEV+G+NRVVYDI+SKPP+TIEWE
Sbjct: 480 RVMRRIINEVEGVNRVVYDISSKPPSTIEWE 510


>gi|119484405|ref|ZP_01619022.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Lyngbya sp. PCC 8106]
 gi|119457879|gb|EAW39002.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Lyngbya sp. PCC 8106]
          Length = 539

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/517 (51%), Positives = 362/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++   +     NPQ IILSG P S  D  +P
Sbjct: 26  IVIMDFGSQYSELIARRIRETEVYSEVISYRTTAEQLATLNPQGIILSGGPNSVYDQGAP 85

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
                I    IP+LG+CYG Q+M Q LGG+ + +Q  E+G+A + I     LL  + E G
Sbjct: 86  HCDPNIWNLGIPILGVCYGMQLMVQQLGGQVERAQRAEYGKASLLIDDPTDLLTNV-ENG 144

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSH D    +P GFE++A +++TP A IA+ +RK Y VQFHPEVVH+VGG  LI
Sbjct: 145 ST--MWMSHADSCTQLPTGFEILAHTENTPCAAIAEHERKLYGVQFHPEVVHSVGGLALI 202

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   Q  W   ++ +E +  ++ +VG++RV+ A+SGGVDS+  AFL++ AIG N
Sbjct: 203 RNFVYHICNCQPTWTTEAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLMHRAIGDN 262

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF+   + P++ V+A ERF+ KL  + DPE KRK+IG  
Sbjct: 263 LTCMFIDQGFMRKYEPERLVKLFEEQFHIPVQYVNARERFLTKLNGVTDPEEKRKIIGHE 322

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE+ ++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 323 FIGVFEEESSRLGPFDYLAQGTLYPDVIESADTNVDPQTGERVAVKIKSHHNVGGLPKDL 382

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KL+EPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR IGE+T ER+ ILR++D
Sbjct: 383 RFKLIEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTPERLRILRDAD 442

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            + R+EI K GIY   WQAF VLLPV++VGVMGD+RTY +   LR V+S DGMTAD+   
Sbjct: 443 FVVRDEISKQGIYHDFWQAFAVLLPVRSVGVMGDQRTYAHPVVLRFVSSEDGMTADWSRV 502

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ R+VNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 503 PYDLLEIISNRMVNEVEGVNRVVYDITSKPPGTIEWE 539


>gi|163802484|ref|ZP_02196377.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio sp. AND4]
 gi|159173785|gb|EDP58600.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio sp. AND4]
          Length = 517

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 270/520 (51%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTENNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGKVAGSTEREFGYAQVKVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---ELTQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT GG Q+++NFV    G +  W   S  ++ V+RIKEQVG + VI  +SGGVDS+V A 
Sbjct: 178 HTKGGLQMLENFVLGACGCERLWTSESIIEDAVARIKEQVGEDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLNALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLENAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV+GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517


>gi|113474718|ref|YP_720779.1| GMP synthase [Trichodesmium erythraeum IMS101]
 gi|110165766|gb|ABG50306.1| GMP synthase (glutamine-hydrolyzing) [Trichodesmium erythraeum
           IMS101]
          Length = 575

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++       + NP+ IILSG P S  D  +P
Sbjct: 62  IVILDFGSQYSELIARRIRETQVYSEVISYRTTAAKLADINPKGIILSGGPNSVYDEGAP 121

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M + LGG+ + +Q  E+G+A + I     LL  + E+G
Sbjct: 122 HCDPEIWNLGIPILGVCYGMQLMVKQLGGEVERTQLAEYGKASVSIDDPTDLLTNI-EEG 180

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +   +WMSHGD V  +P GFEV+A +D+TP   IAD  +K Y  QFHPEVVH++GG  LI
Sbjct: 181 TT--MWMSHGDSVTKMPSGFEVLAHTDNTPCGAIADHNKKLYGTQFHPEVVHSIGGQVLI 238

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 239 RNFVYHICKCEPTWTTEAFVEEAIREIRAKVGDKRVLLALSGGVDSSTLAFLLHQAIGDK 298

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E EN++ +F    +  ++ V+A +RF+  LK + DPE KRK+IG  
Sbjct: 299 LTCMFIDQGFMRKYEPENLVKIFHESFHISVKYVNARDRFLSILKGVSDPEEKRKLIGHE 358

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+K++G   +L QGTLYPDVIES +    P +       IKSHHNVGGLP+ +
Sbjct: 359 FIQVFEEESKRLGPFDYLAQGTLYPDVIESANTNVDPKTGERVAVKIKSHHNVGGLPKDL 418

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR +GE+T++R+ ILR++D
Sbjct: 419 RFKLVEPLRKLFKDEVRNVGRSIGLPEEIVRRHPFPGPGLAIRILGEVTDKRLKILRDAD 478

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI + G+Y   WQAF VLLP+Q+VGVMGD+RTY Y   LR V S DGMTAD+   
Sbjct: 479 FIVRDEIRQQGMYHDFWQAFAVLLPIQSVGVMGDQRTYAYPIVLRFVKSEDGMTADWSRV 538

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 539 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 575


>gi|255654281|ref|ZP_05399690.1| GMP synthase [Clostridium difficile QCD-23m63]
 gi|296452570|ref|ZP_06894265.1| GMP synthase (glutamine-hydrolyzing) [Clostridium difficile NAP08]
 gi|296881018|ref|ZP_06904963.1| GMP synthase (glutamine-hydrolyzing) [Clostridium difficile NAP07]
 gi|296258593|gb|EFH05493.1| GMP synthase (glutamine-hydrolyzing) [Clostridium difficile NAP08]
 gi|296427977|gb|EFH13879.1| GMP synthase (glutamine-hydrolyzing) [Clostridium difficile NAP07]
          Length = 511

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 373/514 (72%), Gaps = 11/514 (2%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE++    +++  KE+NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGG--KTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
            I KEI E  +P+LGICYG QIM   LGG  +  N Q +E+G+  I   K+ SL +G+  
Sbjct: 66  TISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTAITYGKS-SLFEGI-- 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +   VWMSH D +E +PEGF ++A+++  P A + + +R  Y VQFHPEV H + G +
Sbjct: 123 --TTNSVWMSHTDLIETVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDK 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF++++  ++ +W   S+ ++ +  +KE++G+++ +CA+SGGVDS+VAA LI++AIG
Sbjct: 181 ILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTC+ VDHG +RKNE  ++  +F+   +  L  V+A +RF+ KLK + +PE KRK+IG
Sbjct: 241 DNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK- 366
           + FI VFEEE+ K+G   FL QGT+YPDVIES     G ++ IKSHHNVGG+PE +D + 
Sbjct: 301 EEFIRVFEEESNKLGKMDFLVQGTIYPDVIESGH---GNAATIKSHHNVGGIPEDVDFQE 357

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           +VEPL+ELFKDEVR +G EL + +  + RHP PGPGL IR IG++T+E+ +ILRE+DA+Y
Sbjct: 358 IVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAVY 417

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ KAG+YR+IWQAF  L  V+TVGVMGDERTY Y+  LRAVTS DGMT+D+Y    +
Sbjct: 418 MDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYD 477

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV G+NRVVYDITSKPP TIEWE
Sbjct: 478 VLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511


>gi|126697769|ref|YP_001086666.1| GMP synthase [Clostridium difficile 630]
 gi|255099361|ref|ZP_05328338.1| GMP synthase [Clostridium difficile QCD-63q42]
 gi|255305194|ref|ZP_05349366.1| GMP synthase [Clostridium difficile ATCC 43255]
 gi|123067183|sp|Q18CT8|GUAA_CLOD6 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|115249206|emb|CAJ67019.1| Glutamine amidotransferase [Clostridium difficile]
          Length = 511

 Score =  555 bits (1429), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 373/514 (72%), Gaps = 11/514 (2%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE++    +++  KE+NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGG--KTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
            I KEI E  +P+LGICYG QIM   LGG  +  N Q +E+G+  I   K+ SL +G+  
Sbjct: 66  TISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTAITYGKS-SLFEGI-- 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +   VWMSH D +E +PEGF ++A+++  P A + + +R  Y VQFHPEV H + G +
Sbjct: 123 --TTNSVWMSHTDLIEKVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDK 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF++++  ++ +W   S+ ++ +  +KE++G+++ +CA+SGGVDS+VAA LI++AIG
Sbjct: 181 ILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTC+ VDHG +RKNE  ++  +F+   +  L  V+A +RF+ KLK + +PE KRK+IG
Sbjct: 241 DNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK- 366
           + FI VFEEE+ K+G   FL QGT+YPDVIES     G ++ IKSHHNVGG+PE +D + 
Sbjct: 301 EEFIRVFEEESNKLGKMDFLVQGTIYPDVIESGH---GNAATIKSHHNVGGIPEDVDFQE 357

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           +VEPL+ELFKDEVR +G EL + +  + RHP PGPGL IR IG++T+E+ +ILRE+DA+Y
Sbjct: 358 IVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAVY 417

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ KAG+YR+IWQAF  L  V+TVGVMGDERTY Y+  LRAVTS DGMT+D+Y    +
Sbjct: 418 MDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYD 477

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV G+NRVVYDITSKPP TIEWE
Sbjct: 478 VLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511


>gi|170077976|ref|YP_001734614.1| GMP synthase [Synechococcus sp. PCC 7002]
 gi|226739757|sp|B1XLR5|GUAA_SYNP2 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|169885645|gb|ACA99358.1| GMP synthetase [Synechococcus sp. PCC 7002]
          Length = 540

 Score =  555 bits (1429), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 363/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++ + +  ++ NP  IILSG P+S  D  +P
Sbjct: 27  IVILDFGSQYSELIARRIRETEVYSEVISYRTSAEQLRQLNPSGIILSGGPSSVYDDYAP 86

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M + LGG  + ++  E+G+A I I     LL  + E+G
Sbjct: 87  ACDPEIWNLGIPVLGVCYGMQLMVKQLGGTVERAKHAEYGKASIFIDDPTDLLTNV-EEG 145

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD   H+PEGFE++A +D+TP A IA   R+ Y VQFHPEVVH+  G  LI
Sbjct: 146 ST--MWMSHGDSCVHLPEGFEILAHTDNTPCAAIAHHGRQLYGVQFHPEVVHSQDGMALI 203

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 204 RNFVYHICKCEPTWTTEAFVEEAIREIRARVGDQRVLLALSGGVDSSTLAFLLHQAIGDQ 263

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F    + P+  ++A +RFI KLK + DPE KR++IG  
Sbjct: 264 LTCMFIDQGFMRKGEPERLVEIFDEQFHIPVAYINARDRFIDKLKGVTDPEEKRRLIGHE 323

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE+K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLPE +
Sbjct: 324 FIAVFEEESKRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPEDL 383

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +   + LP+  + RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 384 RFKLVEPLRKLFKDEVRKVAASIGLPEEIIRRHPFPGPGLAIRIIGEVTAERLNILRDAD 443

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            + R+EI K G+Y   WQAF VLLP+++VGVMGD+RTY +   LR +TS DGMTAD+   
Sbjct: 444 WVVRDEIKKQGVYSDFWQAFAVLLPIRSVGVMGDKRTYAHPVVLRMITSEDGMTADWARP 503

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L  ++ R+VNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 504 PYELLETISNRMVNEVKGVNRVVYDITSKPPGTIEWE 540


>gi|254973858|ref|ZP_05270330.1| GMP synthase [Clostridium difficile QCD-66c26]
 gi|255091243|ref|ZP_05320721.1| GMP synthase [Clostridium difficile CIP 107932]
 gi|255312902|ref|ZP_05354485.1| GMP synthase [Clostridium difficile QCD-76w55]
 gi|255515661|ref|ZP_05383337.1| GMP synthase [Clostridium difficile QCD-97b34]
 gi|255648755|ref|ZP_05395657.1| GMP synthase [Clostridium difficile QCD-37x79]
 gi|260681975|ref|YP_003213260.1| GMP synthase [Clostridium difficile CD196]
 gi|260685573|ref|YP_003216706.1| GMP synthase [Clostridium difficile R20291]
 gi|306518872|ref|ZP_07405219.1| GMP synthase [Clostridium difficile QCD-32g58]
 gi|260208138|emb|CBA60429.1| GMP synthase [glutamine-hydrolyzing] [Clostridium difficile CD196]
 gi|260211589|emb|CBE01801.1| GMP synthase, glutamine-hydrolyzing [Clostridium difficile R20291]
          Length = 511

 Score =  555 bits (1429), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 373/514 (72%), Gaps = 11/514 (2%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE++    +++  KE+NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGG--KTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
            I KEI E  +P+LGICYG QIM   LGG  +  N Q +E+G+  I   K+ SL +G+  
Sbjct: 66  TISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEKEYGKTSITYGKS-SLFEGI-- 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             +   VWMSH D +E +PEGF ++A+++  P A + + +R  Y VQFHPEV H + G +
Sbjct: 123 --TTNSVWMSHTDLIEKVPEGFTIVANTNDCPVAAMENVERNLYGVQFHPEVEHCLEGDK 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF++++  ++ +W   S+ ++ +  +KE++G+++ +CA+SGGVDS+VAA LI++AIG
Sbjct: 181 ILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCALSGGVDSSVAAVLIHKAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTC+ VDHG +RKNE  ++  +F+   +  L  V+A +RF+ KLK + +PE KRK+IG
Sbjct: 241 DNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDRFLSKLKGVSEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK- 366
           + FI VFEEE+ K+G   FL QGT+YPDVIES     G ++ IKSHHNVGG+PE +D + 
Sbjct: 301 EEFIRVFEEESNKLGKMDFLVQGTIYPDVIESGH---GNAATIKSHHNVGGIPEDVDFQE 357

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           +VEPL+ELFKDEVR +G EL + +  + RHP PGPGL IR IG++T+E+ +ILRE+DA+Y
Sbjct: 358 IVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVIGDVTKEKCDILREADAVY 417

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ KAG+YR+IWQAF  L  V+TVGVMGDERTY Y+  LRAVTS DGMT+D+Y    +
Sbjct: 418 MDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGLRAVTSSDGMTSDWYKMPYD 477

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV G+NRVVYDITSKPP TIEWE
Sbjct: 478 VLERISNRIINEVDGVNRVVYDITSKPPGTIEWE 511


>gi|37526602|ref|NP_929946.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|44887931|sp|Q7N3K4|GUAA_PHOLL RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|36786034|emb|CAE15086.1| GMP synthetase [glutamine-hydrolyzing] (glutamine amidotransferase)
           (GMP synthetase) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 525

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/517 (52%), Positives = 364/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+    S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESTTAQGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M    GGK ++S  REFG A +EIK   +L +G+ + 
Sbjct: 69  PRAPEYVFNAGVPVLGVCYGMQTMSVQFGGKVEDSTEREFGYAQVEIKAESALFRGIQDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            ++Q      VWMSHGD+V  IPE F  IAS+D+ PFA IA+E++++Y VQFHPEV HT 
Sbjct: 129 LNEQGKPSLDVWMSHGDKVTAIPEDFITIASTDTCPFAIIANEEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  V   +  W  +S  ++ V R++EQVG + VI  +SGGVDS+V A L++
Sbjct: 189 QGQRILERFVLDVCQCEALWTPASIIEDTVVRLREQVGEDHVILGLSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE   ++ +F G     +  V A +RF+  L  I DPE KR
Sbjct: 249 RAIGNRLTCVFVDNGLLRLNEATQVMEMFAGKFGLNIVHVPAEDRFLTALAGINDPEEKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++F+EVF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KTIGRVFVEVFDEEASKQAQVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR++D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLNRHPFPGPGLGVRVLGEVKKEYCDLLRQAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDVSGKPPATIEWE 525


>gi|307243697|ref|ZP_07525837.1| GMP synthase (glutamine-hydrolyzing) [Peptostreptococcus stomatis
           DSM 17678]
 gi|306492906|gb|EFM64919.1| GMP synthase (glutamine-hydrolyzing) [Peptostreptococcus stomatis
           DSM 17678]
          Length = 511

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 377/514 (73%), Gaps = 11/514 (2%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE++ +  +++  +E+NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEILPYTTSIEKIEEKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTK--NSQSREFGRAFIEIKKNCSLLKGMWE 127
           +I +EI E  +P+LGICYG Q+M   LGGK +  ++Q+RE+G+  IE  ++  + KG+  
Sbjct: 66  KISREIFEIGVPILGICYGDQLMAHLLGGKVQKGDNQTREYGKTVIEYGQS-PIFKGI-- 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
             S  QVWMSH D +  +PEGF+V+A++ + P A + +  +K Y VQFHPEV H++ G +
Sbjct: 123 --SSNQVWMSHTDYILEVPEGFDVVATTKNCPVAAMHNVDKKLYGVQFHPEVEHSIEGDK 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF++ +  +  +W  SS+  + V+ IK +VG+++ +CA+SGGVDS+VAA L++ AIG
Sbjct: 181 ILTNFLYKICQVSGDWTTSSFIDDKVAEIKAKVGDKKALCALSGGVDSSVAAALMHRAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTCV VDHG +RKNE +++  +F+      L  V+A +RF+ KL  + +PE KRK+IG
Sbjct: 241 DNLTCVFVDHGLLRKNEGDDVERIFRQKFGMNLIRVNAEDRFLGKLAGVTEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK- 366
           + FI VFE E++K+G   FL QGT+YPD++ES +   G S+ IKSHHNVGGLPE +D + 
Sbjct: 301 EEFIRVFEAESQKLGKMDFLVQGTIYPDIVESGN---GESATIKSHHNVGGLPEDVDFQE 357

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           ++EPL+ELFKDEVR +G EL + ++ + RHP PGPGL IR IGE+T+E+ +ILRE+DA+Y
Sbjct: 358 IIEPLRELFKDEVRKIGLELGIEENLIFRHPFPGPGLGIRVIGEVTKEKCDILREADAVY 417

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ KAG+Y++IWQAF  L  V TVGVMGDERTY ++  LRAV S DGMT+D+Y    +
Sbjct: 418 MDELRKAGLYKEIWQAFATLPDVMTVGVMGDERTYAHLVGLRAVASSDGMTSDWYKIPYD 477

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV+G+NRVVYDITSKPP TIEWE
Sbjct: 478 VLERISNRIINEVEGVNRVVYDITSKPPGTIEWE 511


>gi|152991082|ref|YP_001356804.1| GMP synthase [Nitratiruptor sp. SB155-2]
 gi|226739649|sp|A6Q4N8|GUAA_NITSB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|151422943|dbj|BAF70447.1| GMP synthase (glutamine-hydrolyzing) [Nitratiruptor sp. SB155-2]
          Length = 516

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 274/515 (53%), Positives = 361/515 (70%), Gaps = 8/515 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+TQLIARR+RE  VYCE+  F   ++  + + PQ IILSG PAS  + D+P
Sbjct: 6   IVILDFGSQYTQLIARRLREVGVYCEIYPFFEPIENIRAKKPQGIILSGGPASVYEPDAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK----KNCSLLKGM 125
           ++ K I E  IP+LGICYG Q++    GG+   +   E+G+A +       K C L +G 
Sbjct: 66  RVDKAIYELGIPVLGICYGMQLITVDFGGQVVRALEHEYGKAKLYFDPIHGKVCPLFEGT 125

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
            +    Q VWMSHGD+V  +P GF  IA +D++P+A IA+E+++ YA+QFHPEV H+  G
Sbjct: 126 KDG---QIVWMSHGDKVTELPAGFIRIAHTDNSPYAAIANEEKQIYALQFHPEVSHSQEG 182

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            ++++NF   + GI   W M  + KE + +I+++VG ++V+CA+SGGVDS+V   L+YEA
Sbjct: 183 QKILENFARKICGITSKWDMGHFAKEQIEKIRQRVGEDKVLCALSGGVDSSVVTALLYEA 242

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L  V VD+G +R+ E E +  +FK     PL VVDA ERF+  L+ I DPE KRK+
Sbjct: 243 IGDKLIPVFVDNGLLREGEREKVEYVFKNMLKVPLIVVDAKERFLNALQGITDPEQKRKI 302

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG  FIEVFEEEAKK    ++L QGTLYPDVIES+S   GPS  IKSHHNVGGLP+ M  
Sbjct: 303 IGHTFIEVFEEEAKKHTDVKYLAQGTLYPDVIESVS-VKGPSETIKSHHNVGGLPDWMKF 361

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +L+EPL+ELFKDEVR LG EL LP   V RHP PGPGLAIR +GE+ EE ++++R++D I
Sbjct: 362 ELIEPLRELFKDEVRKLGLELGLPREMVYRHPFPGPGLAIRILGEVNEEALDLVRKADTI 421

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
             EEI   G+Y K+WQ+F VLL V++VGVMGD+RTYE   +LR V S DGMTA F H   
Sbjct: 422 LLEEIKAHGLYEKLWQSFAVLLNVKSVGVMGDKRTYENTVALRIVESSDGMTATFAHIPH 481

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + L  ++ RI+NEV GINRVVYDITSKPP TIEWE
Sbjct: 482 DLLELISNRIINEVDGINRVVYDITSKPPGTIEWE 516


>gi|237732484|ref|ZP_04562965.1| bifunctional GMP synthase/glutamine amidotransferase [Citrobacter
           sp. 30_2]
 gi|226908023|gb|EEH93941.1| bifunctional GMP synthase/glutamine amidotransferase [Citrobacter
           sp. 30_2]
          Length = 525

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 367/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+ G+CYG Q M   LGG  + S  REFG A +E++ + +L++G+ + 
Sbjct: 69  PRAPEYVFNAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVQTDSALVRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IPEGF  +AS+DS PFA +A E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPEGFVTVASTDSCPFAIMAHEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVGN++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGNDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  V+  +RF+  LK   DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVEGEKRFLDALKGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|188585091|ref|YP_001916636.1| GMP synthase (glutamine-hydrolyzing) [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226739645|sp|B2A5V5|GUAA_NATTJ RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|179349778|gb|ACB84048.1| GMP synthase (glutamine-hydrolyzing) [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 510

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/511 (51%), Positives = 362/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+++LIARR+RE  VYCE+  +  +++  K+ +P AI+LSG P+S     SP
Sbjct: 6   VIVLDFGGQYSRLIARRIREHNVYCEIYPYNISINKLKQLSPAAIVLSGGPSSVYQEGSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +  EI E  IP+LGICYG Q+M + LGG    S  RE+G+A +EI+    L +G+    
Sbjct: 66  DLDTEIFEIGIPVLGICYGMQLMAKKLGGTVTGSTKREYGKALLEIENPNLLTEGV---S 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   VWMSHGD VE +P GF+V+  +++TP A + +  +  Y VQFH EV+HT  G +++
Sbjct: 123 SDLLVWMSHGDSVEQVPPGFKVMGKTENTPIAGLFNPDKNLYGVQFHLEVMHTPKGREML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ ++A +  +W M SY +E V +IK +    + +C +SGG+DSTVAA L+ +AIG +
Sbjct: 183 KNFLFNIADLSADWTMGSYIEETVEQIKTEAQGRKAVCGLSGGIDSTVAALLVQKAIGDD 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ V+HG +RKNE + +  LF+   +  L  VDAS+RF+ KL+ + DPE KRK+IG+ 
Sbjct: 243 LTCIFVNHGLLRKNEQDQVRELFEQEFDINLVYVDASDRFLNKLQGVTDPEQKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA+KIG   FL QGTLY DV+ES +     +S+IKSHHNVGGLPE MD+ L+E
Sbjct: 303 FIRVFEEEARKIGDVDFLVQGTLYTDVVESGT---ETASVIKSHHNVGGLPEKMDLSLIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL  LFKDEVR + +EL L    VERHP PGPGLAIR +GEIT+E+++ILRE+DA+  +E
Sbjct: 360 PLNSLFKDEVRQVARELGLHREIVERHPFPGPGLAIRVLGEITKEKLDILREADAVVSDE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           + K G+Y  IWQ FTVL  ++TVGV GDER+Y+Y   LRAV S DGMTAD+Y    + L 
Sbjct: 420 LKKIGLYHDIWQLFTVLPDIKTVGVKGDERSYDYPIILRAVNSEDGMTADWYRFSNDVLE 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +++ R+VNEV G+NR +YDITSKPPATIEWE
Sbjct: 480 RLSNRVVNEVDGVNRFIYDITSKPPATIEWE 510


>gi|51244755|ref|YP_064639.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Desulfotalea psychrophila LSv54]
 gi|81642722|sp|Q6APU2|GUAA_DESPS RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|50875792|emb|CAG35632.1| probable GMP synthase [glutamine-hydrolyzing] [Desulfotalea
           psychrophila LSv54]
          Length = 516

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 279/513 (54%), Positives = 360/513 (70%), Gaps = 4/513 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K++I+DFGSQ TQLIARRVRE KVY E+  F   L+  KE NP  IILSG P S  D D+
Sbjct: 7   KIIILDFGSQTTQLIARRVREMKVYSEIHPFSLPLEKLKELNPTGIILSGGPCSVYDDDA 66

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P     + E  +P+ GICYG Q+M Q LGG  + ++ REFG+A I+I  +  L  G+ + 
Sbjct: 67  PHSDAGLFELGVPVFGICYGAQLMIQQLGGSVEKAEKREFGKAEIQILNDSDLFAGL-DV 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
               QVWMSHGD+VE IP+ FEV A S  +P+A +    + + AVQFHPEVVH++ G+ L
Sbjct: 126 ARSHQVWMSHGDRVEVIPDQFEVSAESAHSPYAALRHRSKPFVAVQFHPEVVHSIIGTDL 185

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  +   Q  W M  + +  V+ IKE+VG+  VICA+SGGVDS+V A +I++AIG 
Sbjct: 186 LRNFVFGLCKCQATWTMQGFIESNVAAIKEKVGDAHVICALSGGVDSSVVAAMIHKAIGS 245

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV V++G MR  E E II  FK   +  L  VDAS+ F+ KL+ + DPE KR+ IG 
Sbjct: 246 QLTCVYVNNGLMRIGESEGIIKFFKENTDLHLIDVDASDYFLGKLEGVTDPEVKRQHIGL 305

Query: 309 LFIEVFEEEAKKIGG-AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
            FI++FEEEA KI G  +FL QGTLYPDV+ES+SF G  ++ IKSHHNVG LP+ M + L
Sbjct: 306 GFIKIFEEEAHKIDGDVKFLAQGTLYPDVVESVSFRG--AAPIKSHHNVGCLPDIMKLSL 363

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL+ELFKDEVR LG EL LPD  V R P PGPGL+IR +GE+T ER++I+R +D I  
Sbjct: 364 IEPLRELFKDEVRELGVELGLPDEAVHRQPFPGPGLSIRIMGEVTPERLDIVRRADVIVL 423

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           +E+ K G Y K+WQ+F VLLP+QTVGVMGD RTYE+V +LR V S D MTAD+     + 
Sbjct: 424 DEMKKHGYYNKVWQSFAVLLPIQTVGVMGDFRTYEHVVALRVVDSRDAMTADWSRVPYDI 483

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L  ++ RI+NEV+G+NRVVYDI+SKPPATIEWE
Sbjct: 484 LGDISTRIINEVRGVNRVVYDISSKPPATIEWE 516


>gi|84387649|ref|ZP_00990666.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio splendidus 12B01]
 gi|84377494|gb|EAP94360.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio splendidus 12B01]
          Length = 517

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 266/520 (51%), Positives = 365/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ GICYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   +    + Q VWMSHGD+V  IP  F  IA +D+ P+A +A+E +KYY VQFHPEV 
Sbjct: 121 LFADL---ETTQDVWMSHGDKVVEIPTDFTKIAETDTCPYAAMANEDKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G ++++NFV +  G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLKMLENFVLNACGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L + AIG  LTCV VD+G +R NE E ++ +F       +  VDA ERF+  L+   +PE
Sbjct: 238 LAHRAIGDKLTCVFVDNGLLRLNEGEQVMDMFGDKFGLNIIKVDAEERFLNALEGEAEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKIIGHVFVDIFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|209694327|ref|YP_002262255.1| GMP synthase [Aliivibrio salmonicida LFI1238]
 gi|226738377|sp|B6EGZ6|GUAA_ALISL RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|208008278|emb|CAQ78423.1| GMP synthase [glutamine-hydrolyzing] [Aliivibrio salmonicida
           LFI1238]
          Length = 517

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/516 (51%), Positives = 369/516 (71%), Gaps = 7/516 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       ++ NP  IILSG P S  + 
Sbjct: 7   AQRILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEA 66

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           +SP+ P+ + +S +P+ G+CYG Q M + LGGK   S  REFG A +++    +L K + 
Sbjct: 67  NSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESALFKDL- 125

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              + Q VWMSHGD+V  IP  F  IA +++ P+A +A+E++KYY VQFHPEV HT  G 
Sbjct: 126 --EATQDVWMSHGDKVVEIPSDFVKIAETETCPYAAMANEEKKYYGVQFHPEVTHTKNGL 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
           ++++NFV +V G +  W  +S  ++ ++RIKEQVG++ VI  +SGGVDS+V A L + AI
Sbjct: 184 KMLENFVLNVCGCEGLWTSASIIEDAIARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRV--VDASERFIRKLKNIVDPETKRK 304
           G  LTCV VD+G +R NE E ++ +F     F L++  V+A ERF+  L    DPE KRK
Sbjct: 244 GDKLTCVFVDNGLLRLNEAEQVMEMFS--EGFGLKIIHVEAEERFLSALSGESDPEAKRK 301

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M+
Sbjct: 302 IIGHVFVDIFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDME 361

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
           M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +DA
Sbjct: 362 MGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRADA 421

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H  
Sbjct: 422 IFIEELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLP 481

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 482 YDFLGKVSNRIINEVGGISRVVYDISGKPPATIEWE 517


>gi|284052412|ref|ZP_06382622.1| GMP synthase [Arthrospira platensis str. Paraca]
 gi|291570501|dbj|BAI92773.1| GMP synthase (glutamine-hydrolyzing) [Arthrospira platensis
           NIES-39]
          Length = 541

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++ +     + N + IILSG P+S  D  +P
Sbjct: 28  IMILDFGSQYSELIARRIRETEVYSEVISYRTSAKKLADLNLKGIILSGGPSSVYDEKAP 87

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    +P+LG+CYG Q+M Q LGG+ + ++  E+G+A + I     LL  + E+G
Sbjct: 88  HCDPEIWNLGVPVLGVCYGMQLMVQQLGGEVERAKLAEYGKASLTIDDPTDLLTNV-EQG 146

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +P GFEV+A + +TP A IAD +R+ Y VQFHPEVVH++GG  LI
Sbjct: 147 ST--MWMSHGDSCTRLPPGFEVLAHTGNTPCAAIADHQRQLYGVQFHPEVVHSIGGQALI 204

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 205 RNFVYHICDCEPTWTTETFVEEAIREIRGKVGDKRVLLALSGGVDSSTLAFLLHQAIGDQ 264

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF    +  +  V+A +RF+ +LK + DPE KRK IG  
Sbjct: 265 LTCMFIDQGFMRKYEPEKLVKLFDDRFHISVEYVNARDRFLEQLKGVTDPEEKRKRIGGE 324

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE+ ++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 325 FIRVFEEESARLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 384

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR +GE+T E++NILR++D
Sbjct: 385 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRILGEVTAEKLNILRDAD 444

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EIHK+G+Y   WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 445 FIVRDEIHKSGVYHDFWQAFAVLLPVRSVGVMGDQRTYAYPVVLRFVSSEDGMTADWSRV 504

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 505 PYDLLETISNRIVNEVRGVNRVVYDITSKPPGTIEWE 541


>gi|34762609|ref|ZP_00143603.1| GMP synthase [glutamine-hydrolyzing] [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|27887733|gb|EAA24808.1| GMP synthase [glutamine-hydrolyzing] [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
          Length = 512

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 271/516 (52%), Positives = 367/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPSLNIKLFQKNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMASDFKIIAHTDSS-IAAIENNDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  +A  + NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFVFGIAKAEKNWSMENYIESTVKQIKERVGNKQVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLSKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELSIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|81299000|ref|YP_399208.1| GMP synthase [Synechococcus elongatus PCC 7942]
 gi|81167881|gb|ABB56221.1| GMP synthase (glutamine-hydrolyzing) [Synechococcus elongatus PCC
           7942]
          Length = 575

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 366/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++   D  ++ +P+ IILSG P S  D  +P
Sbjct: 62  LIILDFGSQYSELIARRIRETQVYSEVLSYRTTADQIRQLSPKGIILSGGPNSVYDDYAP 121

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    IP+LG+CYG Q+M Q LGG+   ++  E+G+A + I     LL  + E G
Sbjct: 122 VCDPEIWNLGIPVLGVCYGMQLMVQQLGGQVDRAERGEYGKAALVIDDPTDLLTNV-EPG 180

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD V+ +PEGFE++A +D+TP A IAD +RK+Y VQFHPEVVH+V G  LI
Sbjct: 181 ST--MWMSHGDSVKTMPEGFELLAHTDNTPCAAIADHQRKFYGVQFHPEVVHSVHGMALI 238

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL++ AIG  
Sbjct: 239 RNFVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHRAIGDQ 298

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F       +  + A +RF+++L+ I DPE KRK IG  
Sbjct: 299 LTCMFIDQGFMRKGEPERLMEVFNEKFKIHVEYIQARDRFLQRLEGITDPEEKRKRIGHE 358

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE++++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 359 FIRVFEEESRRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 418

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL+ LFKDEVR +G+ L LP+  V+RHP PGPGLAIR +GE+T E++NILR++D
Sbjct: 419 QFKLVEPLRRLFKDEVRQVGRSLGLPEEIVKRHPFPGPGLAIRILGEVTAEKLNILRDAD 478

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+E+++ G Y + WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 479 LIVRQEVNRQGYYDEFWQAFAVLLPVKSVGVMGDKRTYAYPVVLRFVSSEDGMTADWSRA 538

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 539 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 575


>gi|209523582|ref|ZP_03272136.1| GMP synthase, large subunit [Arthrospira maxima CS-328]
 gi|209495987|gb|EDZ96288.1| GMP synthase, large subunit [Arthrospira maxima CS-328]
          Length = 541

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+I+DFGSQ+++LIARR+RE++VY EVI+++ +     + N + IILSG P+S  D  +P
Sbjct: 28  VVILDFGSQYSELIARRIRETEVYSEVISYRTSAQKLADLNLKGIILSGGPSSVYDEKAP 87

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
               EI    +P+LG+CYG Q+M Q LGG  + ++  E+G+A + I     LL  + E+G
Sbjct: 88  HCDPEIWNLGVPVLGVCYGMQLMVQQLGGGVERAKLAEYGKASLTIDDPTDLLTNV-EQG 146

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGFEV+A +++T  A IA  +R+ Y VQFHPEVVH++GG  LI
Sbjct: 147 ST--MWMSHGDSCTRLPEGFEVLAHTENTRCAAIAHHERQLYGVQFHPEVVHSIGGQALI 204

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++ +E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 205 RNFVYHICDCEPTWTTETFVEEAIREIRARVGDKRVLLALSGGVDSSTLAFLLHQAIGDQ 264

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF    +  +  V+A +RF+ KLK + DPE KRK IG  
Sbjct: 265 LTCMFIDQGFMRKYEPEKLVKLFDARFHISVEYVNARDRFLEKLKGVTDPEEKRKRIGAE 324

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+ ++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 325 FIQVFEEESARLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 384

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR +GE+T E++NILR++D
Sbjct: 385 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRILGEVTAEKLNILRDAD 444

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EIHK+G+Y   WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+   
Sbjct: 445 FIVRDEIHKSGVYHDFWQAFAVLLPVRSVGVMGDQRTYAYPVVLRFVSSEDGMTADWSRV 504

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 505 PYDLLETISNRIVNEVRGVNRVVYDITSKPPGTIEWE 541


>gi|313681460|ref|YP_004059198.1| gmp synthase (glutamine-hydrolyzing) [Sulfuricurvum kujiense DSM
           16994]
 gi|313154320|gb|ADR32998.1| GMP synthase (glutamine-hydrolyzing) [Sulfuricurvum kujiense DSM
           16994]
          Length = 514

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/517 (52%), Positives = 365/517 (70%), Gaps = 6/517 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++++DFGSQ+TQLIARR+RE KVYCEV+ +   +D  K +NP+ IILSG P+S  +
Sbjct: 2   KDVNIIVLDFGSQYTQLIARRLREDKVYCEVLPYHTKIDAIKAKNPKGIILSGGPSSVYN 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRA--FIEIKKNCSLLK 123
            D+ ++ + +    IP+LGICYG Q +    GG    S   E+G+A   I++ ++  L +
Sbjct: 62  KDAYEVDQGVYALGIPVLGICYGMQRIAVDFGGSVIRSDHHEYGKAELTIDMTQHSVLFE 121

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G  ++   + VWMSH D+V+ +PEGF  IA S ++P+A IA+E++  YA+Q+HPEV H+ 
Sbjct: 122 GCEDE---RTVWMSHSDKVDVLPEGFVPIAYSPNSPYAAIANEEKMVYAMQYHPEVNHSE 178

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++ NF   + GI + W M  + KE + +I+ QVG  +V+CA+SGGVDS+V A L+Y
Sbjct: 179 EGYLMLRNFARKICGITEKWDMGHFLKEQIVKIRAQVGEGKVLCALSGGVDSSVVAALLY 238

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           EAIG  L  V VD+G +RK E E++ ++FK +   PL V DASE F+ KL  + DPETKR
Sbjct: 239 EAIGDQLIPVFVDNGLLRKGERESVENIFKVHLKVPLVVADASEIFLGKLAGVTDPETKR 298

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FIEVFE EAKK  G +FL QGTLYPDVIES+S   GPS  IKSHHNVGGLP+ M
Sbjct: 299 KIIGHTFIEVFEAEAKKHDGIKFLAQGTLYPDVIESVSV-NGPSVTIKSHHNVGGLPDWM 357

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           D +L+EPL++LFKDEVR LG EL LPDS V RHP PGPGL IR +GE+ +  +N+LRE+D
Sbjct: 358 DFELIEPLRDLFKDEVRKLGLELGLPDSLVNRHPFPGPGLGIRIMGEVNKPDLNLLREAD 417

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI  +E+  +G Y K WQAF VLL V++VGVMGD RTY+    +R V ++DGMTA F H 
Sbjct: 418 AILLDELKASGYYTKTWQAFAVLLNVKSVGVMGDNRTYDNTVCVRVVEAVDGMTATFAHL 477

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L +++ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 478 PHTLLERISRRIINEVDGINRVVYDISSKPPATIEWE 514


>gi|237745234|ref|ZP_04575715.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 7_1]
 gi|229432463|gb|EEO42675.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 7_1]
          Length = 512

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 369/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFYEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPTLDIKLFQKNIPILGLCYGMQLITHLHGGKVARANKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +++ NFV  +A  ++NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFEMLKNFVFGIAKAEENWSMENYIETTVKKIKERVGNKKVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLTGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLP+ + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPKDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|310779706|ref|YP_003968038.1| GMP synthase (glutamine-hydrolyzing) [Ilyobacter polytropus DSM
           2926]
 gi|309749029|gb|ADO83690.1| GMP synthase (glutamine-hydrolyzing) [Ilyobacter polytropus DSM
           2926]
          Length = 512

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/521 (52%), Positives = 362/521 (69%), Gaps = 16/521 (3%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           + + ++I+DFGSQ+ QLIARRVRE  VY EV+ +   ++  KE+ P  IILSG PAS   
Sbjct: 2   KKNSIVILDFGSQYNQLIARRVREMGVYAEVVPYFEDIEKIKEREPNGIILSGGPASVYL 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRA--FIEIKKN----C 119
            D+P I KEI E  IP+LGICYG Q+    LGGK   +  +EFG+A   I+ KKN    C
Sbjct: 62  DDAPTIDKEIYELGIPVLGICYGMQLTMHLLGGKVAKADKQEFGKAELLIDDKKNPFFDC 121

Query: 120 SLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV 179
                      + QVWMSHGD V  I +GFE IA +DS+  A + D  R +Y VQFHPEV
Sbjct: 122 V--------PDQSQVWMSHGDHVTEIAKGFEKIAHTDSS-IAVVCDTNRNFYCVQFHPEV 172

Query: 180 VHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAA 239
            H+V G Q+++NFV +VA  + NW M +Y +  V  I+E+VG+ +VI A+SGGVDS+VAA
Sbjct: 173 THSVYGKQMLENFVFNVAKCEKNWSMGNYIESTVEEIREKVGDRKVILALSGGVDSSVAA 232

Query: 240 FLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDP 299
            LI++AIG  L+C  VD G MRK+E + ++  +  + N  +  +DA +RF+ KL  + DP
Sbjct: 233 VLIHKAIGDQLSCFFVDTGLMRKDEAKKVMETYGEHYNINIECIDAEDRFLSKLAGVSDP 292

Query: 300 ETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGL 359
           E KRK+IG  FI +FE++ K+   A FL QGT+YPDVIES S   GPS+ IKSHHNVGGL
Sbjct: 293 EEKRKIIGNEFIYIFEDQKKRFKDADFLAQGTIYPDVIESQSV-KGPSATIKSHHNVGGL 351

Query: 360 PEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINIL 419
           PE M  +L+EPL+ELFKDEVR +G+EL +PD  ++RHP PGPGL IR +GE+T E+ +IL
Sbjct: 352 PEEMKFELLEPLRELFKDEVRQVGRELGIPDHMIDRHPFPGPGLGIRILGEVTREKADIL 411

Query: 420 RESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTAD 479
           RE+D I+ EE+   G+Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  + D MTA 
Sbjct: 412 READDIFIEELRNEGLYSKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSADTTDFMTAT 471

Query: 480 FYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +     +FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 472 WSRLPYDFLEKVSNRIINEVKGINRMTYDISSKPPATIEWE 512


>gi|218708651|ref|YP_002416272.1| GMP synthase [Vibrio splendidus LGP32]
 gi|254800125|sp|B7VJU8|GUAA_VIBSL RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|218321670|emb|CAV17624.1| GMP synthase [Vibrio splendidus LGP32]
          Length = 517

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/520 (50%), Positives = 366/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ GICYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   +    + Q VWMSHGD+V  IP  F  IA +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFADL---ETTQDVWMSHGDKVVEIPADFTKIAETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G ++++NFV +  G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLKMLENFVLNACGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L + AIG  LTCV VD+G +R NE E ++ +F       +  VDA +RF+  L+   +PE
Sbjct: 238 LAHRAIGDKLTCVFVDNGLLRLNEGEQVMEMFGDQFGLNIIKVDAEDRFLDALEGEAEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKIIGHVFVDIFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|86145604|ref|ZP_01063934.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio sp. MED222]
 gi|85836575|gb|EAQ54701.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio sp. MED222]
          Length = 517

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/520 (50%), Positives = 366/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRIREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+ GICYG Q M + LGGK   S  REFG A +++    +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVFGICYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   +    + Q VWMSHGD+V  IP  F  IA +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFTDL---ETTQDVWMSHGDKVVEIPADFTKIAETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G ++++NFV +  G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKNGLKMLENFVLNACGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L + AIG  LTCV VD+G +R NE E ++ +F       +  VDA +RF+  L+   +PE
Sbjct: 238 LAHRAIGDKLTCVFVDNGLLRLNEGEQVMEMFGDQFGLNIIKVDAEDRFLDALEGEAEPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK+IG +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 AKRKIIGHVFVDIFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|299143875|ref|ZP_07036955.1| GMP synthase [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518360|gb|EFI42099.1| GMP synthase [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 505

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/512 (53%), Positives = 365/512 (71%), Gaps = 9/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+ QLIARRVR   VYCEV+ +  AL    E+ PQ II +G P S  +  +P
Sbjct: 2   ILVVDFGGQYNQLIARRVRNLNVYCEVVPYNKALKSIDEKKPQGIIFTGGPNSVYEEKAP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           QI KEI E NIP+LG+CYG QIM  +LGG+ K ++ REFG+  + IK +  +  G+    
Sbjct: 62  QIEKEIFERNIPILGLCYGMQIMAHTLGGEVKPAKQREFGKTILNIKDSL-IFNGI---P 117

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++  VWMSH D+VE +PEGFE IA++D+ P A + + ++K YA+QFHPEV H+  G++++
Sbjct: 118 NENYVWMSHVDRVEKLPEGFETIANTDNCPIAAMQNREKKLYALQFHPEVNHSQFGNEML 177

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  V  ++ NW MS+Y K  +  +K +VG+ +V+ A+SGGVDS+V A L+ +A+G  
Sbjct: 178 KNFITEVCKVEQNWNMSNYAKMAIEEVKNKVGDGKVLLALSGGVDSSVTAALLSKAVGSK 237

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG MRKNE + + + FK      +RV DA +RF+ KLK + DPE KRK IG+ 
Sbjct: 238 LTCIFVDHGLMRKNEGDEVEAAFKNSGMNFIRV-DAEDRFLNKLKGVTDPEAKRKAIGEE 296

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFE+E +KI    FL QGT+YPD+IES     G +++IKSHHNVGGLPE +D K LV
Sbjct: 297 FIRVFEDEGRKIKSVDFLAQGTIYPDIIESGL---GDAAVIKSHHNVGGLPEVVDFKDLV 353

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPLK LFKDEVR LG+EL LPD  V+R P PGPGL IR IGE+T+++++ILR++D I+RE
Sbjct: 354 EPLKMLFKDEVRNLGRELGLPDYLVDRQPFPGPGLGIRVIGEVTKDKLDILRDADYIFRE 413

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+ KAG+ ++I Q F VL   +TVGVMGD RTY+Y  +LRAV + D MTAD+       L
Sbjct: 414 ELEKAGLGKEINQYFAVLTNNRTVGVMGDFRTYDYTLALRAVKTTDFMTADWARIPYEIL 473

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RIVNEV  INR+VYDITSKPPATIEWE
Sbjct: 474 DKVSNRIVNEVNNINRIVYDITSKPPATIEWE 505


>gi|22299961|ref|NP_683208.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Thermosynechococcus elongatus BP-1]
 gi|44887998|sp|Q8DGA5|GUAA_THEEB RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|22296146|dbj|BAC09970.1| GMP synthetase [Thermosynechococcus elongatus BP-1]
          Length = 535

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 367/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EVI+++   +   +  P+ IILSG P S  D ++P
Sbjct: 22  IVILDFGSQYSELIARRIRETQVYSEVISYRTTAEQLAQLAPKGIILSGGPNSVYDENAP 81

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   EI    IP+LG+CYG Q+M Q LGG  + + + E+G+A + I     LL  + ++ 
Sbjct: 82  QCDPEIWNLGIPILGVCYGMQLMVQQLGGTVERAIAGEYGKAALFIDDPTDLLTNVEQET 141

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               +WMSHGD V  +P GF V+A +D+TP A IA  +RK Y VQFHPEVVH+VGG  LI
Sbjct: 142 I---MWMSHGDSVTELPPGFRVLAHTDNTPIAAIAHPERKLYGVQFHPEVVHSVGGIALI 198

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W  +++ +E +  ++ +VG++RV+ A+SGGVDS+  AFL++ AIG  
Sbjct: 199 RNFVYHICDCEPTWTTAAFVEEAIREVRAKVGDKRVLLALSGGVDSSTLAFLLHRAIGDQ 258

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ LF+   +  +  V+A +RF+ +L  + DPE KRK IG  
Sbjct: 259 LTCMFIDQGFMRKGEPERLLKLFQEQFHIKVEYVNARDRFLAQLVGVTDPEEKRKRIGHE 318

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI VFEEE++++G   +L QGTLYPDVIES +    P +       IKSHHNVGGLPE++
Sbjct: 319 FIRVFEEESQRLGPFDYLAQGTLYPDVIESANTNIDPQTGERVAVKIKSHHNVGGLPENL 378

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ L LP+  V+RHP PGPGLAIR +GE+T ER+ ILR++D
Sbjct: 379 RFKLVEPLRKLFKDEVRQVGRSLGLPEEIVQRHPFPGPGLAIRILGEVTPERLEILRDAD 438

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI++A +Y ++WQAF VLLP++TVGVMGD+RTY Y   LR VTS DGMTAD+   
Sbjct: 439 LIVRQEINRAQMYHELWQAFAVLLPIRTVGVMGDQRTYAYPVVLRFVTSEDGMTADWARV 498

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L +++ RIVNEV G+NRVVYDITSKPP TIEWE
Sbjct: 499 PYDLLERISNRIVNEVPGVNRVVYDITSKPPGTIEWE 535


>gi|254442187|ref|ZP_05055663.1| GMP synthase, C-terminal domain protein [Verrucomicrobiae bacterium
           DG1235]
 gi|198256495|gb|EDY80803.1| GMP synthase, C-terminal domain protein [Verrucomicrobiae bacterium
           DG1235]
          Length = 513

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/511 (50%), Positives = 363/511 (71%), Gaps = 3/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           + ++DFGSQ+TQ+IARR+RE  VY  + ++K      K+     +ILSG P+S L  +SP
Sbjct: 6   IAVLDFGSQYTQVIARRIRECNVYSRIYSYKATAKQLKKDGVIGVILSGGPSSVLAPNSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +    I +  +P+LGICYG Q++   L GK + S  RE+G   + + K  SL +G+    
Sbjct: 66  KADAAIFKLGVPVLGICYGVQLIAHLLDGKVEKSNEREYGHGTLTVSKKGSLFRGL---P 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +K +VW SHGD++  +P GF+ +AS++++ +A IADEKRK Y +QFHPEV H+ GG  ++
Sbjct: 123 NKLRVWNSHGDRLAKMPTGFQAVASTENSSYAAIADEKRKIYGIQFHPEVDHSQGGINIL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF+  + G + +W M+   +E + +I+E VG +RV+  +SGGVDS+VAA LI++AIG  
Sbjct: 183 ENFLRKICGCKGDWSMADLARESIEKIRETVGEDRVLLGLSGGVDSSVAAALIHKAIGRQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VD+G +R NE E ++ L+K + N  +RV  A  +F+  LK + +PE KRK+IG+ 
Sbjct: 243 LTCVFVDNGLLRLNERELVVDLYKRHFNMDVRVARAGSKFLAALKGVSEPERKRKIIGKT 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           F++VF+E  K+IG A+FL QGTLYPDVIESIS  G P++ IKSHHNVGGLP++M  KL+E
Sbjct: 303 FVKVFQESLKRIGDAKFLAQGTLYPDVIESISIDGNPAATIKSHHNVGGLPKNMKFKLLE 362

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG EL LP   V R P PGPGL +R +GEI +  +++LR++DAI  EE
Sbjct: 363 PLRELFKDEVRALGAELGLPKEVVWRQPFPGPGLGVRVLGEINKRNLDVLRKADAILHEE 422

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           + ++ +Y K+WQ+F V LPV+TVGVMGDERTY+ V ++R V S D MTAD+       L 
Sbjct: 423 MMESDLYYKVWQSFCVFLPVRTVGVMGDERTYDNVIAVRVVESKDAMTADWVRVPYEVLQ 482

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RI+NEVKG+NRVVYDI+SKPP TIEWE
Sbjct: 483 RVSTRIINEVKGVNRVVYDISSKPPGTIEWE 513


>gi|19704776|ref|NP_604338.1| GMP synthase [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|24211750|sp|Q8RDR4|GUAA_FUSNN RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|19715106|gb|AAL95637.1| GMP synthase (glutamine-hydrolyzing) [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 512

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 368/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ ++NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPSLDIKLFQNNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NF+  +A  + NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFIFGIAKAEKNWSMENYIESTVKQIKERVGNKQVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGRQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|254303976|ref|ZP_04971334.1| GMP synthase (glutamine-hydrolyzing) [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148324168|gb|EDK89418.1| GMP synthase (glutamine-hydrolyzing) [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 512

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/516 (52%), Positives = 367/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYT 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPNLDIKLFQKNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKD 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  +A  + NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFVFGIAKAEKNWSMENYIESTVKQIKERVGNKQVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ V+A ERF+ KL  + DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCVNAEERFLIKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|157144560|ref|YP_001451879.1| GMP synthase [Citrobacter koseri ATCC BAA-895]
 gi|226738420|sp|A8AD80|GUAA_CITK8 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|157081765|gb|ABV11443.1| hypothetical protein CKO_00280 [Citrobacter koseri ATCC BAA-895]
          Length = 525

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 367/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E++ N +L++G+ + 
Sbjct: 69  PRAPEYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVRTNSALIRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTETCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVNRIREQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE E ++ +F  +    +  V A ERF+  LK   DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHFGLNIVHVPAEERFLTALKGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA ++   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEAFRLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|197285404|ref|YP_002151276.1| GMP synthase [Proteus mirabilis HI4320]
 gi|226739664|sp|B4EY59|GUAA_PROMH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|194682891|emb|CAR43237.1| GMP synthase [glutamine-hydrolyzing] [Proteus mirabilis HI4320]
          Length = 525

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 367/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LGICYG Q M   LGG  + S  REFG + +EI++ C L + + + 
Sbjct: 69  PRAPEYVFNAGVPVLGICYGMQTMSMQLGGDVEVSGEREFGYSQVEIRETCELFRDIQDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S+       VWMSHGD+V  IP  F  IAS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSEDGKPLLDVWMSHGDKVTAIPADFVTIASTETCPFAIMANEEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  + G    W  ++  ++ V+R+K+Q+G++ VI A+SGGVDS+V A L+ 
Sbjct: 189 QGLAILKRFVLDICGCDALWTSAAIIEDTVARLKQQIGDDHVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++++FKG  +  +  V+A +RF+  LK   DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEAEQVMAMFKGKFDLNIIHVEAEDRFLTALKGENDPEKKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FIE+F+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KIIGHTFIEIFDEEAVKLPQVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV ++D MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|312884312|ref|ZP_07744021.1| GMP synthase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368085|gb|EFP95628.1| GMP synthase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 517

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/520 (51%), Positives = 363/520 (69%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVDEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGG+   S  REFG A +++    +
Sbjct: 61  ESVTEDNSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGRVAGSTEREFGYAQVQVSGESA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L K +      Q VWMSHGD+V  IP  F  I  +++ PFA IA+E++KYY VQFHPEV 
Sbjct: 121 LFKDL---DLSQDVWMSHGDKVVEIPSDFSKIGQTETCPFAAIANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV  V G +  W   S  ++ V+RIKEQVG + VI  +SGGVDS+V A 
Sbjct: 178 HTKHGLQMLENFVLGVCGCERLWTSESIIEDAVARIKEQVGEDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGSKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIIKVDAEERFLSALEGKSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 DKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y ++ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYHQVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 517


>gi|302875784|ref|YP_003844417.1| GMP synthase, large subunit [Clostridium cellulovorans 743B]
 gi|307689219|ref|ZP_07631665.1| GMP synthase [Clostridium cellulovorans 743B]
 gi|302578641|gb|ADL52653.1| GMP synthase, large subunit [Clostridium cellulovorans 743B]
          Length = 510

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 271/511 (53%), Positives = 370/511 (72%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE+I +  +LD  K +NP+AII +G P S    D+P
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEIIPYNKSLDEIKAKNPKAIIFTGGPNSVYGDDTP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           ++ K + E  IP+LGICYG Q+ C   GGK +++ +RE+G+  I +     L KG+ EK 
Sbjct: 66  KVDKGVFELGIPVLGICYGHQLTCHLHGGKVESAITREYGKTEINLVNTSKLFKGIDEK- 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             +  WMSH D V  +P+GFE+IA++D  P A + + ++ +Y VQFHPEV HT  G +++
Sbjct: 125 --EICWMSHTDYVSEVPQGFEIIATTDQCPVAAMQNVEKNFYGVQFHPEVEHTPFGKKML 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  +  ++ +W MSS+ +E + +IKE VG+++V+CA+SGGVDS+VAA L+++AIG N
Sbjct: 183 SNFLFEICDLKADWSMSSFAEEEIKKIKEIVGDKKVLCALSGGVDSSVAAVLVHKAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RK+E + +  +F+G  +  L  V+A ERF+ KL  + DPE KRK+IG+ 
Sbjct: 243 LTCVFVDHGLLRKDEGDQVEQIFRGQFDMNLIRVNAQERFLGKLAGVSDPEAKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGT+YPD++ES +     S+ IKSHHNVGGLPE M+ +L+E
Sbjct: 303 FIRVFEEEANKLGEIDFLVQGTIYPDIVESGT---ATSATIKSHHNVGGLPEDMEFELIE 359

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+E+ +P   V R P PGPGLAIR +GEITEE+++I RE+DAI+REE
Sbjct: 360 PLRELFKDEVRAVGEEVGIPHHLVWRQPFPGPGLAIRVLGEITEEKLHITREADAIFREE 419

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  A +   IWQ F  L  +++VGVMGDERTY +  +LRAVTS D MT++F       L 
Sbjct: 420 IALADLEGSIWQYFACLPNIRSVGVMGDERTYCHTVALRAVTSSDAMTSEFARIPYEVLD 479

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           +V+ RIVNEVKG+NR+VYDITSKPPATIEWE
Sbjct: 480 KVSRRIVNEVKGVNRIVYDITSKPPATIEWE 510


>gi|227355887|ref|ZP_03840279.1| GMP synthase [Proteus mirabilis ATCC 29906]
 gi|227163875|gb|EEI48777.1| GMP synthase [Proteus mirabilis ATCC 29906]
          Length = 536

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 367/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+ + +S
Sbjct: 20  RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNS 79

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LGICYG Q M   LGG  + S  REFG + +EI++ C L + + + 
Sbjct: 80  PRAPEYVFNAGVPVLGICYGMQTMSMQLGGDVEVSGEREFGYSQVEIRETCELFRDIQDS 139

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S+       VWMSHGD+V  IP  F  IAS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 140 VSEDGKPLLDVWMSHGDKVTAIPADFVTIASTETCPFAIMANEEKRFYGVQFHPEVTHTH 199

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  + G    W  ++  ++ V+R+K+Q+G++ VI A+SGGVDS+V A L+ 
Sbjct: 200 QGLAILKRFVLDICGCDALWTSAAIIEDTVARLKQQIGDDHVILALSGGVDSSVTALLLN 259

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++++FKG  +  +  V+A +RF+  LK   DPE KR
Sbjct: 260 RAIGKRLTCVFVDNGLLRLNEAEQVMAMFKGKFDLNIIHVEAEDRFLTALKGENDPEKKR 319

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FIE+F+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 320 KIIGHTFIEIFDEEAVKLPQVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEDM 379

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR +D
Sbjct: 380 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRAD 439

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV ++D MTA + H 
Sbjct: 440 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHL 499

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 500 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 536


>gi|302392812|ref|YP_003828632.1| GMP synthase (glutamine-hydrolyzing) [Acetohalobium arabaticum DSM
           5501]
 gi|302204889|gb|ADL13567.1| GMP synthase (glutamine-hydrolyzing) [Acetohalobium arabaticum DSM
           5501]
          Length = 516

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 273/523 (52%), Positives = 369/523 (70%), Gaps = 10/523 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M  +E+   +L++DFG+Q++QLIARRVRE+ VY  ++ +  +++  KE NP  II SG P
Sbjct: 1   MENKEKQELILVLDFGAQYSQLIARRVREANVYSRLLPYDVSVERIKELNPDGIIFSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSL-GGKTKNSQSREFGRAFIEIKKNC 119
           +S    D+P + +EI +  IP+LGICYG Q+MC  L GG+ + +  RE+G A + IK+  
Sbjct: 61  SSVYSEDAPYVEEEIFDLGIPILGICYGMQMMCHLLPGGEVEAADHREYGNAELTIKQGL 120

Query: 120 SLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEV 179
            LL      G + + WMSHGD+V  IP+GFEVI  +D++P A + + +RK+Y VQFHPEV
Sbjct: 121 DLLD---GLGDELKCWMSHGDRVAEIPDGFEVIGYTDNSPVAAVGNSQRKFYGVQFHPEV 177

Query: 180 VHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAA 239
           VHT  G ++I+NF+  V     NW  S++ +E +++IKE+VG+  VIC +SGGVDS+VAA
Sbjct: 178 VHTPRGREIIENFLFRVCNCSGNWTASNFIEEQIAKIKEEVGDSHVICGLSGGVDSSVAA 237

Query: 240 FLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDP 299
            L++EAIG  LTC+ VDHG +RKNE E +   F    +  L  VDA +RF  KL+ + DP
Sbjct: 238 ALVHEAIGDQLTCIFVDHGLLRKNEAEEVKQTFGQEFDMNLISVDAQQRFFAKLEGVDDP 297

Query: 300 ETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGP--SSIIKSHHNVG 357
           E KRK+IG  FIEVF+EEA K+G  ++L QGT+Y DVIES    GG   S+ IKSHHNVG
Sbjct: 298 EEKRKIIGNEFIEVFDEEAGKLGDIEYLVQGTIYSDVIES----GGTDDSATIKSHHNVG 353

Query: 358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN 417
           GLPE M++KL+EPL+ +FKDEVR +G+EL +P   V R P PGPGL IR +GE+T +++ 
Sbjct: 354 GLPEDMNLKLIEPLRNIFKDEVREVGEELGIPAEIVWRQPFPGPGLGIRVLGEVTPDKVT 413

Query: 418 ILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMT 477
           I++E+DAI REEI KAG+ R+IWQ F  L P+++VGVMGDERTY Y   +RAV S D MT
Sbjct: 414 IVQEADAILREEIKKAGLNREIWQYFAALPPMRSVGVMGDERTYSYTIGIRAVKSKDAMT 473

Query: 478 ADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           AD+       L +++ RI NEVK +NRVVYDITSKPPATIEWE
Sbjct: 474 ADWAKLPHELLEKISTRITNEVKEVNRVVYDITSKPPATIEWE 516


>gi|59711245|ref|YP_204021.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio fischeri ES114]
 gi|75354446|sp|Q5E763|GUAA_VIBF1 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|59479346|gb|AAW85133.1| GMP synthetase (glutamine aminotransferase) [Vibrio fischeri ES114]
          Length = 517

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/512 (51%), Positives = 367/512 (71%), Gaps = 3/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       ++ NP  IILSG P S  + +S
Sbjct: 9   RILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + +S +P+ G+CYG Q M + LGGK   S  REFG A +++    +L K +   
Sbjct: 69  PRAPQYVFDSGVPVFGVCYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESALFKDL--- 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            + Q VWMSHGD+V  IP  F  IA +++ P+A +A+E++KYY VQFHPEV HT  G ++
Sbjct: 126 EATQDVWMSHGDKVVEIPSDFVKIAETETCPYAAMANEEKKYYGVQFHPEVTHTKNGMKM 185

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           ++NFV +V G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A L + AIG 
Sbjct: 186 LENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGD 245

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VD+G +R NE + ++ +F       +  V+A +RF+  L+   DPETKRK+IG 
Sbjct: 246 KLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIVHVNAEQRFLDALEGESDPETKRKIIGH 305

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M+M LV
Sbjct: 306 VFVDIFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLV 365

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR +DAI+ E
Sbjct: 366 EPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIFIE 425

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H   +FL
Sbjct: 426 ELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFL 485

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 486 GKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|149190080|ref|ZP_01868357.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio shilonii AK1]
 gi|148836110|gb|EDL53070.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Vibrio shilonii AK1]
          Length = 517

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/520 (51%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + +SP+ P+ + +S +P+LG+CYG Q M + LGG+   S  REFG A +++  + +
Sbjct: 61  ESVTEENSPRAPQYVFDSGVPVLGVCYGMQTMAEQLGGRVAGSNEREFGYAQVKVSGDSA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           + K +    + Q VWMSHGD+V  IP  F  +  +D+ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 IFKDL---EATQDVWMSHGDKVVEIPADFVKVGETDTCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NFV    G +  W   S  ++ V+RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKQGLQMLENFVLGACGCERLWTSESIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGDKLTCVFVDNGLLRLNEGQQVMEMFGDKFGLNIIKVDAEERFLTALEGQSDPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHAADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H   +FL +V+ RI+NEV+GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYDFLGKVSNRIINEVEGISRVVYDISGKPPATIEWE 517


>gi|260495481|ref|ZP_05815607.1| GMP synthase domain-containing protein [Fusobacterium sp. 3_1_33]
 gi|260197018|gb|EEW94539.1| GMP synthase domain-containing protein [Fusobacterium sp. 3_1_33]
          Length = 512

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 368/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFYEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPTLDIKLFQKNIPILGLCYGMQLITHLHGGKVARANKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +++ NFV  +A  + NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFEMLKNFVFGIAKAEKNWSMENYIETTVKKIKERVGNKKVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLP+ + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPKDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  ++RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMIDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|317154158|ref|YP_004122206.1| GMP synthase large subunit [Desulfovibrio aespoeensis Aspo-2]
 gi|316944409|gb|ADU63460.1| GMP synthase, large subunit [Desulfovibrio aespoeensis Aspo-2]
          Length = 514

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/514 (51%), Positives = 362/514 (70%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +++VLI+DFGSQFTQLIARRVRE+ +Y E+       +  K   P A+ILSG P+S L+ 
Sbjct: 3   NNRVLILDFGSQFTQLIARRVREAGIYSEIHPCNVDPERVKAFKPSALILSGGPSSVLEG 62

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
             P +  + L   +P+LGICYG Q++  ++GG+   S  RE+GRA  +   +C L +G+ 
Sbjct: 63  GCPALNMDYLAMGVPVLGICYGMQLLAHNMGGRVVASTDREYGRAQFKALNDCILFEGIE 122

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           +K     VWMSHGD+VE +P+GF  +  +DS  FA + D  RK YA+QFHPEV HT  G+
Sbjct: 123 DK-ENLTVWMSHGDRVEALPQGFVTMGRTDSIEFAAMGDPARKLYALQFHPEVAHTTDGA 181

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            +I NF+  VAG+   W M+S+    +  +K+QVG+ +V+  +SGG+DSTVAA L++ AI
Sbjct: 182 TIIQNFLFKVAGLTPTWSMASFVDTCIEDLKKQVGDAKVVLGLSGGIDSTVAAVLLHRAI 241

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G NL C+ VD+G +R  E E ++     + +  ++ VDAS  F+ KL  + DPE KRK+I
Sbjct: 242 GRNLHCIFVDNGLLRMGEKEEVVGFLAEHFDLNVKFVDASREFLDKLVGVTDPEQKRKII 301

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FI+VF+ EAK I G +FLGQGTLYPDVIES S F GPS++IKSHHNVGGLPE M +K
Sbjct: 302 GYTFIDVFDREAKAIEGVRFLGQGTLYPDVIESES-FKGPSAVIKSHHNVGGLPEKMHLK 360

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR    EL LP+  + R P PGPGL+IR IGE+++ER++ILR +D I 
Sbjct: 361 LVEPLRELFKDEVRRAAYELGLPEHIIWRQPFPGPGLSIRIIGEVSDERLSILRLADRIV 420

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
           + E+  +  YRK+WQ F VLLP++TVGVMGD+RTYE V +LR V S+D MTAD+      
Sbjct: 421 QNEMVASDWYRKVWQGFAVLLPLKTVGVMGDDRTYENVIALRIVDSLDAMTADWSRLPSE 480

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L++++ RI+NEVKG+NRVV DI+SKPP+TIEWE
Sbjct: 481 LLARISNRIINEVKGVNRVVLDISSKPPSTIEWE 514


>gi|304406346|ref|ZP_07388003.1| GMP synthase, large subunit [Paenibacillus curdlanolyticus YK9]
 gi|304344930|gb|EFM10767.1| GMP synthase, large subunit [Paenibacillus curdlanolyticus YK9]
          Length = 512

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/511 (50%), Positives = 365/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q+ QLIARR+R+  VY E++ +    +  +E NP+ I+ SG PAS  + +SP
Sbjct: 8   IVVLDFGGQYNQLIARRIRDLGVYSELLPYNTTAERLREINPKGIVFSGGPASVYEENSP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   + + N+P+ GICYG Q+M   L GK + +  RE+G+A ++     +L  G+    
Sbjct: 68  LVDPAVYDLNVPIFGICYGMQLMSHQLEGKVQRAGKREYGKAEVDFVSEFALTSGL---D 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +KQ VWMSH D V   P GF+V  S++  P A ++D  R ++AVQFHPEV H+  G+++I
Sbjct: 125 AKQTVWMSHSDLVVEPPAGFQVTGSTEHAPIAAMSDATRNFHAVQFHPEVRHSEYGNEMI 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+++V G + NW M+++ ++ +  I+EQVG++ V+CA+SGGVDS+V A LI++AIG  
Sbjct: 185 RNFLYNVCGCEGNWSMTTFIEDTIKDIREQVGDKNVLCALSGGVDSSVVAMLIHKAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK E E+++  F G  +  +  +DASERF+ KLK + DPE KRK+IG  
Sbjct: 245 LTCMFIDHGMLRKGEAESVMETFVGKFDMKVIKIDASERFLGKLKGVSDPEQKRKIIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VF+EE+ K+G   FL QGTLY D++ES +     +  IKSHHNVGGLPE M  +LVE
Sbjct: 305 FIYVFDEESAKLGDFAFLAQGTLYTDIVESGT---ATAQTIKSHHNVGGLPEDMKFELVE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVR +G E  LPD+ V+R P PGPGLAIR +GE+TE++++I+RESDAI R+E
Sbjct: 362 PLKALFKDEVRKVGSECGLPDAIVQRQPFPGPGLAIRVLGEVTEDKLHIVRESDAILRDE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 422 IAKAGLDREIWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLE 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV+ +NR+VYD+TSKPPATIEWE
Sbjct: 482 KISVRIVNEVENVNRIVYDVTSKPPATIEWE 512


>gi|115377691|ref|ZP_01464884.1| GMP synthase (glutamine-hydrolyzing) [Stigmatella aurantiaca
           DW4/3-1]
 gi|115365297|gb|EAU64339.1| GMP synthase (glutamine-hydrolyzing) [Stigmatella aurantiaca
           DW4/3-1]
          Length = 530

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/515 (53%), Positives = 361/515 (70%), Gaps = 3/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ+TQLIARRVRE  VYCE+       +  +   P+ IILSG PAS    
Sbjct: 18  AEKILILDFGSQYTQLIARRVRELGVYCEIHRPDLPAEQIRRFAPRGIILSGGPASVETE 77

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+    + ++ +P+LGICYG Q++ + LGGK   S  RE+G A +E+      L G +
Sbjct: 78  GSPRCDPFVFDAGVPVLGICYGLQLLAKLLGGKLDRSAHREYGNAEMEVLSARGPL-GEF 136

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G + +VWMSHGD+V+ +P GFE I  S ++PFA  A   + +Y +QFHPEVVHT  G 
Sbjct: 137 HPGERVKVWMSHGDRVDALPPGFEAIGRSGNSPFAAAAHTTKPFYGLQFHPEVVHTPQGK 196

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEA 245
            ++  F+     +   W M  + +E    I+ QVG E RVIC +SGGVDS+VAA L++ A
Sbjct: 197 AMLRAFLFSDCKVSGTWTMKGFIQEAEEAIRRQVGAEGRVICGLSGGVDSSVAALLLHRA 256

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L C+ VD+G +R++E   + +LF    + PL+ VDA ERF++KL  + DPE KRK 
Sbjct: 257 IGPRLQCIFVDNGLLRQDERAQVEALFVDRFHVPLKTVDARERFLQKLAGVTDPEKKRKT 316

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FI VFEE A+++  A FL QGTLYPDVIES+S+  GPS  IKSHHNVGGLPE M +
Sbjct: 317 IGREFIAVFEEAAREVQDAGFLAQGTLYPDVIESVSY-KGPSVTIKSHHNVGGLPEQMKL 375

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR+LG+EL LP+  V R P PGPGLAIR +GE+TE R+ ++R +DAI
Sbjct: 376 KLVEPLRELFKDEVRVLGRELGLPEEMVNRQPFPGPGLAIRVLGEVTETRLALVRRADAI 435

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
            +EEI  AG+Y ++WQAF VLLPVQ+VGVMGDERTYE  C LRAVTS+DGMTAD+     
Sbjct: 436 VQEEIRTAGLYTELWQAFAVLLPVQSVGVMGDERTYESTCVLRAVTSVDGMTADWARLPY 495

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L +++ RI NEV+GINRVV DI+SKPPATIEWE
Sbjct: 496 PVLERISTRITNEVRGINRVVLDISSKPPATIEWE 530


>gi|260655872|ref|ZP_05861341.1| GMP synthase [Jonquetella anthropi E3_33 E1]
 gi|260629488|gb|EEX47682.1| GMP synthase [Jonquetella anthropi E3_33 E1]
          Length = 509

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/513 (51%), Positives = 367/513 (71%), Gaps = 7/513 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
            ++IID GSQFTQLIARR+RE  V+ E+I     LD  K + P+ +I+SG P S LD  S
Sbjct: 3   NIVIIDCGSQFTQLIARRIREMHVHSEIIPAGCTLDEVKSRQPKGLIISGGPKSVLDQGS 62

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKGMWE 127
           P++P       +P+LG+CYG Q+M +  GG  + S++RE+GR  + I+ K+C++  G+ +
Sbjct: 63  PRVPDGFFYLGVPILGVCYGMQLMARLFGGVVRRSKAREYGRGHVSIQDKSCAIFAGLPD 122

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
                QVWMSHGD VE IP  F + A SD    A    +  ++ A+Q+HPEV HT GG +
Sbjct: 123 S---FQVWMSHGDDVEKIPPDFVLTAQSDDGVVAGFRSKDGRFNALQYHPEVAHTQGGEK 179

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF++ + G + +W +  +     + I  +VGN++VIC +SGGVDS+VAA L+  AIG
Sbjct: 180 MLHNFIYDICGCKGDWQLGDWISIAQADIDAKVGNDKVICGLSGGVDSSVAAALVSRAIG 239

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
             L C+ V++G +R+NE E ++  +K      +  VDASE+F+  L  +++PE KRK+IG
Sbjct: 240 DRLECIFVNNGLLRQNEAEEVLESYKQM-KLNVHYVDASEQFLSALTGVIEPERKRKIIG 298

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKL 367
           + FI VFEE+A+KI GA++L QGTLYPDVIES +  G  + +IKSHHNVGGLP+ M+M L
Sbjct: 299 ETFIRVFEEQARKIKGARWLLQGTLYPDVIESGARKG--ADVIKSHHNVGGLPQDMNMNL 356

Query: 368 VEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYR 427
           +EPL++LFKDEVR LG+ L LP++ V RHP PGPGLA+RC+G+IT+E++N+LR++D I+ 
Sbjct: 357 LEPLRDLFKDEVRALGRLLGLPENIVRRHPFPGPGLAVRCLGDITKEKLNVLRQADHIFL 416

Query: 428 EEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNF 487
           EEI  AG+Y +IWQAF VLLPV TVGVMGDERTY  VC+LRA+TS DGMTA++Y    + 
Sbjct: 417 EEIRAAGLYDQIWQAFAVLLPVFTVGVMGDERTYARVCALRAITSSDGMTAEWYPMPHSV 476

Query: 488 LSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           L +V+ RI NEV+GINRVVYD TSKPPAT+EWE
Sbjct: 477 LDRVSTRICNEVRGINRVVYDCTSKPPATVEWE 509


>gi|283832117|ref|ZP_06351858.1| GMP synthase [Citrobacter youngae ATCC 29220]
 gi|291071745|gb|EFE09854.1| GMP synthase [Citrobacter youngae ATCC 29220]
          Length = 525

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/517 (50%), Positives = 366/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+ G+CYG Q M   LGG  + S  REFG A +E++ + +L++G+ + 
Sbjct: 69  PRAPEYVFNAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVQTDSALIRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            + +      VWMSHGD+V  IPEGF  +AS+DS PFA +A E++++Y VQFHPEV HT 
Sbjct: 129 LTAEGKPLLDVWMSHGDKVTAIPEGFVTVASTDSCPFAIMAHEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI+EQVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVVRIREQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  V+   RF+  LK   DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVEGESRFLEALKGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|295402654|ref|ZP_06812599.1| GMP synthase, large subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312112492|ref|YP_003990808.1| GMP synthase, large subunit [Geobacillus sp. Y4.1MC1]
 gi|294975311|gb|EFG50944.1| GMP synthase, large subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311217593|gb|ADP76197.1| GMP synthase, large subunit [Geobacillus sp. Y4.1MC1]
          Length = 512

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 273/516 (52%), Positives = 359/516 (69%), Gaps = 6/516 (1%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           ++   ++++DFGSQ+ QLI RR+RE  VY E+       D  +E N + II SG P S  
Sbjct: 3   QKQEMIIVLDFGSQYNQLITRRIRELGVYSELHPHTITADKIQEMNAKGIIFSGGPNSVY 62

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           D ++     +I E  +P+LGICYG Q+M   LGGK + +  RE+G+A I++K   +L K 
Sbjct: 63  DDNAFACDPQIFELGLPILGICYGMQLMTHHLGGKVEKATHREYGKAMIQVKNASALFKR 122

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +     +Q VWMSHGD V   PEGF V A+S S P A +++E +K+YAVQFHPEV H+V 
Sbjct: 123 L---PDEQVVWMSHGDLVTAPPEGFAVDATSASCPIAAMSNEAKKFYAVQFHPEVRHSVY 179

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G+ ++ NFV  V   + +W M S+    V +I+E VG+++V+CA+SGGVDS+VAA L++ 
Sbjct: 180 GNDILRNFVFDVCQCKGDWTMGSFIDSEVRKIRELVGDKKVLCALSGGVDSSVAAVLVHR 239

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VDHG +RK E E+++  F+      +  VDA ERF+ KLK ++DPE KRK
Sbjct: 240 AIGDQLTCIFVDHGLLRKGEAESVMKTFREGFQMNVIKVDAKERFLSKLKGVIDPEQKRK 299

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG  FI VF++EA K+ G +FL QGTLY D+IES +     +  IKSHHNVGGLPE M 
Sbjct: 300 IIGNEFIYVFDDEAAKLEGIEFLVQGTLYTDIIESGT---ATAQTIKSHHNVGGLPEDMK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            KL+EPLK LFKDEVR LG EL LPD  V R P PGPGL IR +GE+TEE++ I+RESDA
Sbjct: 357 FKLIEPLKTLFKDEVRALGTELGLPDEIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I REEI KAG+ R+IWQ FTVL  +++VGVMGD RTY+Y   +RAVTS+DGMTAD+    
Sbjct: 417 ILREEIKKAGLDREIWQYFTVLPDIRSVGVMGDARTYDYTVGIRAVTSVDGMTADWARIP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              L +++ RIVNEV  +NRVVYDITSKPPATIEWE
Sbjct: 477 WEVLEKISTRIVNEVPHVNRVVYDITSKPPATIEWE 512


>gi|257462948|ref|ZP_05627353.1| GMP synthase [Fusobacterium sp. D12]
 gi|317060567|ref|ZP_07925052.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. D12]
 gi|313686243|gb|EFS23078.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. D12]
          Length = 512

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 368/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KECSIVILDFGSQYNQLIARRVREMGVYAEVVPFYEPVDKILARKPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSLLKG 124
             +P + K + + NIP+LG+CYG Q++    GG+   ++ +EFG+A + I +K  +L   
Sbjct: 62  EGAPTLDKTLFDHNIPVLGLCYGMQLVTHLFGGEVARAEKQEFGKAELIIDEKEAALFDN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +  +VWMSHGD V  I EGF  IA +DS   A + + ++  YA QFHPEV H+  
Sbjct: 122 I---PNNTKVWMSHGDHVTRIAEGFHAIAHTDSC-IAAVVNPEKNIYAFQFHPEVTHSEH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  VA  + NW M +Y +  +  I+E+VG+++VI  +SGGVDS+VAA LI++
Sbjct: 178 GRDMLQNFVLEVAKCEKNWSMDNYIESTIKVIQEKVGDKKVILGLSGGVDSSVAATLIHK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RKNE + ++ ++  + +  ++ V+A ERF+ KLK + DPE KRK
Sbjct: 238 AIGDQLTCIFVDTGLLRKNEAKTVMEVYSEHFHMNIKCVNAEERFLSKLKGVSDPEQKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ FIEVF EEAKK   A+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE M 
Sbjct: 298 IIGKEFIEVFNEEAKKFEDAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDMK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G++L +P   ++RHP PGPGL +R +G+IT+E+ +ILRE+D 
Sbjct: 357 FQLLEPLRELFKDEVREVGRQLGIPHHMIDRHPFPGPGLGVRILGDITKEKADILREADD 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KAG+Y K+ QAF VLLPVQ+VGVMGDERTYEYV +LR+V +ID MTA + H  
Sbjct: 417 IFIEELRKAGLYGKVSQAFVVLLPVQSVGVMGDERTYEYVAALRSVNTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 FEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|310821570|ref|YP_003953928.1| gmp synthase [Stigmatella aurantiaca DW4/3-1]
 gi|309394642|gb|ADO72101.1| GMP synthase [Stigmatella aurantiaca DW4/3-1]
          Length = 517

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/515 (53%), Positives = 361/515 (70%), Gaps = 3/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ+TQLIARRVRE  VYCE+       +  +   P+ IILSG PAS    
Sbjct: 5   AEKILILDFGSQYTQLIARRVRELGVYCEIHRPDLPAEQIRRFAPRGIILSGGPASVETE 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            SP+    + ++ +P+LGICYG Q++ + LGGK   S  RE+G A +E+      L G +
Sbjct: 65  GSPRCDPFVFDAGVPVLGICYGLQLLAKLLGGKLDRSAHREYGNAEMEVLSARGPL-GEF 123

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
             G + +VWMSHGD+V+ +P GFE I  S ++PFA  A   + +Y +QFHPEVVHT  G 
Sbjct: 124 HPGERVKVWMSHGDRVDALPPGFEAIGRSGNSPFAAAAHTTKPFYGLQFHPEVVHTPQGK 183

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEA 245
            ++  F+     +   W M  + +E    I+ QVG E RVIC +SGGVDS+VAA L++ A
Sbjct: 184 AMLRAFLFSDCKVSGTWTMKGFIQEAEEAIRRQVGAEGRVICGLSGGVDSSVAALLLHRA 243

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L C+ VD+G +R++E   + +LF    + PL+ VDA ERF++KL  + DPE KRK 
Sbjct: 244 IGPRLQCIFVDNGLLRQDERAQVEALFVDRFHVPLKTVDARERFLQKLAGVTDPEKKRKT 303

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FI VFEE A+++  A FL QGTLYPDVIES+S+  GPS  IKSHHNVGGLPE M +
Sbjct: 304 IGREFIAVFEEAAREVQDAGFLAQGTLYPDVIESVSY-KGPSVTIKSHHNVGGLPEQMKL 362

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ELFKDEVR+LG+EL LP+  V R P PGPGLAIR +GE+TE R+ ++R +DAI
Sbjct: 363 KLVEPLRELFKDEVRVLGRELGLPEEMVNRQPFPGPGLAIRVLGEVTETRLALVRRADAI 422

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
            +EEI  AG+Y ++WQAF VLLPVQ+VGVMGDERTYE  C LRAVTS+DGMTAD+     
Sbjct: 423 VQEEIRTAGLYTELWQAFAVLLPVQSVGVMGDERTYESTCVLRAVTSVDGMTADWARLPY 482

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L +++ RI NEV+GINRVV DI+SKPPATIEWE
Sbjct: 483 PVLERISTRITNEVRGINRVVLDISSKPPATIEWE 517


>gi|253689372|ref|YP_003018562.1| GMP synthase, large subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259647686|sp|C6DBG3|GUAA_PECCP RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|251755950|gb|ACT14026.1| GMP synthase, large subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 525

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/517 (50%), Positives = 366/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +  NP  IILSG P S+ +  S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M   LGG  + S  REFG A +E+K + +L++ + + 
Sbjct: 69  PRAPEYVFNAGVPVLGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVKTDSALVRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IPEGFE +AS+D+ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LSATGAPLLDVWMSHGDKVTAIPEGFETVASTDTCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVGN++VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVRDICQCEALWTPAKIIDDAVTRIREQVGNDQVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F  +    +  V A +RF+ +L    DPE KR
Sbjct: 249 RAIGDRLTCVFVDNGLLRLNEADQVLEMFGDHFGLNIVHVAAEDRFLGELAGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEASKQTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|226326332|ref|ZP_03801850.1| hypothetical protein PROPEN_00180 [Proteus penneri ATCC 35198]
 gi|225205283|gb|EEG87637.1| hypothetical protein PROPEN_00180 [Proteus penneri ATCC 35198]
          Length = 525

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEDNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LGICYG Q M   LGG  + S  REFG + +EI++ C+L   + + 
Sbjct: 69  PRAPEYVFNAGVPVLGICYGMQTMSMQLGGDVEVSGEREFGYSQVEIRETCALFNDIQDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S+       VWMSHGD+V  IP  F  +AS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSEDGKPLLDVWMSHGDKVTAIPSDFVTVASTETCPFAIMANEEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  + G    W  ++  ++ V+R+KEQ+G++ VI A+SGGVDS+V A L+ 
Sbjct: 189 QGLAILKRFVLDICGCDALWTSAAIIEDTVARLKEQIGDDHVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +FKG  +  +  V+A +RF+  LK   DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEAEQVMEMFKGKFDLNIIHVEAEDRFLTALKGENDPEKKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  FIE+F+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KIIGHTFIEIFDEEAVKQPQVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV ++D MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETVDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVSGISRVVYDISGKPPATIEWE 525


>gi|262276498|ref|ZP_06054307.1| GMP synthase [glutamine-hydrolyzing] [Grimontia hollisae CIP
           101886]
 gi|262220306|gb|EEY71622.1| GMP synthase [glutamine-hydrolyzing] [Grimontia hollisae CIP
           101886]
          Length = 525

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/525 (51%), Positives = 369/525 (70%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +     ++LI+DFGSQ+TQLIARR+RE  VYCE+  +       ++ NP  IILSG P
Sbjct: 1   MTQNIHDQRILILDFGSQYTQLIARRIREIGVYCELWGWDVDEQDIRDFNPNGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  +  SP+ P+ +  + +P+LG+CYG Q M + LGGK   S  REFG A + +    S
Sbjct: 61  ESVTEAGSPRAPEYVFNAGVPVLGVCYGMQTMSEQLGGKVAGSTEREFGYAKVTLDNAGS 120

Query: 121 LLKGMWEKGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQF 175
           L +G+ +  ++       VWMSHGD+V  IP  F  +AS+DS PFA +A+E++++Y VQF
Sbjct: 121 LFEGIEDAINEDGKGVLDVWMSHGDKVVEIPADFVKVASTDSCPFAAMANEEKRFYGVQF 180

Query: 176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS 235
           HPEV HT  G ++++ FV  + G +  W  +S  ++ ++RIKEQVG++ VI  +SGGVDS
Sbjct: 181 HPEVTHTRQGHRMLERFVLDICGCERLWTPASIIEDAIARIKEQVGDDEVILGLSGGVDS 240

Query: 236 TVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN 295
           +V A LI+ AIG  LTCV VD+G +R NE + ++ +F  +    +  VDA ERF+  L+ 
Sbjct: 241 SVVAMLIHRAIGDKLTCVFVDNGLLRLNEAQQVMEMFGDHFGLNIIHVDAEERFLSALEG 300

Query: 296 IVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
           I DPE KRK IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHN
Sbjct: 301 ISDPEEKRKKIGHVFVDVFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHN 360

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLP+ M+M LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E 
Sbjct: 361 VGGLPDDMEMGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEY 420

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
            ++LR +DAI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID 
Sbjct: 421 CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF 480

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTA + H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 481 MTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525


>gi|332290472|ref|YP_004421324.1| GMP synthase [Gallibacterium anatis UMN179]
 gi|330433368|gb|AEC18427.1| GMP synthase [Gallibacterium anatis UMN179]
          Length = 519

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/512 (51%), Positives = 361/512 (70%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ+TQLIARRVRE  VYCE+ A+       ++ NP  IILSG P S+ + +S
Sbjct: 8   KILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQIRDFNPTGIILSGGPESTTEDNS 67

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  +N+P+LGICYG Q M   LGG T++S  REFG A + +K   +L K + + 
Sbjct: 68  PRAPEYVFNANVPVLGICYGMQTMAMQLGGLTESSDHREFGYASVALKNETALFKDLNDG 127

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
             K  VWMSHGD+V  +P  F+V  S+ + P A +++EKR +Y VQFHPEV HT  G  L
Sbjct: 128 EHKLDVWMSHGDKVTKLPPEFQVTGSTPTCPIAAMSNEKRHFYGVQFHPEVTHTQSGLAL 187

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           + NFV  + G + NW   +  ++ V+RIK QVG++ VI  +SGGVDS+V A L++ AIG 
Sbjct: 188 LTNFVVDICGCERNWTPENIIEDAVARIKAQVGDDEVILGLSGGVDSSVTALLLHRAIGK 247

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
           NL CV VD+G +R NE + ++ +F       +  VDA +RF+  LK I DPE KRK IG+
Sbjct: 248 NLHCVFVDNGLLRLNEADQVMEMFGDKFGLNIIRVDAEDRFLNALKGIEDPEAKRKTIGK 307

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           +F++VF++E+KK+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP++M + LV
Sbjct: 308 VFVDVFDDESKKLTSVKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDYMKLGLV 367

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G  L LP   + RHP PGPGL +R +GEI +E  ++LR +DAI+ E
Sbjct: 368 EPLRELFKDEVRKIGLALGLPAEMLNRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIFIE 427

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E++KA  Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H   + L
Sbjct: 428 ELYKADWYYKVSQAFTVFLPVKSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDLL 487

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 488 GKISNRIINEVDGISRVVYDVSGKPPATIEWE 519


>gi|327537782|gb|EGF24487.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Rhodopirellula baltica WH47]
          Length = 506

 Score =  551 bits (1420), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/509 (51%), Positives = 355/509 (69%), Gaps = 3/509 (0%)

Query: 12  IIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQI 71
           ++DFGSQ+ QLIARRVRE  VYC+++    + +   E  P+ IILSG P S  +  +P+ 
Sbjct: 1   MLDFGSQYAQLIARRVREQNVYCQIVRHDISAERIAELAPKGIILSGGPNSVYEEGAPKC 60

Query: 72  PKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSK 131
            + + +  IP+LGICYG Q+ CQ+LGGK  N+ SRE+GRA  E     S+ +GM E    
Sbjct: 61  DEGLFDLGIPVLGICYGMQLACQALGGKVDNTPSREYGRAMCEFTDRDSIFRGMQES--- 117

Query: 132 QQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDN 191
           +QVWMSHGDQV  I + F  +A + + P+A I   +R  + +QFHPEV HT  G Q++ N
Sbjct: 118 EQVWMSHGDQVSQIADQFTAMAKTSTCPYAAIRHNERPVFGMQFHPEVTHTPHGGQILRN 177

Query: 192 FVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLT 251
           FV  V G   +W +  +    +  I++QVGN+RVIC +SGGVDS+V A L+Y+AIG  L+
Sbjct: 178 FVIDVCGCDGSWKLGDFADAAIESIRKQVGNKRVICGLSGGVDSSVVAALLYKAIGPQLS 237

Query: 252 CVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFI 311
           C+LVD+G +RKNE + ++  F  +    L +V+A +RF+  L  I +P+ KR+ IG  FI
Sbjct: 238 CILVDNGLLRKNEQQIVLEEFSNHFKTDLHIVEAEDRFLADLAGIDEPQEKRRRIGHAFI 297

Query: 312 EVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPL 371
           E F++EA KI  A FL QGTLYPDVIES +   GP++ IK HHNVGGLPE +  +L+EPL
Sbjct: 298 ECFKDEAAKIEDAHFLAQGTLYPDVIESGADKDGPAATIKLHHNVGGLPEELGFELIEPL 357

Query: 372 KELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIH 431
           ++LFKDEVR LG EL LP+  V RHP PGPGLA+RC+GEIT +++ +LRE+DAI  EEI 
Sbjct: 358 RDLFKDEVRRLGLELGLPEQLVWRHPFPGPGLAVRCLGEITRDKLVVLREADAIVVEEIE 417

Query: 432 KAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQV 491
            AG+YR+  QAF VLLPVQ+VGVMGD RTY+   ++R V + D MTAD+ H     L+++
Sbjct: 418 NAGLYRETSQAFAVLLPVQSVGVMGDARTYDNAVAVRCVNTDDFMTADWSHLPYELLARI 477

Query: 492 AIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + RI+NEVKG+NRV YDI+SKPPATIEWE
Sbjct: 478 STRIINEVKGVNRVCYDISSKPPATIEWE 506


>gi|146296983|ref|YP_001180754.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|259647688|sp|A4XKX8|GUAA_CALS8 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|145410559|gb|ABP67563.1| GMP synthase (glutamine-hydrolyzing) [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 511

 Score =  551 bits (1420), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 366/512 (71%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVRE  VYCE+  +   L+   E+NP+ II +G P+S  + ++P
Sbjct: 6   VIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIIEKNPKGIIFTGGPSSVYEENAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            + K+I E  +P+LGICYG Q++   LGGK   +  RE+G+  I+   N  L  G+ E  
Sbjct: 66  VVDKKIFEIGVPILGICYGNQLIAYFLGGKVSTALFREYGKTHIKYNTNSPLFTGLPESS 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
                WMSH D VE +PEGFE++AS+++   A     ++K Y VQFHPEVVHT  G ++I
Sbjct: 126 I---CWMSHTDFVEELPEGFEILASTENCAIAAFGSREKKIYGVQFHPEVVHTEFGQEII 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+ ++ G + +W  SS+ +E ++ I++ VGN++V+CA+SGGVDS+VAA L+++AIG N
Sbjct: 183 KNFLFNICGCKGDWKTSSFIEERINEIRKIVGNQKVVCALSGGVDSSVAAVLVHKAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L C+ VDHG +RK E E +I  FKG  +  +  VDA ERF++ L  ++DPE KRK+IG+ 
Sbjct: 243 LFCIFVDHGLLRKGEAEEVIKTFKGQFDMNVIKVDAKERFLKALCGVIDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM-KLV 368
           FI VFEEEA K+G  +FL QGT+YPDV+ES     G ++ IKSHHNVGGLPEH+   +++
Sbjct: 303 FIRVFEEEASKLGDVKFLVQGTIYPDVVESGV---GKAATIKSHHNVGGLPEHIKFERII 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G EL +P+  V+R P PGPGLAIR IGE+TEE++ ILRE D I+R+
Sbjct: 360 EPLRELFKDEVRRVGVELGIPEKIVKRQPFPGPGLAIRIIGEVTEEKLEILREVDWIFRK 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI   G+  +IWQ F VL  +++VGVMGDERTY+Y  +LRAVTS+DGMTAD+     + L
Sbjct: 420 EIEACGLDEEIWQYFAVLTDMRSVGVMGDERTYDYTVALRAVTSVDGMTADWARIPYDVL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+  IVN V+ +NRVVYDITSKPPATIEWE
Sbjct: 480 ERVSNEIVNTVRKVNRVVYDITSKPPATIEWE 511


>gi|197334330|ref|YP_002155395.1| gmp synthase (glutamine-hydrolyzing) [Vibrio fischeri MJ11]
 gi|226739763|sp|B5FAY1|GUAA_VIBFM RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|197315820|gb|ACH65267.1| gmp synthase (glutamine-hydrolyzing) [Vibrio fischeri MJ11]
          Length = 517

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/512 (51%), Positives = 366/512 (71%), Gaps = 3/512 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARR+RE  VYCE+ ++       ++ NP  IILSG P S  + +S
Sbjct: 9   RILILDFGSQYTQLVARRIREIGVYCELWSWDVEESDIRDFNPDGIILSGGPESVTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + +S +P+ G+CYG Q M + LGGK   S  REFG A +++    +L K +   
Sbjct: 69  PRAPQYVFDSGVPVFGVCYGMQTMAEQLGGKVATSTEREFGYAAVQVTGESALFKDL--- 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            + Q VWMSHGD+V  IP  F  IA +++ P+A +A+E++KYY VQFHPEV HT  G ++
Sbjct: 126 EATQDVWMSHGDKVVEIPSDFVKIAETETCPYAVMANEEKKYYGVQFHPEVTHTKNGMKM 185

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           ++NFV +V G +  W  +S  ++ V+RIKEQVG++ VI  +SGGVDS+V A L + AIG 
Sbjct: 186 LENFVLNVCGCEGLWTSASIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLAHRAIGD 245

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VD+G +R NE + ++ +F       +  V+A +RF+  L+   DPE KRK+IG 
Sbjct: 246 KLTCVFVDNGLLRLNEADQVMEMFGNKFGLNIIHVNAEQRFLDALEGESDPEVKRKIIGH 305

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           +F+++F+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M+M LV
Sbjct: 306 VFVDIFDEESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDMEMGLV 365

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GEI +E  ++LR +DAI+ E
Sbjct: 366 EPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRADAIFIE 425

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H   +FL
Sbjct: 426 ELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFL 485

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 486 GKVSNRIINEVNGISRVVYDISGKPPATIEWE 517


>gi|296327752|ref|ZP_06870291.1| GMP synthase (glutamine-hydrolyzing) [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|296155099|gb|EFG95877.1| GMP synthase (glutamine-hydrolyzing) [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 512

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 368/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ ++NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPSLDIKLFQNNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NF+  +A  + NW M +Y +  V +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFIFGIAKAEKNWSMENYIETTVKQIKERVGNKQVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGRQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILR++DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILRKADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|82702328|ref|YP_411894.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Nitrosospira multiformis ATCC 25196]
 gi|91206811|sp|Q2Y9R9|GUAA_NITMU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|82410393|gb|ABB74502.1| GMP synthase (glutamine-hydrolyzing) [Nitrosospira multiformis ATCC
           25196]
          Length = 522

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 271/517 (52%), Positives = 358/517 (69%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ+TQLIARRVRES  YCE+  F  +  +     P  IILSG PAS  + ++
Sbjct: 6   KILILDFGSQYTQLIARRVRESNAYCEIHPFDISSQFIGNFAPAGIILSGGPASVAENET 65

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E  +P++GICYG Q M   LGG  +NS+ REFG A +++K    LL+ + ++
Sbjct: 66  PRAPQIVFELGVPVMGICYGMQTMAAQLGGSVENSKVREFGYAELQVKNLAGLLQDIHDR 125

Query: 129 --GSKQQ---VWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
              S+Q+   VWMSHGD V  +P GF+V+AS+ +TP A IAD  R++Y +QFHPEV HT 
Sbjct: 126 TDASRQKLLDVWMSHGDSVNTLPPGFQVMASNPATPLAAIADGARRFYGMQFHPEVTHTP 185

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  +ID FVH + G+  +W M  Y +E+V RI+ +VG + VI  +SGGVDS+VAA LI+
Sbjct: 186 QGKAIIDRFVHEICGLAYDWNMPDYLEEMVGRIRSEVGPDEVILGLSGGVDSSVAAALIH 245

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++  F       +  VDASE F+  L+ I DPE KR
Sbjct: 246 RAIGKQLTCVFVDNGLLRLNEAEQVMDTFSRNLGVKVIHVDASEEFLGHLQGITDPEAKR 305

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           ++IG+ F+EVF+ EA KI  A++L QGT+YPDVIES       ++ IKSHHNVGGLPE +
Sbjct: 306 RIIGREFVEVFQREAAKIANARWLAQGTIYPDVIESAGAKTKKANTIKSHHNVGGLPETL 365

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            +KL+EPL+ELFKDEVR LG  L LP   V RHP PGPGL +R +GE+  E   +LR +D
Sbjct: 366 HLKLLEPLRELFKDEVRELGLTLGLPHDMVFRHPFPGPGLGVRILGEVKREYAELLRRAD 425

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+  AG Y K  QAF V LPV++VGVMGD RTY++V +LRAV + D MTA +   
Sbjct: 426 AIFIEELRNAGWYEKTSQAFAVFLPVKSVGVMGDGRTYDFVVALRAVQTEDFMTARWAEL 485

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L++++ RIVNEV+GINRVVYDI+ KPPATIEWE
Sbjct: 486 PYALLARISSRIVNEVRGINRVVYDISGKPPATIEWE 522


>gi|294784941|ref|ZP_06750229.1| GMP synthase [Fusobacterium sp. 3_1_27]
 gi|294486655|gb|EFG34017.1| GMP synthase [Fusobacterium sp. 3_1_27]
          Length = 512

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 269/516 (52%), Positives = 366/516 (70%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAKEPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPTLDIKLFQKNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKD 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  +A  + NW M +Y +  + +IKE+VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFVFGIAKAEKNWSMENYIETTIKKIKERVGNKKVILGLSGGVDSSVAATLINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  I DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGITDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAK+I GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKRIEGAKFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T+E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTKEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ K  +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKTDLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|83814385|ref|YP_446181.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Salinibacter ruber DSM 13855]
 gi|294508107|ref|YP_003572165.1| GMP synthase [glutamine-hydrolyzing] [Salinibacter ruber M8]
 gi|123528343|sp|Q2S0V0|GUAA_SALRD RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|83755779|gb|ABC43892.1| glutamine-hydrolyzing GMP synthase [Salinibacter ruber DSM 13855]
 gi|294344435|emb|CBH25213.1| GMP synthase [glutamine-hydrolyzing] [Salinibacter ruber M8]
          Length = 526

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/525 (50%), Positives = 354/525 (67%), Gaps = 13/525 (2%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
            K++++DFGSQ+TQLIARRVRE+ VY E+       D     NP  +ILSG P S  D  
Sbjct: 3   DKIVVLDFGSQYTQLIARRVRETGVYSEIRPCTVEADAIDALNPSGVILSGGPCSVYDEA 62

Query: 68  SPQIPKEILE------SNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSL 121
            P +   +LE      + +PLLGICYG Q M    GG+   +  REFGRA +++  +   
Sbjct: 63  GPALDPALLELERPDGTPVPLLGICYGLQAMAHQFGGEVARADRREFGRAQLQVPPDGQE 122

Query: 122 LKGMWEK-GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
              ++E   S   VWMSH D +  +P+G+EVIA +D+ P A + D    YY VQFHPEVV
Sbjct: 123 KSLLFEGVPSGSTVWMSHSDHLTDLPDGYEVIARTDNAPVAAVRDTDGPYYGVQFHPEVV 182

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G Q+++NF H + G   +W  +S+ +E    I+++VG+  VI  +SGGVDS+VAA 
Sbjct: 183 HTDYGRQILENFAHAICGCSGDWTPASFVEEQTETIRDRVGDRHVILGLSGGVDSSVAAA 242

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L+  A+G  L C+ V++G +RK E   +   F+G+    LR  DA++RF+ +L  + DPE
Sbjct: 243 LLQRALGDQLHCIFVNNGLLRKGEWNQVQDTFRGHFEMDLRTTDATDRFLERLDGVTDPE 302

Query: 301 TKRKVIGQLFIEVFEEEAKKIGG-----AQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
            KR ++G  FIEVFEE+ + I         +L QGTLYPD+IES+SF  GPS  IK+HHN
Sbjct: 303 EKRTIVGNTFIEVFEEQTEAIAADLGHRPTYLAQGTLYPDLIESVSF-KGPSVTIKTHHN 361

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLPE +D  L+EP +ELFKDEVR +G+ L +PD  V RHP PGPGLAIR +G+IT ER
Sbjct: 362 VGGLPEELDFDLIEPFRELFKDEVREIGRLLDVPDPIVGRHPFPGPGLAIRILGQITRER 421

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
           + +LRE+DAI+ EE+    +Y ++WQAF VLLPVQ VGVMGDERTYE VC+LRAVTS+DG
Sbjct: 422 LALLREADAIFIEELRANDLYDEVWQAFAVLLPVQAVGVMGDERTYENVCALRAVTSVDG 481

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTAD+ H   +FL  V+ RIVNEV GINR+VYD++SKPPATIEWE
Sbjct: 482 MTADWAHLPHDFLGHVSNRIVNEVPGINRIVYDVSSKPPATIEWE 526


>gi|261404771|ref|YP_003241012.1| GMP synthase large subunit [Paenibacillus sp. Y412MC10]
 gi|261281234|gb|ACX63205.1| GMP synthase, large subunit [Paenibacillus sp. Y412MC10]
          Length = 512

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/511 (50%), Positives = 365/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q+ QLIARR+R+  VY E++ +   ++  K+ +P+ I+ SG P+S    ++P
Sbjct: 8   IVVLDFGGQYNQLIARRIRDLGVYSELLPYNTPVEKIKDLSPRGIVFSGGPSSVYSENAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   I +  +P+ GICYG Q+M Q L GK + +  RE+G+A +E   N +L+KG+ +K 
Sbjct: 68  HVDPAIYDLGLPIFGICYGMQLMAQQLDGKVERASKREYGKAELEFAPNSTLVKGIEQK- 126

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q VWMSHGD V  +P GF++ A ++S P A +++E +K YAVQFHPEV H+V G+++I
Sbjct: 127 --QTVWMSHGDHVVSLPSGFKLDAGTESAPIAAMSNEDKKLYAVQFHPEVRHSVHGNEMI 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V G + NW M ++ ++ V  I+E VG ++V+CA+SGGVDS+V A LI++AIG  
Sbjct: 185 KNFLYEVCGCEGNWSMETFIEDQVREIREVVGEKKVLCALSGGVDSSVVAMLIHKAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK E E+++  F G  +  +  +DA ERF+ KLK + DPE KRK+IG  
Sbjct: 245 LTCMFIDHGLLRKGEAESVMETFVGKFDMKVVKIDAQERFMSKLKGVDDPEKKRKIIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VF+EE+ K     FL QGTLY D++ES +     +  IKSHHNVGGLPE M  +L+E
Sbjct: 305 FIYVFDEESSKFDDFAFLAQGTLYTDIVESGT---DTAHTIKSHHNVGGLPEDMKFELIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVR +G+EL LPD  V R P PGPGLAIR +GE+TE+++ I+R+SD I REE
Sbjct: 362 PLKALFKDEVRKVGEELGLPDEIVHRQPFPGPGLAIRVLGEVTEDKLQIVRDSDYILREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 422 IAKAGLDREIWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLE 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV+ +NR+VYD+TSKPPATIEWE
Sbjct: 482 KISVRIVNEVENVNRIVYDVTSKPPATIEWE 512


>gi|91792628|ref|YP_562279.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Shewanella denitrificans OS217]
 gi|123061095|sp|Q12PS0|GUAA_SHEDO RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|91714630|gb|ABE54556.1| GMP synthase (glutamine-hydrolyzing) [Shewanella denitrificans
           OS217]
          Length = 525

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/518 (51%), Positives = 367/518 (70%), Gaps = 6/518 (1%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ+TQLIARR+RE  VYCE+ A+  +    +E NPQ IIL+G P S    +S
Sbjct: 8   KILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFNPQGIILAGGPESVTAENS 67

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKT-KNSQSREFGRAFIEIKKNCSLLKGMWE 127
           P+ P+ +  + +P+LGICYG Q M + LGGK  +     EFG A +E+    +L KG+ +
Sbjct: 68  PRAPEYVFNAGVPVLGICYGMQTMSEQLGGKVIQGVGEGEFGYAQVEMLLESALFKGIED 127

Query: 128 KGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHT 182
             S        VWMSHGD+V  IPEGF+ +A +D+ PFA +A+E++++Y VQFHPEV HT
Sbjct: 128 AISPAGRPLLDVWMSHGDKVSAIPEGFKAVAKTDTCPFAAMANEEKRFYGVQFHPEVTHT 187

Query: 183 VGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLI 242
             G +++++F   + G   NW  SS  ++ + RIK QVG++ VI  +SGGVDS+V A L+
Sbjct: 188 RQGLRMLEHFAVAICGCGTNWKPSSIIEDAIERIKAQVGDDEVILGLSGGVDSSVVAMLL 247

Query: 243 YEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK 302
           + AIG  LTCV VD+G +R NE E ++ +F  +    +  VDA  RF+  +  + DPE K
Sbjct: 248 HRAIGKKLTCVFVDNGLLRLNEAEQVLEMFGDHFGLNIVHVDAENRFLDAMAGVADPEAK 307

Query: 303 RKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           RK+IG++F+E+F+EE+KK   A++L QGT+YPDVIES     G + +IKSHHNVGGLP+ 
Sbjct: 308 RKIIGRVFVEIFDEESKKCANAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPDD 367

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           M+M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +
Sbjct: 368 MEMGLVEPLRELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRA 427

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           DAI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H
Sbjct: 428 DAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAH 487

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 488 LPYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525


>gi|323703202|ref|ZP_08114855.1| GMP synthase, large subunit [Desulfotomaculum nigrificans DSM 574]
 gi|323531861|gb|EGB21747.1| GMP synthase, large subunit [Desulfotomaculum nigrificans DSM 574]
          Length = 513

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/511 (51%), Positives = 361/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+TQLIARR+R+  VYCE+  +   L   K++ P+ I+ SG P+S    ++P
Sbjct: 9   ILVLDFGGQYTQLIARRIRDCNVYCEIEPYNTPLQKIKDKKPKGIVFSGGPSSVYGENAP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   I   ++P+LGICYG Q+M   L GK   ++  E+GR  + I +  ++LKG+   G
Sbjct: 69  AVDPAIYNLDVPILGICYGMQLMTHQLNGKVVPAEQHEYGRTKLNISRCENILKGL---G 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             ++ WMSHGD+VE  P GF V AS++  P A +A+E+RK YAVQFHPEVVHT  G +++
Sbjct: 126 PDEECWMSHGDRVEEAPPGFVVTASTEQAPVAAMANEERKLYAVQFHPEVVHTPRGIEIL 185

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            +F+  + G   +W M S+ +E ++ IK QVG+  V+CA+SGGVDS+VAA L++ A+G  
Sbjct: 186 KSFLFDICGCSGSWNMGSFLEEAIADIKRQVGDRHVLCALSGGVDSSVAAVLVHRAVGDK 245

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RKNE   ++  F+   N  L  VDASERF+ KLK + DPE KRK+IG  
Sbjct: 246 LTCVFVDHGLLRKNEAAQVVHTFRNLFNIKLVHVDASERFLGKLKGVTDPEEKRKIIGAE 305

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA+K+G   FL QGTLYPDV+ES +   G +++IKSHHNVGGLPE M  +LVE
Sbjct: 306 FIRVFEEEARKLGDIDFLVQGTLYPDVVESGT---GTAAVIKSHHNVGGLPEDMKFELVE 362

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR LG++L LP+  V R P PGPGLA+R +GE+T  +++ILR++D I  +E
Sbjct: 363 PLRWLFKDEVRRLGEQLGLPEEIVWRQPFPGPGLAVRILGEVTRHKLDILRDADFIVTDE 422

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ ++IWQ F VL  ++TVGVMGD RTY Y   +RAV S DGMTAD+       L 
Sbjct: 423 IKKAGLDKEIWQYFAVLPDMRTVGVMGDGRTYAYAVVVRAVYSHDGMTADWARIPYEVLE 482

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++R+VN+V+ +NRVVYDITSKPP TIEWE
Sbjct: 483 KISVRLVNQVQEVNRVVYDITSKPPGTIEWE 513


>gi|223940293|ref|ZP_03632151.1| GMP synthase, large subunit [bacterium Ellin514]
 gi|223891060|gb|EEF57563.1| GMP synthase, large subunit [bacterium Ellin514]
          Length = 513

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/515 (51%), Positives = 360/515 (69%), Gaps = 4/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + +++I+DFGSQ+TQ+IARR+RE  VY  ++ +    +      P+ +ILSG PAS    
Sbjct: 2   NEQIVILDFGSQYTQVIARRIRECNVYSIILRYDTPAEEIAAMQPKGLILSGGPASVYTK 61

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKN-CSLLKGM 125
            +PQ  K I +  IP+LGICYG Q++ Q LGGK +  Q RE+G+  +++K + C+L   +
Sbjct: 62  GAPQPDKAIFDLGIPILGICYGLQLVAQYLGGKVEKGQKREYGKGTLQVKDSFCALFANL 121

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
            EK    QVW SHGD++  +P GF+ +A ++++ +A I +  +K Y +QFHPEV HT  G
Sbjct: 122 PEK---LQVWNSHGDKLTKLPRGFKSVAITENSDYAAIENHAKKMYGLQFHPEVAHTPQG 178

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
            ++I NFVH++ G    W M SY  + V  I+ QVGNE+VI  +SGGVDS+VAA L+++A
Sbjct: 179 REIISNFVHNICGCGKLWTMHSYIDQAVEAIRNQVGNEKVILGLSGGVDSSVAAALLHKA 238

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTC+ V++G +R  E + +  +F  +    L+  DAS  F+++LK + DPE KRK+
Sbjct: 239 IGNQLTCIFVNNGLLRGREAKTVQEVFGRHFKIKLQYEDASNLFLKRLKGVTDPERKRKI 298

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FIEVFE   K+ G A+FL QGTLYPD+IES+   G P+++IKSHHNVGGLP+ M  
Sbjct: 299 IGKTFIEVFEAATKRAGKAKFLAQGTLYPDIIESVPIAGNPAAMIKSHHNVGGLPKKMRF 358

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +LVEPLK LFKDEVR LG EL LP   V R P PGPGLA+R +GE+T  R  ILRE+D I
Sbjct: 359 QLVEPLKSLFKDEVRELGLELGLPREIVLRQPFPGPGLAVRILGEVTPRRCEILREADTI 418

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
             EE+  +G Y KIWQ+F VLLPV++VGVMGDERTY+Y  +LRAV S DGMTAD+     
Sbjct: 419 VVEEMKTSGWYYKIWQSFAVLLPVKSVGVMGDERTYDYTIALRAVESQDGMTADWVKLPY 478

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           + L +++ RI+NEVKG+NRV +DI+SKPPATIEWE
Sbjct: 479 DLLEKLSSRIINEVKGVNRVCFDISSKPPATIEWE 513


>gi|261820583|ref|YP_003258689.1| GMP synthase [Pectobacterium wasabiae WPP163]
 gi|261604596|gb|ACX87082.1| GMP synthase, large subunit [Pectobacterium wasabiae WPP163]
          Length = 525

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +  NP  IILSG P S+ +  S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGPESTTEFGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M   LGG  + S  REFG A +EIK + +L++ + + 
Sbjct: 69  PRAPEYVFNAGVPVLGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEIKTDSALVRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IPEGFE +AS+D+ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LSATGAPLLDVWMSHGDKVTAIPEGFETVASTDTCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVGN+ VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVLDICQCEALWTPAKIIDDAVNRIREQVGNDHVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F  +    +  V A +RF+ +L    DPE KR
Sbjct: 249 RAIGDRLTCVFVDNGLLRLNEADQVLEMFGDHFGLNIVHVAAEDRFLNELAGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEANKQTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYNMLFRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|296273590|ref|YP_003656221.1| GMP synthase large subunit [Arcobacter nitrofigilis DSM 7299]
 gi|296097764|gb|ADG93714.1| GMP synthase, large subunit [Arcobacter nitrofigilis DSM 7299]
          Length = 511

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/511 (52%), Positives = 360/511 (70%), Gaps = 5/511 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFGSQ+TQ+IAR++RE+ VY E++ +  +++  K + P+ IILSG PAS    DS 
Sbjct: 6   IVVLDFGSQYTQIIARKLREAGVYSEIVPYSESIEDIKARTPKGIILSGGPASVYAKDSY 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              KEI E  +P+LGICYG Q++ Q  GG    +   E+G+A +  +K   + +   +  
Sbjct: 66  HPDKEIFELGLPILGICYGMQLISQYFGGSVIAADHHEYGKAKLNFEKQSDIFR---DTT 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q VWMSHGD+VE IPEGFE IA+S+++P+A IAD  R  YA QFHPEV H+V G++L+
Sbjct: 123 DGQTVWMSHGDRVETIPEGFEKIATSENSPYAAIADLDRLVYAFQFHPEVYHSVEGAKLL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF  ++ G +  W M S+ KE + +I++QVG+++V+C VSGGVDS+V A L+ EAIG  
Sbjct: 183 KNFAKYICGCESTWNMGSFAKEQIKKIQDQVGDKKVLCGVSGGVDSSVVATLLAEAIGDQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L  V VD+G +R NE E + ++FK     PL  VDA+E+F+ KL  + DPETKRK+IG+ 
Sbjct: 243 LIPVFVDNGLLRANEREQVEAMFKAR-GVPLITVDATEQFLSKLAGVTDPETKRKIIGET 301

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI+VF+EEAKK  G +FL QGTLY DVIES+S   GPS  IKSHHNVGGLP+ M   L+E
Sbjct: 302 FIKVFDEEAKKHDGIEFLAQGTLYTDVIESVSV-KGPSKTIKSHHNVGGLPDWMTFDLIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+E+FKDEVRLLG EL +P   + RHP PGPGLAIR +G++ +  + +LR++D I  + 
Sbjct: 361 PLREIFKDEVRLLGLELGIPKDMIGRHPFPGPGLAIRIMGDVNKPDLELLRKADVIMLDV 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           +   G Y K WQAFTVLL V++VGVMGD RTY+    +R V + DGMTA F H   + L 
Sbjct: 421 LRATGYYDKTWQAFTVLLNVKSVGVMGDNRTYDNTVCVRIVEATDGMTATFAHIPHDILE 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 481 TISRRIINEVDGINRVVYDISSKPPATIEWE 511


>gi|257466980|ref|ZP_05631291.1| GMP synthase [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918119|ref|ZP_07914359.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691994|gb|EFS28829.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 512

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 367/516 (71%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   LD    + P+ IILSG PAS   
Sbjct: 2   KECSIIILDFGSQYNQLIARRVREMGVYAEVVPFYEPLDKILARKPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSLLKG 124
             +P + K + ++ IP+LG+CYG Q++    GG+   +  +EFG+A + I +K+ +L + 
Sbjct: 62  EGAPTLDKALFDNGIPVLGLCYGMQLVTHLFGGEVARADKQEFGKAELIIDEKDAALFQN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +  +VWMSHGD V  I EGF  IA +DS   A + + ++  YA QFHPEV H+  
Sbjct: 122 I---PNNTKVWMSHGDHVTRIGEGFHAIAHTDSC-IAAVVNPEKNIYAFQFHPEVTHSEH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  VA  + NW M +Y +  +  I+E+VG+++VI  +SGGVDS+VAA LI+ 
Sbjct: 178 GRDMLQNFVLEVAKCEKNWSMDNYIESTIKAIQEKVGDKKVILGLSGGVDSSVAATLIHR 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RKNE + ++ ++    +  ++ VDA ERF+ KLK + DPE KRK
Sbjct: 238 AIGDQLTCIFVDTGLLRKNEAKTVMEVYSENFHMNIKCVDAEERFLSKLKGVSDPEQKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ FIEVF EEAKK   A+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE M 
Sbjct: 298 IIGKEFIEVFNEEAKKFEDAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDMK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G++L +P   ++RHP PGPGL +R +G+IT+E+ +ILRE+D 
Sbjct: 357 FQLLEPLRELFKDEVREVGRQLGIPHHMIDRHPFPGPGLGVRILGDITKEKADILREADD 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPVQ+VGVMGDERTYEYV SLR+V +ID MTA + H  
Sbjct: 417 IFIEELRKADLYGKVSQAFVVLLPVQSVGVMGDERTYEYVASLRSVNTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +F+ +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 FDFMERVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|300722900|ref|YP_003712196.1| GMP synthetase [Xenorhabdus nematophila ATCC 19061]
 gi|297629413|emb|CBJ90014.1| GMP synthetase (glutamine aminotransferase) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 525

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           +VLI+DFGSQ+TQLIARR+RE  VYCE+  +    +  +  NP  IILSG P S+ + +S
Sbjct: 9   RVLILDFGSQYTQLIARRIREIGVYCELWTWNVTEEQIRAFNPSGIILSGGPESTTENNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LGICYG Q M   LGG+  NS  REFG A +EIK NC L + + + 
Sbjct: 69  PRAPEYVFSAGVPVLGICYGMQTMSMQLGGQVSNSDEREFGYAQVEIKNNCELFRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S+       VWMSHGD+V  IP  F  +AS+D+ PFA +A++++++Y VQFHPEV HT 
Sbjct: 129 LSEDGKPLLDVWMSHGDKVTAIPADFTTVASTDTCPFAIMANDEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  +   +  W  +S   +IV R++ Q+G+++VI A+SGGVDS+V A L+ 
Sbjct: 189 QGLNILKRFVLDICQCEALWTPASIIDDIVERLRAQIGDDQVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F+G  +  +  V A +RF+  L  I +PE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEADQVMEMFEGKFDLNIIHVKAEDRFLSALAGIDEPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +FI+VF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KTIGHVFIDVFDEEASKQTQVKWLAQGTIYPDVIESAASATGNAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRRIGLELGLPYEMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525


>gi|294637669|ref|ZP_06715948.1| GMP synthase [Edwardsiella tarda ATCC 23685]
 gi|291089224|gb|EFE21785.1| GMP synthase [Edwardsiella tarda ATCC 23685]
          Length = 525

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/525 (50%), Positives = 366/525 (69%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+  +    ++ NP  IILSG P
Sbjct: 1   MTQNIHQDRILILDFGSQYTQLLARRVREIGVYCELWAWDVSEAQIRDFNPSGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ +  SP+ P+ + ++ +P+LG+CYG Q M   +GG+ ++S  REFG A +EI    +
Sbjct: 61  ESTTESGSPRAPEYVFQAGVPVLGVCYGMQTMAMQMGGRVESSTEREFGYAKVEITSPSA 120

Query: 121 LLKGMWEKGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQF 175
           L  G+ +  S        VWMSHGD+V  IP  F  +AS++S PFA +A+E++++Y VQF
Sbjct: 121 LFDGIQDSLSDDGKAVLDVWMSHGDKVTAIPADFTTVASTESCPFAIMANEEKRFYGVQF 180

Query: 176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS 235
           HPEV HT  G +++  FV  + G    W  ++  ++ V+R++EQ+G++ VI  +SGGVDS
Sbjct: 181 HPEVTHTHQGQRMLQRFVLDICGCAALWTPATIIEDAVARMREQIGDDEVILGLSGGVDS 240

Query: 236 TVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN 295
           +V A L++ AIG  LTCV VD+G +R NE E ++++F       +  V+A +RF+  L  
Sbjct: 241 SVTALLLHRAIGKRLTCVFVDNGLLRLNEAEQVMAMFGDQFGLNIIHVNAEDRFLAALAG 300

Query: 296 IVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
           I DPE KRK IG++FIEVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHN
Sbjct: 301 IADPEAKRKTIGRVFIEVFDEEAAKLPQVKWLAQGTIYPDVIESAASATGKAHVIKSHHN 360

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLPE M + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +  
Sbjct: 361 VGGLPEEMKLGLVEPLKELFKDEVRKIGLELGLPHDMLYRHPFPGPGLGVRVLGEVKKPY 420

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
            ++LR +DAI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID 
Sbjct: 421 CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF 480

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTA + H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 481 MTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|124004150|ref|ZP_01688996.1| GMP synthase, C-terminal domain [Microscilla marina ATCC 23134]
 gi|123990220|gb|EAY29719.1| GMP synthase, C-terminal domain [Microscilla marina ATCC 23134]
          Length = 518

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/523 (51%), Positives = 360/523 (68%), Gaps = 8/523 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQ--NPQAIILSG 58
           M      +++LI DFGSQ+TQLIARRVRE  VYCE++ + N +    E   N + IILSG
Sbjct: 1   MKPNNTKTQILIFDFGSQYTQLIARRVRELNVYCEILPYNNEILNNAESLTNVKGIILSG 60

Query: 59  SPASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIE-IKK 117
           SP S LD  +P  P    +  +PLLG+CYG Q+M    GGK + S +RE+GRA +  ++ 
Sbjct: 61  SPCSVLDTGAPTFPLAKFQGKVPLLGVCYGAQLMAHKAGGKVQPSATREYGRANLHFVQS 120

Query: 118 NCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHP 177
           N +L K +    S  QVWMSHGD +  IPEGFE++AS+ S          +  Y +QFHP
Sbjct: 121 NATLFKNI---PSNSQVWMSHGDSIIDIPEGFEILASTASVKVGGYKIANQDTYGIQFHP 177

Query: 178 EVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTV 237
           EV HT  G QL+ NFV  + G +  W   S+ +  V+ +K Q+GN++V+  +SGGVDS+V
Sbjct: 178 EVTHTTEGKQLLQNFVVDICGCEQTWTPDSFIETTVAELKAQIGNDKVVLGLSGGVDSSV 237

Query: 238 AAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIV 297
           AA L+++AIG NL  + VD+G +RK+E E ++  +KG     +  VDA + F   L  + 
Sbjct: 238 AAVLLHQAIGKNLYAIFVDNGLLRKDEFEEVLESYKGM-GLNVTGVDAKQDFYDVLTGLK 296

Query: 298 DPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVG 357
           DPE KRK IG  FI+VF+ EA KI G ++LGQGT+YPD+IES+S   GPS+ IKSHHNVG
Sbjct: 297 DPEQKRKAIGGKFIDVFQAEANKIQGVKWLGQGTIYPDIIESVSV-KGPSATIKSHHNVG 355

Query: 358 GLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERIN 417
           GLPE MD+K+VEPL  LFKDEVR +GK L + D  + RHP PGPGLAIR + +IT E+++
Sbjct: 356 GLPEKMDLKVVEPLNTLFKDEVRRVGKSLEIDDKILGRHPFPGPGLAIRILSDITPEKVD 415

Query: 418 ILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMT 477
           IL++ DAI+   +  +G+Y  +WQA  +LLPVQ+VGVMGDERTYE V +LRAV S+DGMT
Sbjct: 416 ILQQVDAIFINGLKTSGLYDDVWQAGAMLLPVQSVGVMGDERTYENVVALRAVHSLDGMT 475

Query: 478 ADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           AD+ H    FL++ + +I+N+VKG+NRVVYDI+SKPPATIEWE
Sbjct: 476 ADWVHLPYEFLAETSNKIINKVKGVNRVVYDISSKPPATIEWE 518


>gi|237742539|ref|ZP_04573020.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 4_1_13]
 gi|229430187|gb|EEO40399.1| bifunctional GMP synthase/glutamine amidotransferase [Fusobacterium
           sp. 4_1_13]
          Length = 512

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 365/516 (70%), Gaps = 6/516 (1%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLD 65
           +   ++I+DFGSQ+ QLIARRVRE  VY EV+ F   +D    + P+ IILSG PAS   
Sbjct: 2   KKGGIVILDFGSQYNQLIARRVREMGVYAEVVPFHEDVDKILAREPKGIILSGGPASVYA 61

Query: 66  IDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK-KNCSLLKG 124
             +P +  ++ + NIP+LG+CYG Q++    GGK   +  +EFG+A +E+  KN  L K 
Sbjct: 62  EGAPSLDIKLFQKNIPILGLCYGMQLITHLHGGKVARADKQEFGKAELELDDKNHILYKN 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    +K  VWMSHGD V  +   F++IA +DS+  A I +  +  YA Q+HPEV H+  
Sbjct: 122 I---PNKTTVWMSHGDHVTEMAPDFKIIAHTDSS-IAAIENSDKNIYAFQYHPEVTHSQH 177

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G  ++ NFV  +A  + NW M +Y +  V +IK +VGN++VI  +SGGVDS+VAA LI +
Sbjct: 178 GFDMLKNFVFGIAKAEKNWSMENYIESTVKQIKGRVGNKQVILGLSGGVDSSVAAALINK 237

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           AIG  LTC+ VD G +RK+E + ++ ++    +  ++ ++A ERF+ KL  + DPETKRK
Sbjct: 238 AIGKQLTCIFVDTGLLRKDEAKQVMEVYAKNFDMNIKCINAEERFLTKLAGVTDPETKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ F+EVF EEAKKI GA+FL QGT+YPDVIES+S   GPS  IKSHHNVGGLPE + 
Sbjct: 298 IIGKEFVEVFNEEAKKIEGAEFLAQGTIYPDVIESVSV-KGPSVTIKSHHNVGGLPEDLK 356

Query: 365 MKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDA 424
            +L+EPL+ELFKDEVR +G+EL +PD  V+RHP PGPGL IR +GE+T E+ +ILRE+DA
Sbjct: 357 FELLEPLRELFKDEVRKVGRELGIPDYMVDRHPFPGPGLGIRILGEVTTEKADILREADA 416

Query: 425 IYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHD 484
           I+ EE+ KA +Y K+ QAF VLLPV++VGVMGDERTYEY   LR+  +ID MTA + H  
Sbjct: 417 IFIEELRKADLYNKVSQAFVVLLPVKSVGVMGDERTYEYTAVLRSANTIDFMTATWSHLP 476

Query: 485 MNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             FL +V+ RI+NEVKGINR+ YDI+SKPPATIEWE
Sbjct: 477 YEFLEKVSNRILNEVKGINRLTYDISSKPPATIEWE 512


>gi|253989307|ref|YP_003040663.1| GMP synthase [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253780757|emb|CAQ83919.1| GMP synthase [glutamine-hydrolyzing] [Photorhabdus asymbiotica]
          Length = 525

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 361/517 (69%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+    S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESTTAQGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M    GGK ++S  REFG A +EIK   +L +G+ + 
Sbjct: 69  PRAPEYVFNAGVPILGVCYGMQTMSVQFGGKVEDSTEREFGYAQVEIKAESALFRGIQDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            ++Q      VWMSHGD+V  IP  F  IAS+D+ PFA IA+E++++Y VQFHPEV HT 
Sbjct: 129 LNEQGQPLLDVWMSHGDKVTSIPADFITIASTDTCPFAIIANEEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +S  ++ V R++EQVG + VI  +SGGVDS+V A L++
Sbjct: 189 QGQRILERFVLDICQCEALWTPASIIEDTVVRLREQVGEDHVILGLSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F G     +  V A +RF+  L  I DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEAEQVMEMFAGKFGLNIVHVPAEDRFLAALAGINDPEEKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++F+EVF+EEA K     +L QGT+YPDVIES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KTIGRVFVEVFDEEASKQTQVNWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPEEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G  L LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLALGLPYDMLNRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDVSGKPPATIEWE 525


>gi|237808916|ref|YP_002893356.1| GMP synthase [Tolumonas auensis DSM 9187]
 gi|259647691|sp|C4L8C4|GUAA_TOLAT RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|237501177|gb|ACQ93770.1| GMP synthase, large subunit [Tolumonas auensis DSM 9187]
          Length = 525

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/525 (50%), Positives = 368/525 (70%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQLIARRVRE  VYCE+ A+    +  +E NP  IILSG P
Sbjct: 1   MSKNIHKHRILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  + DSP+ P+ +  + +P+LG+CYG Q M + LGGK ++S  REFG A +++ K+  
Sbjct: 61  ESVTESDSPRAPEYVFNAGVPVLGVCYGMQTMAEQLGGKVESSDKREFGYAKVKLVKDSE 120

Query: 121 LL----KGMWEKGSKQ-QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQF 175
           L       + E G  +  VWMSHGD+V  IP  F  IA + + P A +A+E +++Y VQF
Sbjct: 121 LFHNIEDAITEDGRPELDVWMSHGDKVMEIPVDFVTIAVTPTCPHAAMANEAKRFYGVQF 180

Query: 176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS 235
           HPEV HTV G+++++ FV  +   +  W  ++  ++ V+RI+EQVG + VI  +SGGVDS
Sbjct: 181 HPEVTHTVQGARMLERFVKEICHCEALWTPATIIEDAVARIREQVGTDEVILGLSGGVDS 240

Query: 236 TVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN 295
           +V A LI+ A+G  LTCV VD+G +R NE + ++ +F  +    +  VDA ERF+  LK 
Sbjct: 241 SVVAMLIHRAVGKQLTCVFVDNGLLRLNEGQQVMEMFGDHFGLNIIKVDAEERFLSALKG 300

Query: 296 IVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
           I DPE KRK IG++F+EVF++E+KK+  A++L QGT+YPDVIES +   G + +IKSHHN
Sbjct: 301 IADPELKRKAIGRVFVEVFDDESKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHN 360

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLP+ M M LVEPL+ELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E 
Sbjct: 361 VGGLPDDMKMGLVEPLRELFKDEVRRVGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEY 420

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
            ++LR +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID 
Sbjct: 421 CDLLRRADAIFIEELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF 480

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTA + H   +FL  V+ RI+NE+ GI+RVVYDI+ KPPATIEWE
Sbjct: 481 MTAHWAHLPYDFLGHVSNRIINEINGISRVVYDISGKPPATIEWE 525


>gi|284928867|ref|YP_003421389.1| GMP synthase [cyanobacterium UCYN-A]
 gi|284809326|gb|ADB95031.1| GMP synthase (glutamine-hydrolyzing) [cyanobacterium UCYN-A]
          Length = 544

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 366/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE+ VY EV++++  +    E NP+ II SG P S     SP
Sbjct: 31  IVILDFGSQYSELIARRIRETHVYSEVMSYQTDIKKICELNPKGIIFSGGPNSVYSDFSP 90

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q  ++I +  IP+LGICYG Q+M Q LGG+ + ++  E+G+A + I     L   + E G
Sbjct: 91  QCDRKIWDLGIPILGICYGMQLMVQQLGGQVEKAKYGEYGKALLRIDDPTDLFTNL-EDG 149

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGF ++A +++TP A IA+  +K + VQFHPEVVH+VGG  +I
Sbjct: 150 SI--MWMSHGDSSTKLPEGFSILAHTENTPCAAIANHDKKLFGVQFHPEVVHSVGGIAII 207

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+ G +  W   ++  E +  I+++V + +V+ A+SGGVDS+  AFL+++AIG N
Sbjct: 208 RNFVYHICGCEPTWTTKAFVDETIDGIRKKVKDRKVLLALSGGVDSSTLAFLLHQAIGDN 267

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++S+F    + P+  VDA ERFI+KL+ IVDPE KR +IG  
Sbjct: 268 LTCMFIDQGFMRKGEPERLVSIFSKQFHIPVEYVDARERFIKKLEGIVDPEEKRHLIGHE 327

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE++++G   +L QGTLYPDVIES       S+       IKSHHNVGGLP+++
Sbjct: 328 FIQVFEEESQRLGPFDYLAQGTLYPDVIESADTNINSSTGERVAVKIKSHHNVGGLPKNL 387

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 388 RFKLVEPLRKLFKDEVRRVGQSIGLPEEIVRRHPFPGPGLAIRIIGEVTAERLNILRDAD 447

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I R+EI K G+Y   WQAF VLLP+++VGVMGD+RTY +   LR +TS DGMTAD+   
Sbjct: 448 FIVRDEISKQGVYHDFWQAFAVLLPIRSVGVMGDKRTYSHPIVLRFITSEDGMTADWAKV 507

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L  ++ RIVNEV+ +NR+VYDITSKPP TIEWE
Sbjct: 508 PYELLEIISNRIVNEVEAVNRIVYDITSKPPGTIEWE 544


>gi|50122130|ref|YP_051297.1| GMP synthase [Pectobacterium atrosepticum SCRI1043]
 gi|81644335|sp|Q6D288|GUAA_ERWCT RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|49612656|emb|CAG76106.1| GMP synthase [glutamine-hydrolyzing] [Pectobacterium atrosepticum
           SCRI1043]
          Length = 525

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/527 (50%), Positives = 369/527 (70%), Gaps = 9/527 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +  NP  IILSG P
Sbjct: 1   MTQNIHQHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ +  SP+ P+ +  + +P+LG+CYG Q M   LGG  + S  REFG A +E+K N +
Sbjct: 61  ESTTEFGSPRAPEYVFNAGVPVLGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVKTNSA 120

Query: 121 LLKGMWEKGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQF 175
           L++ + +  S        VWMSHGD+V  IPEGFE +AS+D+ PFA +A+E++++Y VQF
Sbjct: 121 LVRDIQDALSATGAPLLDVWMSHGDKVTAIPEGFETVASTDTCPFAIMANEEKRFYGVQF 180

Query: 176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS 235
           HPEV HT  G ++++ FV  +   +  W  +    + V+RI+EQVGN+ VI  +SGGVDS
Sbjct: 181 HPEVTHTRQGQRMLERFVLDICQCEALWTPAKIIDDAVNRIREQVGNDSVILGLSGGVDS 240

Query: 236 TVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD--ASERFIRKL 293
           +V A L++ AIG  LTCV VD+G +R NE + ++ +F    NF L +V   A +RF+ +L
Sbjct: 241 SVTAMLLHRAIGDRLTCVFVDNGLLRLNEADQVLEMFG--DNFGLNIVHVAAEDRFLNEL 298

Query: 294 KNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSH 353
               +PE KRK+IG++F+EVF+EEA K    ++L QGT+YPDVIES +   G + +IKSH
Sbjct: 299 AGEDEPEAKRKIIGRVFVEVFDEEANKQAEVKWLAQGTIYPDVIESAASATGKAHVIKSH 358

Query: 354 HNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITE 413
           HNVGGLP+ M + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +
Sbjct: 359 HNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKK 418

Query: 414 ERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSI 473
           E  ++LR +DAI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V +LRAV +I
Sbjct: 419 EYCDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVALRAVETI 478

Query: 474 DGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           D MTA + H   +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 479 DFMTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|87307823|ref|ZP_01089966.1| GMP synthase [Blastopirellula marina DSM 3645]
 gi|87289437|gb|EAQ81328.1| GMP synthase [Blastopirellula marina DSM 3645]
          Length = 529

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 362/517 (70%), Gaps = 3/517 (0%)

Query: 4   RERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASS 63
           R    K+L++DFGSQ+ QLIARRVRE  VYCE++    +++     NP+ IILSG P+S 
Sbjct: 16  RISDEKILVLDFGSQYAQLIARRVREQNVYCEIVRHDISVERIAAHNPRGIILSGGPSSV 75

Query: 64  LDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK 123
            +  +PQ    I    IP+LGICYG Q++CQ+ GG+ KN+  RE+G A I I  N  L  
Sbjct: 76  YEEGAPQCDPGIFAMGIPVLGICYGMQLICQAFGGQVKNTSQREYGHAKISISPNEDLFG 135

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           G+    S+  VWMSHGDQV ++ E FE +AS+ + P A +  ++   YA+QFHPEV HT 
Sbjct: 136 GL---PSETDVWMSHGDQVTNVTESFEPLASTSTCPIAAMRHKELPLYAMQFHPEVTHTP 192

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G Q++ NFV  V   +  W +  + ++ ++ I+E+VG+ RVIC +SGGVDS V A L+Y
Sbjct: 193 LGFQILRNFVISVCDCEGLWKLHDFAQQTIAEIRERVGDNRVICGLSGGVDSAVVAALLY 252

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +AIG  L+C+LVD+G +RK E E++I+ F  +    L VVDA ++F+++L  I +P+ KR
Sbjct: 253 QAIGPQLSCILVDNGLLRKQEAESVIAEFTKHFKTDLHVVDAKDQFLKELAGITEPQEKR 312

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           + IG  F+E F+ EA KI  A+FL QGTLYPDVIES +   GP++ IK HHNVGGLP+ +
Sbjct: 313 RRIGYQFVECFKAEALKIKDAKFLAQGTLYPDVIESGAALDGPAATIKLHHNVGGLPKEL 372

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             +L+EPL++LFKDEVR LG EL LP+  V RHP PGPGLA+RC+ +ITEE++++LRE+D
Sbjct: 373 GFELIEPLRDLFKDEVRKLGLELGLPEDLVWRHPFPGPGLAVRCLSDITEEKLSVLREAD 432

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           +I   EI  AG+YR+  QAF VLLPVQ+VGVMGD RTYE   ++R V + D MTA + + 
Sbjct: 433 SIVVSEIKAAGLYRQTSQAFAVLLPVQSVGVMGDARTYENAVAVRCVNTDDFMTATWSYL 492

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
               L++++ RI+NEVKG+NRV YDI++KPPATIEWE
Sbjct: 493 PYEVLARISTRIINEVKGVNRVCYDISTKPPATIEWE 529


>gi|34557924|ref|NP_907739.1| GMP synthase [Wolinella succinogenes DSM 1740]
 gi|44887990|sp|Q7M8K2|GUAA_WOLSU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|34483642|emb|CAE10639.1| GMP SYNTHASE [Wolinella succinogenes]
          Length = 521

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 276/515 (53%), Positives = 364/515 (70%), Gaps = 8/515 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +LI+DFGSQ+TQLIARR+RE  +YCE++ +   L+  K + P+ IILSG PAS  + D+ 
Sbjct: 11  LLILDFGSQYTQLIARRLREYGIYCEIVPYHEKLEAIKAREPKGIILSGGPASVYEEDAF 70

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRA---FIEIKKNCS-LLKGM 125
            I K + E  IP+LGICYG Q+M    GG    ++  E+G+A   F  ++ + S L +G 
Sbjct: 71  LIDKAVFELGIPVLGICYGMQLMTHYFGGVVAKAEHHEYGKAEVIFDALEGSESKLFEGC 130

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
               S + VWMSHGD+VE +PEGF  IA S ++PFA IA +++ +YAVQFHPEVVH+  G
Sbjct: 131 H---SGKVVWMSHGDKVEKLPEGFTRIAHSTNSPFAAIAHQEKPFYAVQFHPEVVHSEEG 187

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
           +  + NF   + G +++W M ++ +E + +I+E+V + +V+CAVSGGVDS+V A L+Y A
Sbjct: 188 ALYLKNFALGICGCENDWNMHNFAEEQIKKIQERVKSGKVLCAVSGGVDSSVVAALLYRA 247

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  L  V VDHG +R  E E +  +FK   + PL  VDASE F+ KLK + DPETKRK+
Sbjct: 248 IGEKLIPVFVDHGLLRAGEREAVEKMFKENLHVPLITVDASEIFLGKLKGVSDPETKRKI 307

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FIEVF+ EAKK  G Q+L QGTLYPDVIES+S   GPS  IKSHHNVGGLP+ M  
Sbjct: 308 IGETFIEVFDVEAKKHDGIQYLAQGTLYPDVIESVS-VKGPSKTIKSHHNVGGLPDWMTF 366

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           +L+EPL+ELFKDEVR LG EL +P   + RHP PGPGLAIR +GE+  E + +LR++D I
Sbjct: 367 ELIEPLRELFKDEVRALGAELGMPREMLMRHPFPGPGLAIRIMGEVNFEDLELLRKADVI 426

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
             +E+ K+G Y K WQAFTVLL V++VGVMGD RTY+    +R V +IDGMTA F H   
Sbjct: 427 MLDELKKSGFYDKTWQAFTVLLNVRSVGVMGDNRTYDNTVCVRVVEAIDGMTATFAHLPH 486

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L +++ RI+NEV GINRVVYDI+SKPPATIEWE
Sbjct: 487 ELLERMSTRIINEVDGINRVVYDISSKPPATIEWE 521


>gi|317049125|ref|YP_004116773.1| GMP synthase large subunit [Pantoea sp. At-9b]
 gi|316950742|gb|ADU70217.1| GMP synthase, large subunit [Pantoea sp. At-9b]
          Length = 526

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 366/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+    +  ++ NP  IILSG P S+ +++S
Sbjct: 10  RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRQFNPNGIILSGGPESTTELNS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M   LGGK + S  REFG A +E+K   +L++ + + 
Sbjct: 70  PRAPEYVFNAGVPVLGVCYGMQTMAMQLGGKVEGSTEREFGYAQVEVKTPSALIRDIEDA 129

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 130 ISDAGKPLLDVWMSHGDKVTAIPADFVTVASTETCPFAIMANEEKRFYGVQFHPEVTHTR 189

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  + G +  W  +   ++ V RI+EQVG ++VI  +SGGVDS+V A L++
Sbjct: 190 QGLRMLERFVRDICGCEALWTPAKIIEDAVERIREQVGEDKVILGLSGGVDSSVTAMLLH 249

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F  +    +  V A  RF+  L    DPE KR
Sbjct: 250 RAIGDRLTCVFVDNGLLRLNEAEQVLEMFGDHFGLNIVHVAAEARFLEALAGENDPEAKR 309

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 310 KIIGRVFVEVFDEEAGKLTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 369

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 370 KLGLVEPLKELFKDEVRKIGLELGLPYAMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 429

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 430 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 489

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 490 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 526


>gi|298529721|ref|ZP_07017124.1| GMP synthase, large subunit [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511157|gb|EFI35060.1| GMP synthase, large subunit [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 516

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/514 (51%), Positives = 368/514 (71%), Gaps = 3/514 (0%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           +KV+I+DFGSQ+TQLIARR+RES +Y E+     +L+  K   P A++LSG P+S    +
Sbjct: 5   NKVIILDFGSQYTQLIARRIRESGIYSEIHPCTVSLEDLKAMQPSALVLSGGPSSVAGEE 64

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           SPQ+ + + +  +P+LGICYG Q+M    GG+ + +++RE+GRA  E   +C L +G+ +
Sbjct: 65  SPQVDQGVFQLGLPILGICYGMQLMAHLFGGQVEPARNREYGRASFEFVSDCPLWEGLGD 124

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
           K     VWMSHGD V   P GFEV+  + S   A + D ++K Y +QFHPEV HT  G +
Sbjct: 125 KDG-LTVWMSHGDTVLTPPPGFEVLGRTSSVEIAAVGDSQQKIYGLQFHPEVAHTEEGYR 183

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQV-GNERVICAVSGGVDSTVAAFLIYEAI 246
           ++ NF+  VAG+  +W M+S+ ++ +  I+E +  +E+V+C +SGG+DSTV A L+++AI
Sbjct: 184 ILHNFLFKVAGLVPDWSMTSFIQDCIQEIREMIPDDEQVVCGLSGGIDSTVVAVLLHKAI 243

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  L C+LVD+G +R NE   ++     + +  L+ V+A + F+ +L  + DPE KRK+I
Sbjct: 244 GKRLHCILVDNGVLRHNEALEVVESLTKHFDLNLKHVEAQDLFLSRLHGVKDPEEKRKII 303

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FIEVFE+EAK I   ++L QGTLYPDVIES+SF  GPS++IKSHHNVGGLPE MD+K
Sbjct: 304 GHTFIEVFEKEAKSIPDVKWLAQGTLYPDVIESVSF-KGPSAVIKSHHNVGGLPEKMDLK 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           LVEPL+ELFKDEVR +  EL +PD+ V RHP PGPGLAIR IG IT ER+ ILR+SD I 
Sbjct: 363 LVEPLRELFKDEVRKVAVELGIPDTIVWRHPFPGPGLAIRVIGTITPERLEILRKSDRIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
           + E+  +  Y ++WQ F VLLP++TVGVMGDERTYE+V +LR V SID MTAD+      
Sbjct: 423 QNELFASNWYTRVWQGFAVLLPLKTVGVMGDERTYEHVVALRIVDSIDAMTADWSRIPPE 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L++++ RI+NEV+G+NRVV+DI+SKPP+TIEWE
Sbjct: 483 ILARISNRIINEVQGVNRVVFDISSKPPSTIEWE 516


>gi|163846550|ref|YP_001634594.1| GMP synthase [Chloroflexus aurantiacus J-10-fl]
 gi|222524339|ref|YP_002568810.1| GMP synthase [Chloroflexus sp. Y-400-fl]
 gi|163667839|gb|ABY34205.1| GMP synthase, large subunit [Chloroflexus aurantiacus J-10-fl]
 gi|222448218|gb|ACM52484.1| GMP synthase, large subunit [Chloroflexus sp. Y-400-fl]
          Length = 513

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/515 (52%), Positives = 354/515 (68%), Gaps = 5/515 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           +  + ++DFGSQ  QLI RR+RE   Y E++      D  +   P  I+LSG PAS  + 
Sbjct: 3   THSIPVLDFGSQTAQLIVRRLRELGYYSELLPHDAPEDQVRALAPVGIVLSGGPASVYEP 62

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            +P +P  +LES++P+ GICYG Q++  +LGG       RE+G A I I     L     
Sbjct: 63  GAPTLPSWLLESDLPVFGICYGMQLISHTLGGIVTRPAGREYGPAMITITHPHPLFA--- 119

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
           +  ++Q VWMSHGD++E +P GF  IA++ +TPFA IAD++RK+Y VQFHPEVVHTV G 
Sbjct: 120 DTPTEQPVWMSHGDRIEQLPTGFTAIAANPATPFAAIADDRRKWYGVQFHPEVVHTVYGR 179

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNE-RVICAVSGGVDSTVAAFLIYEA 245
            ++ NF   + G +  W  +S+  E + R+K QVG+  RVICA+SGGVDS VAA +I+ A
Sbjct: 180 TILTNFAR-LCGARPEWQPNSFVAEAIERVKAQVGDHGRVICALSGGVDSAVAALIIHRA 238

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG  LTCV VD+G +R  E E +I+ F  + + PL  VDA E F+  LK + DPE KRK+
Sbjct: 239 IGDRLTCVFVDNGLLRAGEAEQVIATFSEHFHVPLIAVDAREEFMTALKGVTDPEQKRKI 298

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG+ FI +FE EA+ + G +FL QGTLYPDVIES +     ++ IK+HHNVGGLP  M +
Sbjct: 299 IGEKFIRIFEREARALAGVEFLAQGTLYPDVIESTAPDRPKAAKIKTHHNVGGLPADMQL 358

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KLVEPL+ LFKDEVR  G +L LP+++V RHP PGPGLA+R IGE+T ER+ ILR++D I
Sbjct: 359 KLVEPLRYLFKDEVRAAGLQLGLPETWVWRHPFPGPGLAVRIIGEVTWERLEILRQADKI 418

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           + EE+H +G YR   QAF VLLPVQ+VGVMGD RTY    +LRA+T+ D MTAD+     
Sbjct: 419 FLEELHASGYYRATQQAFAVLLPVQSVGVMGDGRTYGVTIALRAITTEDYMTADWARLPY 478

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L+ V+ RIVNEV+G+NRVVYDI+SKPPATIEWE
Sbjct: 479 ELLAHVSSRIVNEVEGVNRVVYDISSKPPATIEWE 513


>gi|288818620|ref|YP_003432968.1| GMP synthase [Hydrogenobacter thermophilus TK-6]
 gi|288788020|dbj|BAI69767.1| GMP synthase [Hydrogenobacter thermophilus TK-6]
 gi|308752211|gb|ADO45694.1| GMP synthase, large subunit [Hydrogenobacter thermophilus TK-6]
          Length = 507

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 268/511 (52%), Positives = 361/511 (70%), Gaps = 9/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +++++FGSQ+ QLIARRVRE+ +Y E++ +  +      + P  IILSG PAS  + D+P
Sbjct: 6   IIVLNFGSQYVQLIARRVREAGIYSEILPYDTSAQEILSRKPYGIILSGGPASVYEPDAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              + I    +P+LGICYG Q+M   LGGK + +  +E+GRA + + K   +  G+    
Sbjct: 66  LPDQNIYTLGVPVLGICYGLQVMAHQLGGKVERATKQEYGRAKLTVIKEDPIFYGI---P 122

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            +  VWMSH D+V  +PEGFEVIASS+++P+A +   +   Y  QFHPEV HT  G ++ 
Sbjct: 123 REFDVWMSHADKVISLPEGFEVIASSENSPYAVV--RRGNLYGFQFHPEVAHTSYGMEIF 180

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V   Q NW +    +E VS IK  V + +VICA+SGGVDSTVAA L Y+AIG N
Sbjct: 181 RNFLYRVCHAQKNWEVGDLVEEKVSEIKSTVKDGKVICALSGGVDSTVAATLTYKAIGNN 240

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L C+ VDHG +RK EV+ +   F+   + P + VDA E F+ +L+ + DPE KR+++G  
Sbjct: 241 LKCIFVDHGLLRKGEVQEVEGYFRSL-SLPFKTVDAKELFLSRLRGVEDPEEKRRIVGYT 299

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FIEVFEEEAKK+G A FL QGTLYPDV+ES    G  + +IK+HHNVGGLPE + +KL+E
Sbjct: 300 FIEVFEEEAKKVG-ADFLLQGTLYPDVVESAGLPG--AKVIKTHHNVGGLPERLGIKLLE 356

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR +G+ L LP+  ++RHP PGPGLAIR +G++ EE ++ILRE+D I+ EE
Sbjct: 357 PLRELFKDEVRQIGRSLGLPEEMLKRHPFPGPGLAIRVLGQVNEEDLDILREADYIFIEE 416

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           + + G+Y K+WQAF VLLPV+TVGVMGD RTYE V +LRAV S+DGMTAD+      FL 
Sbjct: 417 LKRWGLYDKVWQAFAVLLPVKTVGVMGDVRTYERVVALRAVDSVDGMTADWARLPYEFLD 476

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            V  RI+NEVKG+NRVVYD++SKPPATIEWE
Sbjct: 477 HVMRRIINEVKGVNRVVYDVSSKPPATIEWE 507


>gi|283786121|ref|YP_003365986.1| GMP synthase [glutamine-hydrolyzing] [Citrobacter rodentium ICC168]
 gi|282949575|emb|CBG89193.1| GMP synthase [glutamine-hydrolyzing] [Citrobacter rodentium ICC168]
          Length = 525

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/517 (50%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E+  + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSSEREFGYAQVEVVNDSALVRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS++S PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI++QVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVERIRQQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  V A ERF+  LK   DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVPAEERFLAALKGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|200388214|ref|ZP_03214826.1| gmp synthase (glutamine-hydrolyzing) [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199605312|gb|EDZ03857.1| gmp synthase (glutamine-hydrolyzing) [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 525

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 366/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       ++ NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E++ + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVQTDSALIRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IPEGF  +AS+++ PFA +A E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPEGFVTVASTETCPFAIMAHEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE E ++ +F  +    +  V A +RF+  L    DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+ KA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|332141955|ref|YP_004427693.1| GMP synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551977|gb|AEA98695.1| GMP synthase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 525

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/517 (52%), Positives = 360/517 (69%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARRVRE  VYCE+ A+    +  +E NPQ IILSG P S  +  S
Sbjct: 9   RILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESVTEEGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK----G 124
           P+ P  + E+ +P+LG+CYG Q M   LGG    S  REFG A +E+ K   LL      
Sbjct: 69  PRAPDYVFEAGVPVLGVCYGMQTMAHQLGGGVLGSDKREFGYAQVEVIKPSPLLDKIEDA 128

Query: 125 MWEKGSKQ-QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           + + G+    VWMSHGD+V  IPEGFE IA + S P A + +E++++Y VQFHPEV HT 
Sbjct: 129 IGDNGAALLDVWMSHGDKVAAIPEGFETIAQTASCPHAAMYNEEKQFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G +L+  FV  +   +  W   +  ++ + RIKE+VG+ERVI  +SGGVDS+V A L++
Sbjct: 189 QGMRLLTQFVMDICKCEKLWTAGAIIEDAIERIKEKVGDERVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  VDA  RF+ +LK I DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEADQVMEMFGDHFGLNINRVDAEGRFLDRLKGIEDPELKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG  F+ VF+EEA K+  A++L QGT+YPDVIES     G + +IKSHHNVGGLPE M
Sbjct: 309 KAIGNEFVRVFDEEASKLENAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           ++ LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR +D
Sbjct: 369 ELGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE++ A +Y+K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELYAADLYQKVSQAFTVFLPVRSVGVMGDARKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NE+ GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGKVSNRIINEIDGISRVVYDISGKPPATIEWE 525


>gi|290969038|ref|ZP_06560573.1| GMP synthase (glutamine-hydrolyzing) [Megasphaera genomosp. type_1
           str. 28L]
 gi|290780994|gb|EFD93587.1| GMP synthase (glutamine-hydrolyzing) [Megasphaera genomosp. type_1
           str. 28L]
          Length = 511

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 273/517 (52%), Positives = 363/517 (70%), Gaps = 8/517 (1%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E+   V+++DFG Q+ QLIARRVRE+ VYCEV  ++ A +  K++ PQ II +G PAS  
Sbjct: 2   EQKELVIVVDFGGQYNQLIARRVRENHVYCEVYPYQKAWEEIKKKRPQGIIFTGGPASVY 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           D ++P++   I ++ IP+LG+CYG Q M Q+L G  + + +REFG+  I ++ +  L +G
Sbjct: 62  DENAPRMEAAIFQAGIPVLGLCYGMQYMAQTLHGTVQQATAREFGKTVITVRNDSPLFQG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           +    ++Q VWMSH D V  +PEGFE IASS + P A + ++++K YA+QFHPEV+H+  
Sbjct: 122 L---DARQTVWMSHRDYVAALPEGFESIASSANCPVAAMQNKEKKLYALQFHPEVLHSEH 178

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +++ NF+  V      W M++Y K  V+ I+  VGN +V+ A+SGGVDS+VAA LI  
Sbjct: 179 GKEMLHNFLFAVCHCTGTWTMANYAKTAVADIRRTVGNGKVVLALSGGVDSSVAAALISR 238

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           A+G  LTC+ VDHG MRKNE + +   F+      +RV DA+ RF+ KL ++ DPE KRK
Sbjct: 239 AVGKQLTCIFVDHGLMRKNEGDEVERAFQSSGMNFIRV-DAAARFLGKLAHVGDPEAKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
           +IG+ FI VFEEE +KIG   FL QGT+YPDVIES +   G +++IKSHHNVGGLP  +D
Sbjct: 298 IIGEEFIRVFEEEGRKIGAVDFLAQGTIYPDVIESGA---GDAAVIKSHHNVGGLPAVVD 354

Query: 365 MK-LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            K L+EPL+ LFKDEVR LG EL LPD  V R P PGPGLAIR +GEIT E+++ILRE+D
Sbjct: 355 FKGLIEPLRNLFKDEVRELGSELGLPDYLVWRQPFPGPGLAIRVMGEITAEKLDILREAD 414

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+REEI KAG+ R I Q F VL   +TVGVMGD RTY+Y  +LR VT+ D MTAD+   
Sbjct: 415 AIFREEIVKAGLARSINQYFAVLTANRTVGVMGDFRTYDYTLALRGVTTTDFMTADWARI 474

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  V+ RIVNEV  INR+VYDIT KPPATIEWE
Sbjct: 475 PYDVLETVSGRIVNEVPHINRIVYDITGKPPATIEWE 511


>gi|242240146|ref|YP_002988327.1| GMP synthase, large subunit [Dickeya dadantii Ech703]
 gi|242132203|gb|ACS86505.1| GMP synthase, large subunit [Dickeya dadantii Ech703]
          Length = 525

 Score =  549 bits (1414), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPNGIILSGGPESTTEFNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + ++ +P+LG+CYG Q M   LGG+ + S  REFG A +EIK   +L++ + ++
Sbjct: 69  PRAPEYVFQAGVPVLGVCYGMQTMAMQLGGQVEGSSEREFGYAQVEIKTPSALIRDIQDE 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+D+ P+A +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSASGAPLLDVWMSHGDKVTAIPADFVTVASTDTCPYAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + ++RI+EQVG ++VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVRDICQCEALWTPAKIIDDAIARIREQVGADKVILGLSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F       +  V A ERF+  L  I DPE KR
Sbjct: 249 RAIGDRLTCVFVDNGLLRLNEAEQVMEMFGDQFGLNIVHVPAEERFLSALAGIADPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++F++VF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KTIGRVFVDVFDEEAGKLTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPDDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 ALGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKAELYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|212710851|ref|ZP_03318979.1| hypothetical protein PROVALCAL_01919 [Providencia alcalifaciens DSM
           30120]
 gi|212686548|gb|EEB46076.1| hypothetical protein PROVALCAL_01919 [Providencia alcalifaciens DSM
           30120]
          Length = 525

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 364/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+    +  +E NP  IILSG P S+ + DS
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVTEEQIREFNPNGIILSGGPESTTEADS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LGICYG Q M   LGG  + S  REFG A +EI ++C L + + + 
Sbjct: 69  PRAPEYVFNAGVPVLGICYGMQTMSMQLGGAVEVSGEREFGYANVEILEDCDLFRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            ++       VWMSHGD+V  IP  F+ IAS+ S P+A +AD ++++Y VQFHPEV HT 
Sbjct: 129 INEDGKPVLDVWMSHGDKVTAIPSSFKTIASTPSCPYAIMADVEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  +   +  W  ++  ++ V+R+KEQ+G++ V+ A+SGGVDS+V A L++
Sbjct: 189 QGLNILKRFVLDLCQCEALWTSAAIIEDTVARLKEQIGDDHVLLALSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F+G  +  +    A +RF+  L  I DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEAEQVMEMFQGKFDLNIIHAKAEDRFMNALAGISDPEEKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +FIEVF+EE+ K+   ++L QGT+YPD+IES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KKIGHVFIEVFDEESSKLQNIKWLAQGTIYPDIIESAASATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|261345936|ref|ZP_05973580.1| GMP synthase [Providencia rustigianii DSM 4541]
 gi|282566021|gb|EFB71556.1| GMP synthase [Providencia rustigianii DSM 4541]
          Length = 525

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 265/517 (51%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARRVRE  VYCE+ A+    +  KE NP  IILSG P S+ + DS
Sbjct: 9   RILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIKEFNPNGIILSGGPESTTESDS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P  +  + +P+LGICYG Q M   LGG  + S  REFG A +EI + C L + + + 
Sbjct: 69  PRAPDYVFNAGVPVLGICYGMQTMSMQLGGAVEVSGEREFGYANVEITEQCELFRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            + +      VWMSHGD+V  IP  F+ IAS+ S P+A +A+E++++Y VQFHPEV HT 
Sbjct: 129 INAEGKPVLDVWMSHGDKVTAIPSSFKTIASTPSCPYAIMANEEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  +   +  W  ++  ++ V+R+KEQ+G++ V+ A+SGGVDS+V A L++
Sbjct: 189 QGLNILKRFVLDICQCEALWTSAAIIEDTVARLKEQIGDDHVLLALSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F G  +  +    A +RF+  L  I DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEAEQVMEMFAGKFDLNIIHAKAQDRFMNALAGISDPEEKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +FIEVF+EE+ K+   ++L QGT+YPD+IES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KKIGHVFIEVFDEESSKLPNIKWLAQGTIYPDIIESAASATGKAHVIKSHHNVGGLPDDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVSGISRVVYDISGKPPATIEWE 525


>gi|307132050|ref|YP_003884066.1| GMP synthetase (glutamine aminotransferase) [Dickeya dadantii 3937]
 gi|306529579|gb|ADM99509.1| GMP synthetase (glutamine aminotransferase) [Dickeya dadantii 3937]
          Length = 525

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPNGIILSGGPESTTEFNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + ++ +P+LG+CYG Q M   LGGK + S  REFG A +E+K N +L++ + + 
Sbjct: 69  PRAPEYVFQAGVPVLGVCYGMQTMAMQLGGKVEGSSEREFGYAQVEVKTNSALIRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+D+ P+A +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSASGAPLLDVWMSHGDKVTAIPADFVTVASTDTCPYAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI+ QVG ++VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVRDICQCEALWTPAKIIDDAVERIRVQVGKDKVILGLSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F       +  V A ERF+  L  I DPE KR
Sbjct: 249 RAIGDRLTCVFVDNGLLRLNEAEQVMEMFGDQFGLNIVHVAAEERFLSALAGIDDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++F++VF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KTIGRVFVDVFDEEAGKLTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPDDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 ALGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYEFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|126660833|ref|ZP_01731927.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Cyanothece sp. CCY0110]
 gi|126617884|gb|EAZ88659.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Cyanothece sp. CCY0110]
          Length = 542

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 368/517 (71%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++   +  ++ NP+ IILSG P S  D  +P
Sbjct: 29  IVILDFGSQYSELIARRIRETQVYSEVLSYRTTAEKLRQLNPKGIILSGGPNSVYDNRAP 88

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   +I E  IP+LG+CYG Q+M + LGG+ + +   E+G+A + I     LL  + E G
Sbjct: 89  QCDPDIWELGIPVLGVCYGMQLMVKQLGGQVEKAVRGEYGKASLRIDDPTDLLTNV-EDG 147

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGF ++A +++T  A IAD ++K + VQFHPEVVH+V G  LI
Sbjct: 148 SI--MWMSHGDSCTRLPEGFSILAHTENTLCAAIADHEKKLFGVQFHPEVVHSVDGIALI 205

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++  E +  I+ +V ++RV+ A+SGGVDS+  AFL+++AIG N
Sbjct: 206 RNFVYHICECEPTWTTEAFVDETIREIRAKVRDKRVLLALSGGVDSSTLAFLLHQAIGDN 265

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F    + P+  V+A +RF+++L+ ++DPE KR++IG  
Sbjct: 266 LTCMFIDQGFMRKGEPERLMDIFDKQFHIPVEYVNARDRFLKQLEGVIDPEKKRRLIGHE 325

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 326 FIQVFEEESKRLGPFDYLAQGTLYPDVIESADTNIDPKTGERVAVKIKSHHNVGGLPKDL 385

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 386 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDAD 445

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            + R+EI K G+Y   WQAF VLLP+++VGVMGD+RTY +   LR ++S DGMTAD+   
Sbjct: 446 FVVRDEIGKQGMYHDFWQAFAVLLPIRSVGVMGDQRTYAHPIVLRLISSEDGMTADWSKV 505

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 506 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542


>gi|134300214|ref|YP_001113710.1| GMP synthase [Desulfotomaculum reducens MI-1]
 gi|134052914|gb|ABO50885.1| GMP synthase (glutamine-hydrolyzing) [Desulfotomaculum reducens
           MI-1]
          Length = 513

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/511 (51%), Positives = 360/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+TQLIARR+R+  VYCE+     ++D  K +NP+ II SG P+S     +P
Sbjct: 9   ILVLDFGGQYTQLIARRIRDVNVYCEIEPHNVSIDKIKAKNPKGIIFSGGPSSVYGEKAP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   + E +IP+LGICYG Q+M Q L GK   ++ RE+GR  + + +  ++LK +    
Sbjct: 69  TVDPAVYELDIPVLGICYGMQLMTQQLKGKVVPAEMREYGRTTLRVMQCDNILKNL---T 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           + ++ WMSHGD+VE +P GF+V+A ++  P A +A+ ++K +AVQFHPEV+HT  G +++
Sbjct: 126 ADEECWMSHGDRVEEVPPGFQVLAQTEKAPVAAMANPEKKLFAVQFHPEVIHTPKGMEVL 185

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            +F+  + G   +W M S+  E V  +K++VGN +V+CA+SGGVDS+VAA L++ A+G N
Sbjct: 186 KSFLFDICGCSGSWSMGSFLDEAVKEVKQRVGNRQVLCALSGGVDSSVAAVLVHRAVGDN 245

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHG +RKNE E ++  F+   N  L  VDASERF+ KL+ + DPE KRK+IG  
Sbjct: 246 LTCVFVDHGLLRKNEAEQVVKTFRDQFNIKLVHVDASERFLGKLQGVTDPEQKRKIIGTE 305

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA+K+G   FL QGTLYPDV+ES +     + +IKSHHNVGGLPE M   LVE
Sbjct: 306 FIRVFEEEARKLGEIDFLVQGTLYPDVVESGT---ATAEVIKSHHNVGGLPEDMKFDLVE 362

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR LG+EL +P+  V R P PGPGLA+R +GEIT+ ++ ILRE+D +  +E
Sbjct: 363 PLRWLFKDEVRRLGEELGMPEEIVWRQPFPGPGLAVRILGEITKPKLAILREADFVVTDE 422

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I  AG+ R+IWQ F VL  +++VGVMGD RTY Y   +RAV S DGMTAD+     + L 
Sbjct: 423 IKNAGLNREIWQYFAVLPDMRSVGVMGDGRTYAYAIVVRAVYSHDGMTADWAKIPHDVLG 482

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            ++ R+VNEV  INRVVYDITSKPP TIEWE
Sbjct: 483 NISTRLVNEVAEINRVVYDITSKPPGTIEWE 513


>gi|183599368|ref|ZP_02960861.1| hypothetical protein PROSTU_02837 [Providencia stuartii ATCC 25827]
 gi|188021606|gb|EDU59646.1| hypothetical protein PROSTU_02837 [Providencia stuartii ATCC 25827]
          Length = 525

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 267/517 (51%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ++QLIARRVRE  VYCE+ A+  + +  +E NP  IILSG P S+ + DS
Sbjct: 9   RILILDFGSQYSQLIARRVREIGVYCELWAWDVSEEQIREFNPNGIILSGGPESTTENDS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + IP+LGICYG Q M   LGG  + S  REFG A +EI + C L + + + 
Sbjct: 69  PRAPEYVFNAGIPVLGICYGMQTMSMQLGGAVEVSGEREFGYAKVEITEQCDLFRDIQDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            ++       VWMSHGD+V  IP  F+ IAS+ + PFA +A+E++K+Y VQFHPEV HT 
Sbjct: 129 LNENGTPVLDVWMSHGDKVTAIPADFKTIASTPNCPFAIMANEEKKFYGVQFHPEVTHTY 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  ++  FV  +   +  W  ++   + V+R+KEQ+G++ VI A+SGGVDS+V A L+ 
Sbjct: 189 QGLNILKRFVQDICQCEALWTPAAIIDDTVARLKEQIGDDHVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F G  +  +  V A +RF+  L  I DPE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEADQVMEMFAGKFDLNIIHVKAEDRFLSALAGIHDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +FI+VF+EEA K    ++L QGT+YPD+IES +   G + +IKSHHNVGGLPE M
Sbjct: 309 KAIGHVFIDVFDEEASKQTQVKWLAQGTIYPDIIESAASATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKAELYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525


>gi|256425803|ref|YP_003126456.1| GMP synthase [Chitinophaga pinensis DSM 2588]
 gi|256040711|gb|ACU64255.1| GMP synthase, large subunit [Chitinophaga pinensis DSM 2588]
          Length = 512

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/517 (51%), Positives = 372/517 (71%), Gaps = 9/517 (1%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K+LI+DFGSQ+TQLIAR +RE  +YCE+      + +  +   + IILSGSP S  D 
Sbjct: 2   TEKILILDFGSQYTQLIARSIRELNIYCEIKPCLAPIQW--DDTVKGIILSGSPFSVNDA 59

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
            +P +    + + +P+LG+CYG Q+  +  GG+   S  RE+GRAF++       L  ++
Sbjct: 60  GAPTVDIAAMAAKVPVLGVCYGAQLTAKVFGGEVAKSSIREYGRAFMDHGNKEEKL--LY 117

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADE---KRKYYAVQFHPEVVHTV 183
           +  S+ QVWMSH D +  +PEGFE+IA +D+ P A    E   K     +QFHPEV H++
Sbjct: 118 DISSRSQVWMSHSDTIVRMPEGFEIIAHTDNIPVAAFKSETVAKHPILGLQFHPEVTHSL 177

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G QL+ NF+ H+ G   +W  +++ +E + +IK QVG+++V+ A+SGGVDSTVAA LI+
Sbjct: 178 EGKQLLRNFLVHICGCAQDWTPAAFVQETIEKIKAQVGDKKVVMALSGGVDSTVAAELIH 237

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
           +AIG NL C+ VD+G +RKNE EN++  +K +    ++ V+A + F  +LK + DPE KR
Sbjct: 238 KAIGSNLYCIFVDNGLLRKNEFENVLDSYK-HMGLNVKGVNAKDLFFGELKGVSDPEKKR 296

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG+LFIEVF++EA  +    FLGQGT+YPDVIES+S   GPS  IKSHHNVGGLPE M
Sbjct: 297 KIIGRLFIEVFQQEATLLTDISFLGQGTIYPDVIESVSV-NGPSVTIKSHHNVGGLPEKM 355

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           +M LVEPL+ LFKDEVR +G+E+ + + F+ RHP PGPGLAIR +GEIT E++ +L+E+D
Sbjct: 356 NMGLVEPLRFLFKDEVRRVGREIGISEIFLGRHPFPGPGLAIRILGEITPEKVAMLQEAD 415

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           A+Y + + +A +Y K+WQA T+LLPVQ+VGVMGDERTYE+  +LRAVTS+DGMTAD+ H 
Sbjct: 416 AVYIDGLREAELYDKVWQAGTILLPVQSVGVMGDERTYEFTVALRAVTSVDGMTADWAHL 475

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL++++  I+N+VKGINRVVYDI+SKPPATIEWE
Sbjct: 476 PYEFLAKMSNDIINKVKGINRVVYDISSKPPATIEWE 512


>gi|251794871|ref|YP_003009602.1| GMP synthase, large subunit [Paenibacillus sp. JDR-2]
 gi|247542497|gb|ACS99515.1| GMP synthase, large subunit [Paenibacillus sp. JDR-2]
          Length = 511

 Score =  548 bits (1413), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 363/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q+ QLIARR+R+  VY E++ F  +++  +E  P+ I+ SG PAS  +  SP
Sbjct: 7   IIVLDFGGQYNQLIARRIRDLGVYSELLPFNTSVERIRELQPKGIVFSGGPASVYEEKSP 66

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   I +  +P+ GICYG Q+M   L GK + +  RE+G+A ++  +   L +G+    
Sbjct: 67  LVDPAIYDLGVPIFGICYGMQMMSHQLEGKVERAGKREYGKAEVDFAEGSHLAQGL---D 123

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           ++Q VWMSH D V   P GF V AS++  P A +++  RK++AVQFHPEV H+V G+++I
Sbjct: 124 ARQTVWMSHSDLVVEPPAGFRVDASTEHAPIAAMSNPDRKFFAVQFHPEVRHSVYGNEMI 183

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++++ G + NW M S+ ++ ++ I+ QVG+ +V+C +SGGVDS+V A LI++AIG  
Sbjct: 184 RNFLYNICGCEGNWTMESWIEDTITDIRNQVGDRKVLCGLSGGVDSSVVAMLIHKAIGDQ 243

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK+E E+++  F G  +  +  +DASERF+ KLK + DPE KRK+IG  
Sbjct: 244 LTCMFIDHGMLRKDEAESVMETFVGKFDMKVVKIDASERFLGKLKGVTDPEQKRKIIGNE 303

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VF+EE+ K+G   FL QGTLY D++ES +     +  IKSHHNVGGLPE M  +LVE
Sbjct: 304 FIYVFDEESAKLGEFDFLAQGTLYTDIVESGT---ATAQTIKSHHNVGGLPEDMKFELVE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVR +G E  LPD  V R P PGPGLAIR +GE+TE++++I+RESDAI R+E
Sbjct: 361 PLKTLFKDEVRKVGAECGLPDEIVHRQPFPGPGLAIRVLGEVTEDKLHIVRESDAILRDE 420

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 421 IAKAGLDREIWQYFTALPGMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLE 480

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV  +NR+VYD+TSKPPATIEWE
Sbjct: 481 KISVRIVNEVDNVNRIVYDVTSKPPATIEWE 511


>gi|289423312|ref|ZP_06425120.1| GMP synthase [Peptostreptococcus anaerobius 653-L]
 gi|289156243|gb|EFD04900.1| GMP synthase [Peptostreptococcus anaerobius 653-L]
          Length = 511

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 263/514 (51%), Positives = 370/514 (71%), Gaps = 11/514 (2%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL+IDFG Q+ QLIARRVRE+ VYCE++ +   ++  KE+NP+ II +G P S+   DSP
Sbjct: 6   VLVIDFGGQYNQLIARRVRENNVYCEILPYTCGIEKIKEKNPKGIIFTGGPNSAYLEDSP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTK--NSQSREFGRAFIEIKKNCSLLKGMWE 127
           +I +EI E  +P+LGICYG Q+M   LGG  +  ++ +RE+G+  I+  ++      ++E
Sbjct: 66  KISEEIFELGVPILGICYGDQLMAHLLGGTVEKGDNMTREYGKTIIDYGQST-----IFE 120

Query: 128 KGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQ 187
                QVWMSH D +   PEGFEV+A++ + P A + +  +K Y VQFHPEV H++ G +
Sbjct: 121 GVDTNQVWMSHTDYISQAPEGFEVVATTKNCPVAAMQNVAKKLYGVQFHPEVEHSLDGDK 180

Query: 188 LIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIG 247
           ++ NF+++V  +  +W  SS+  + V+ IK  VG+++ +CA+SGGVDS+VAA L+++AIG
Sbjct: 181 ILKNFLYNVCEVAGDWTTSSFIDDKVAEIKAMVGDKKALCALSGGVDSSVAAALMHKAIG 240

Query: 248 INLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307
            NLTCV VDHG +RKNE +++  +F+      L  V+A +RF+ KL  + +PE KRK+IG
Sbjct: 241 KNLTCVFVDHGLLRKNEGDDVERIFREKFGMNLVRVNAEDRFLGKLAGVTEPEAKRKIIG 300

Query: 308 QLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK- 366
           + FI VFEEE+ K+G   FL QGT+YPDVIES     G S+ IKSHHNVGGLPE +D + 
Sbjct: 301 EEFIRVFEEESHKLGKMDFLVQGTIYPDVIESGL---GDSATIKSHHNVGGLPEDVDFQE 357

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           ++EPL+ELFKDEVR +G EL + ++ + RHP PGPGL IR IGE+T+E+ +ILRE+DA+Y
Sbjct: 358 IIEPLRELFKDEVRKIGLELGIEENLIFRHPFPGPGLGIRVIGEVTKEKCDILREADAVY 417

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            +E+ KA +Y++IWQAF  L  V+TVGVMGDERTY Y+  +RAV S DGMT+D+Y     
Sbjct: 418 MDELRKADLYKEIWQAFATLPDVKTVGVMGDERTYAYLVGIRAVASSDGMTSDWYKIPYE 477

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV+G+NRVVYDITSKPP TIEWE
Sbjct: 478 VLERISNRIINEVEGVNRVVYDITSKPPGTIEWE 511


>gi|320352192|ref|YP_004193531.1| GMP synthase [Desulfobulbus propionicus DSM 2032]
 gi|320120694|gb|ADW16240.1| GMP synthase (glutamine-hydrolyzing) [Desulfobulbus propionicus DSM
           2032]
          Length = 516

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/514 (51%), Positives = 354/514 (68%), Gaps = 2/514 (0%)

Query: 7   SSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI 66
           + K++I+DFGSQ TQLIARR+RE KVY E+  +   LD      P  I+LSG PAS  D 
Sbjct: 5   TQKIIILDFGSQTTQLIARRIREQKVYSEIHPYTLPLDRLAALRPTGIVLSGGPASVYDD 64

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW 126
           D+P     + E  +P+LGICYG Q+M   LGG+ + ++ REFG+A + I     L  GM 
Sbjct: 65  DAPISDPGVFELGVPVLGICYGAQLMTVQLGGRVERAEKREFGKAQLNIAYTGGLFAGME 124

Query: 127 EKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGS 186
              +  QVWMSHGD++E +  GF V A+S  +P+A I   +  +  VQFHPEV HT+ G+
Sbjct: 125 VAPAHYQVWMSHGDRIEELAPGFVVTATSGHSPYAAIRHGENPFVGVQFHPEVAHTLIGT 184

Query: 187 QLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAI 246
            ++ NF+  + G + +W M S+    V+ I+ +VG++RVICA+SGGVDS+V A L++ AI
Sbjct: 185 DVLRNFIFGLCGCRPDWTMHSFIDSTVAEIRAKVGSDRVICALSGGVDSSVVAALVHRAI 244

Query: 247 GINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVI 306
           G  LTC+ V++G MR  E E+++  F+   +  +  VDA+E F+  L  + DPE KRK I
Sbjct: 245 GDQLTCIHVNNGLMRTGESESVLRFFREKTSLTVIDVDATEFFLNALDGVADPEEKRKRI 304

Query: 307 GQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           G  FIE+FE EAKK+G  ++L QGTLYPDVIES+ F G   + IKSHHNVGGLPE M + 
Sbjct: 305 GYGFIEIFEAEAKKLGKVRYLAQGTLYPDVIESVVFRG--KAPIKSHHNVGGLPERMQLD 362

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPL+ELFKDEVR LG EL LP+  + R P PGPGL IR +G I  ER+ ILR++D I 
Sbjct: 363 LIEPLRELFKDEVRELGLELGLPEEAIYRQPFPGPGLGIRIMGAINAERLRILRQADVIV 422

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EE+  AG YRK+WQ+F VLLP+QTVGVMGD RTYE+V +LR V S D MTAD+     +
Sbjct: 423 LEEMKDAGWYRKVWQSFAVLLPIQTVGVMGDGRTYEHVIALRCVDSRDAMTADWSQLPYD 482

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            L +++ RI+NEV+G+NRVVYDI+SKPPATIEWE
Sbjct: 483 LLGRISNRIINEVRGVNRVVYDISSKPPATIEWE 516


>gi|319956181|ref|YP_004167444.1| gmp synthase (glutamine-hydrolyzing) [Nitratifractor salsuginis DSM
           16511]
 gi|319418585|gb|ADV45695.1| GMP synthase (glutamine-hydrolyzing) [Nitratifractor salsuginis DSM
           16511]
          Length = 514

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 273/512 (53%), Positives = 359/512 (70%), Gaps = 5/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFGSQ+TQLIAR++RES VY EV+ ++  L+  K + P+ IILSG PAS    D+ 
Sbjct: 7   IVVLDFGSQYTQLIARKLRESGVYTEVVPYREDLEAIKARKPKGIILSGGPASVYAEDAY 66

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              + I +  +P+LGICYG Q++ Q  GG+   +   E+G+A + I K  S +    +  
Sbjct: 67  HPDEGIWDLGLPILGICYGMQLIAQHFGGEVVPADHHEYGKARLHITKPDSPI--FKDVP 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
               VWMSHGD+VE +PEGFE IA SD++P A IADE R+ YA QFHPEV H+V G +++
Sbjct: 125 DNSIVWMSHGDRVEKLPEGFETIAVSDNSPHAAIADENRQIYAFQFHPEVHHSVEGVKML 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF  ++ G +  W M S+ KE +  I++QVG+++V+C VSGGVDS+V A L++EAIG  
Sbjct: 185 KNFAKYICGAESTWNMGSFAKEKIEEIRKQVGDKKVLCGVSGGVDSSVVAALLHEAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L  V VD G +RKNE + +  +FK      L  VDASE+F+ +LK + DPE KRK+IG+ 
Sbjct: 245 LIAVFVDTGLLRKNEAQQVQDMFKQL-GIDLITVDASEKFLSRLKGVTDPERKRKIIGET 303

Query: 310 FIEVFEEEAKKIGG-AQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           FIEVF+EEAKK      FL QGTLY DVIES+S   GPS  IKSHHNVGGLPE M  +LV
Sbjct: 304 FIEVFDEEAKKHADEVSFLAQGTLYTDVIESVSV-KGPSKTIKSHHNVGGLPEWMTFELV 362

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+E+FKDEVR LG EL LP   + RHP PGPGLAIR +GE+ EE + +LR+SD I +E
Sbjct: 363 EPLREIFKDEVRKLGLELGLPKHMIGRHPFPGPGLAIRVMGEVNEEALRLLRDSDEIMQE 422

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           E+  +G Y K+WQAFTVLL V +VGVMGD RTY+    +R V S+DGMTA F +   + L
Sbjct: 423 ELRASGYYDKVWQAFTVLLNVSSVGVMGDNRTYDNTVCVRMVESVDGMTATFAYVPHDIL 482

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             ++ RI+NE+ GINRVVYDI+SKPPATIEWE
Sbjct: 483 ENISRRIINEIDGINRVVYDISSKPPATIEWE 514


>gi|330837271|ref|YP_004411912.1| GMP synthase (glutamine-hydrolyzing) [Spirochaeta coccoides DSM
           17374]
 gi|329749174|gb|AEC02530.1| GMP synthase (glutamine-hydrolyzing) [Spirochaeta coccoides DSM
           17374]
          Length = 520

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 270/524 (51%), Positives = 351/524 (66%), Gaps = 8/524 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           MH  +  + V+++DFG+Q++QLIARRVRE  VY  ++ +  +    ++  P  II SG P
Sbjct: 1   MHTTQHDT-VVVLDFGAQYSQLIARRVREQGVYSLIVPYTISAQELRKMAPVGIIFSGGP 59

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIK---- 116
           AS    DSP+    I    IP+LGICYG Q+M    GG  +   +RE+G A + +     
Sbjct: 60  ASVSTEDSPRPDAGIYGLGIPVLGICYGLQVMSVMNGGTVRRPDAREYGFAHLHLNHFTG 119

Query: 117 KNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH 176
           K   LL G+ E     Q+WMSHGD V  +P GF    S+ + P     +E R+ Y VQFH
Sbjct: 120 KTSRLLAGIPEG---SQLWMSHGDSVVDLPTGFVTTGSTPNCPVTVAENEARRLYGVQFH 176

Query: 177 PEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDST 236
           PEVVH+  G+ ++ NFV  + G + +W M S+    V RI+  VG+ +V+C +SGGVDS+
Sbjct: 177 PEVVHSTDGTAVLRNFVMDICGAKADWSMESFIATEVERIRSVVGDRKVLCGLSGGVDSS 236

Query: 237 VAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNI 296
           VAA LI++AIG  L CV V++G +RKNE +N++ LF  + N  L  VDA   F+  LK I
Sbjct: 237 VAAVLIHKAIGDQLVCVFVNNGMLRKNEAQNVVDLFGKHFNMRLEYVDAETAFLDALKGI 296

Query: 297 VDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNV 356
            +PE KRK+IG++F++VF + A+ +G   FL QGTLYPDVIES S  GGPS+ IKSHHNV
Sbjct: 297 AEPEAKRKIIGKMFVDVFYDAARSLGDISFLAQGTLYPDVIESRSPSGGPSATIKSHHNV 356

Query: 357 GGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERI 416
           GGLP+ +  +L+EPLKELFKDEVR LG EL L +  V RHP PGPGL +RCIGE+T+ER+
Sbjct: 357 GGLPDDLKWELLEPLKELFKDEVRQLGMELGLAEELVNRHPFPGPGLGVRCIGEVTKERL 416

Query: 417 NILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           + LRE DAI+ EEI +AG+Y  IWQA   LLPV++VGV GDERTY  VCSLRAVTS D M
Sbjct: 417 DTLREVDAIFVEEIRRAGLYGDIWQALACLLPVKSVGVQGDERTYREVCSLRAVTSQDAM 476

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TAD+Y      L   A RI NEV G+NRV+YDITSKPP TIEWE
Sbjct: 477 TADWYRFPPEVLQTTASRICNEVAGVNRVLYDITSKPPGTIEWE 520


>gi|67921332|ref|ZP_00514851.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Crocosphaera
           watsonii WH 8501]
 gi|67857449|gb|EAM52689.1| GMP synthase, C-terminal:GMP synthase, N-terminal [Crocosphaera
           watsonii WH 8501]
          Length = 515

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/517 (51%), Positives = 366/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++  ++  ++ NP+ IILSG P S  D  +P
Sbjct: 2   IVILDFGSQYSELIARRIRETQVYSEVLSYRTTVEKLRQLNPKGIILSGGPNSVYDDRAP 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   EI +  IP+LG+CYG Q+M + LGG+ + +   E+G+A + I     LL  + E G
Sbjct: 62  QCDPEIWQLGIPVLGVCYGMQLMVKQLGGQVEKATRGEYGKASLCIDDPTDLLTNV-EDG 120

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGF ++A +++T  A IA+ ++K + VQFHPEVVH+V G  LI
Sbjct: 121 ST--MWMSHGDSCTRLPEGFSILAHTENTVCAAIANHEKKLFGVQFHPEVVHSVDGIALI 178

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++  E +  I+ +VG++RV+ A+SGGVDS+  AFL+++AIG  
Sbjct: 179 RNFVYHICECEPTWTTEAFVDETIREIRAKVGDKRVLLALSGGVDSSTLAFLLHQAIGDK 238

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F    + P+  V A +RF+ KL+ I DPE KR++IG  
Sbjct: 239 LTCMFIDQGFMRKGEPERLMDIFDRQFHIPVEYVHARDRFLNKLEGITDPEKKRRLIGHE 298

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 299 FIQVFEEESKRLGPFDYLAQGTLYPDVIESADTNVDPKTGERVAVKIKSHHNVGGLPKDL 358

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 359 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDAD 418

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            + R+EI K G+Y   WQAF VLLPV++VGVMGD+RTY +   LR +TS DGMTAD+   
Sbjct: 419 FVVRDEIAKQGMYHDFWQAFAVLLPVRSVGVMGDQRTYAHPIVLRLITSEDGMTADWAKV 478

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 479 PYDLLEIISNRIVNEVKGVNRVVYDITSKPPGTIEWE 515


>gi|254421737|ref|ZP_05035455.1| glutamine amidotransferase, SNO family [Synechococcus sp. PCC 7335]
 gi|196189226|gb|EDX84190.1| glutamine amidotransferase, SNO family [Synechococcus sp. PCC 7335]
          Length = 542

 Score =  548 bits (1412), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 361/515 (70%), Gaps = 9/515 (1%)

Query: 12  IIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSPQI 71
           I+DFGSQ+++LIARR+RE++VY EV++++ + +  ++ NP+ IILSG P S  D  +P  
Sbjct: 31  ILDFGSQYSELIARRIRETEVYSEVLSYRTSAEQLRQLNPKGIILSGGPNSVYDKGAPAC 90

Query: 72  PKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSK 131
             EI    IP+LG+CYG Q+M Q LGG+ +  +  E+G+A + +     +LK + +  + 
Sbjct: 91  DPEIWNLGIPVLGVCYGMQLMVQQLGGQVERVERGEYGKASLLVDAGTDILKNVADAST- 149

Query: 132 QQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLIDN 191
             +WMSH D V  +PEGFEV+A + +TP A IA+ ++K+Y VQFHPEVVH+  GS LI N
Sbjct: 150 --MWMSHADSVTRLPEGFEVLAHTVNTPQAAIANHQKKFYGVQFHPEVVHSTEGSTLIRN 207

Query: 192 FVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLT 251
           FV+ +   +  W   ++ +E +  ++ +VG++RV+ A+SGGVDS+  AFL+++AIG  LT
Sbjct: 208 FVYDICQCEPTWTTEAFVEEAIREVRAKVGDQRVLLALSGGVDSSTLAFLLHKAIGEQLT 267

Query: 252 CVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFI 311
           C+ +D GFMRK E E +I +F    +  +  +DA +RF+ K+K + DPE KRK+IG  FI
Sbjct: 268 CMFIDQGFMRKREPERLIEIFNNRFHINVEYIDARDRFLAKIKGVTDPEEKRKIIGHEFI 327

Query: 312 EVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHMDM 365
           +VFEEE+ ++G   +L QGTLYPDVIES      PS+       IKSHHNVGGLPE +  
Sbjct: 328 QVFEEESTRLGPFDYLAQGTLYPDVIESADTNVDPSTGERVAVKIKSHHNVGGLPEDLRF 387

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           KL+EPL++LFKDEVR +G  + LP+  V RHP PGPGLAIR +GE+T ER++ILRE+D I
Sbjct: 388 KLIEPLRKLFKDEVRKVGTAVNLPEDIVRRHPFPGPGLAIRILGEVTAERLHILREADYI 447

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
            R+EI ++  Y   WQAF VLLPV++VGVMGD+RTY Y   LR V+S DGMTAD+     
Sbjct: 448 IRQEIRRSDSYHDFWQAFGVLLPVRSVGVMGDQRTYAYPIVLRLVSSEDGMTADWSRAPY 507

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L  ++ R+VNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 508 ELLENISNRVVNEVEGVNRVVYDITSKPPGTIEWE 542


>gi|125972896|ref|YP_001036806.1| GMP synthase [Clostridium thermocellum ATCC 27405]
 gi|259647675|sp|A3DCD4|GUAA_CLOTH RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|125713121|gb|ABN51613.1| GMP synthase (glutamine-hydrolyzing) [Clostridium thermocellum ATCC
           27405]
          Length = 511

 Score =  548 bits (1411), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 264/512 (51%), Positives = 372/512 (72%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+ QLIARRVRE+ VYCEV+ + +++D  K +NP+ II +G PAS LD  +P
Sbjct: 6   ILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              +E+ E  IP+LGICYG Q+M   LGG  + ++ RE+G+  I    +  L +G+ ++ 
Sbjct: 66  ICDREVFELGIPILGICYGMQLMSHMLGGTVEKAEQREYGKVNITFDTSSMLFEGIEKES 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +    WMSH   V ++PEGF   A + + P A I + ++K Y VQFHPEVVHT  G  ++
Sbjct: 126 T---CWMSHTYYVNNLPEGFVKCADTPNCPVAAIENREKKLYGVQFHPEVVHTPKGRDIL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF++ + G   +W M+S+ +  ++ I+E+VG+++V+CA+SGGVDS+VAA L+++A+G  
Sbjct: 183 NNFLYKICGCSGDWKMASFIEHSINSIREKVGDKKVLCALSGGVDSSVAAVLVHKAVGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKYEGDQVEEVFKKQFDISLIRVNAEDRFLEKLKGVTDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFEEEAKKIG   FL QGT+YPDVIES     G +++IKSHHNVGGLP+++D K ++
Sbjct: 303 FIRVFEEEAKKIGTVDFLVQGTIYPDVIESGV---GDAAVIKSHHNVGGLPDYIDFKEII 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ LFKDEVR +G EL +P+  V R P PGPGLA+R IGE+T+E+++ILR++D I+RE
Sbjct: 360 EPLRSLFKDEVRKVGIELGIPEDIVMRQPFPGPGLAVRVIGEVTKEKVDILRDADYIFRE 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+ R+I Q F VL  +++VGVMGDERTY+Y  +LRAVT+ID MTAD+     + L
Sbjct: 420 EIKNAGLDREINQYFAVLTGMRSVGVMGDERTYDYTLALRAVTTIDFMTADWAKIPYDVL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RIVNEVK INR+VYDIT+KPPATIEWE
Sbjct: 480 EKVSNRIVNEVKHINRIVYDITTKPPATIEWE 511


>gi|284006291|emb|CBA71526.1| GMP synthase [glutamine-hydrolyzing] [Arsenophonus nasoniae]
          Length = 525

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 368/517 (71%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ A+  +    +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLIARRIREIGVYCELWAWDVSEAQIREFNPNGIILSGGPESTTEQNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+  + + ++ +P+LGICYG Q M   LGG+ + S  REFG A + I+++C L + +++ 
Sbjct: 69  PRASEYVFQAGVPVLGICYGMQTMSIQLGGQVEVSGEREFGYAQVSIQQSCELFRDIYDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S +      VWMSHGD+V  IP  F++IAS+DS PFA +A++++++Y VQFHPEV HT 
Sbjct: 129 LSAEGKPLLDVWMSHGDKVTAIPTDFKIIASTDSCPFAIMANDEKRFYGVQFHPEVTHTH 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G+ ++  FV  + G +  W  ++  ++ V R+K Q+G+++VI A+SGGVDS+V A L+ 
Sbjct: 189 QGAAILQRFVLDICGCKARWTAAAIVEDTVQRLKAQIGDDQVILALSGGVDSSVTALLLN 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++++F G  +  +  V A ERF+  L  I +PE KR
Sbjct: 249 RAIGKQLTCVFVDNGLLRLNEAQQVMAMFAGKFDLNIIHVAAEERFLNALAGIDEPELKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++FI+VF+E+A K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLP  M
Sbjct: 309 KTIGRVFIDVFDEQAAKQTQVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPAEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPLKELFKDEVR +G  L LP   + RHP PGPGL +R +GE+ +   ++LR++D
Sbjct: 369 RMGLVEPLKELFKDEVRKVGLALGLPYDMLYRHPFPGPGLGVRVLGEVKKAYCDLLRQAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYHKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVAGISRVVYDISGKPPATIEWE 525


>gi|294793177|ref|ZP_06758323.1| GMP synthase [Veillonella sp. 6_1_27]
 gi|294456122|gb|EFG24486.1| GMP synthase [Veillonella sp. 6_1_27]
          Length = 511

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/517 (52%), Positives = 359/517 (69%), Gaps = 8/517 (1%)

Query: 5   ERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSL 64
           E    V+++DFG Q+ QLIARRVRE+ VYCEV  +  ALD  KE  PQ II +G P S  
Sbjct: 2   ENKEFVIVVDFGGQYNQLIARRVRENHVYCEVYPYNKALDKIKELKPQGIIFTGGPNSVY 61

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
           + +SP+I KEI E  IP+LG+CYG Q M  +LGG+ K++ +REFG+   ++     L KG
Sbjct: 62  EENSPKIEKEIFELGIPILGMCYGMQFMAHTLGGEVKSADNREFGKTPTKVDTTSPLFKG 121

Query: 125 MWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVG 184
           + E    Q VWMSH D V  +PEGFE++A +   P A + + +RK YA+Q+H EV+HT  
Sbjct: 122 LEED---QVVWMSHVDYVAKVPEGFEIVAHTKDCPVASMQNTERKLYAMQYHAEVLHTEH 178

Query: 185 GSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYE 244
           G +++ NF++ V G    W M++Y K  +  I++ VG+ +V+ A+SGGVDS+VAA LI +
Sbjct: 179 GKEMLHNFLYEVCGFTGTWTMANYAKSAIEDIRKTVGDGKVLLALSGGVDSSVAAALISK 238

Query: 245 AIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRK 304
           A+G  LTC+ VDHG MRKNE + + + FK      +RV DA +RF+ KL  + DPE KRK
Sbjct: 239 AVGDQLTCIFVDHGLMRKNEGDEVEAAFKDSGMHFIRV-DAEKRFLDKLAGLEDPEAKRK 297

Query: 305 VIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMD 364
            IG+ FI VFE+E +KIG   FL QGT+YPDVIES +   G + +IKSHHNVGGLP  +D
Sbjct: 298 AIGEEFIRVFEDEGRKIGSVDFLAQGTIYPDVIESGT---GEAEVIKSHHNVGGLPAVVD 354

Query: 365 MK-LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            K L+EPL+ LFKDEVR LG EL L D  V R P PGPGLAIR +GEIT+E+++ILR++D
Sbjct: 355 FKGLIEPLRNLFKDEVRELGSELGLADYLVWRQPFPGPGLAIRVMGEITKEKLDILRDAD 414

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            I+R+EI KAG+ R I Q F VL   +TVGVMGD RTY+Y  +LR VT+ D MTAD+   
Sbjct: 415 YIFRDEIAKAGLDRSINQYFAVLTSTRTVGVMGDFRTYDYTLALRGVTTTDFMTADWARI 474

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEV+ INR+VYDITSKPPATIEWE
Sbjct: 475 PYDVLDTISRRIVNEVQHINRIVYDITSKPPATIEWE 511


>gi|310764763|gb|ADP09713.1| GMP synthase [Erwinia sp. Ejp617]
          Length = 526

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+    +  +  NP  IILSG P S+ + DS
Sbjct: 10  RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRGFNPNGIILSGGPESTTEHDS 69

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P  +  + +P+LG+CYG Q M   LGGK + S  REFG A +E+K   +L++ + + 
Sbjct: 70  PRAPDYVFNAGVPVLGVCYGMQTMALQLGGKVEGSSEREFGYAQVEVKNQSALIRDIEDA 129

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+D+ PFA +A+E +++Y VQFHPEV HT 
Sbjct: 130 ISADGKPLLDVWMSHGDKVTAIPSDFVTVASTDTCPFAIMANEDKRFYGVQFHPEVTHTR 189

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G +L++ FV  +   +  W  +   ++ V+R++EQVGN++VI  +SGGVDS+V A L++
Sbjct: 190 QGLRLLERFVRDICQCEALWTPAKIIEDAVARLREQVGNDKVILGLSGGVDSSVTAMLLH 249

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F  +    +  V A  RF+  L    +PE KR
Sbjct: 250 RAIGDRLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIIHVAAENRFLDALAGTDEPEAKR 309

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 310 KIIGRVFVEVFDEEATKLSDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 369

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 370 KLGLVEPLKELFKDEVRKIGLELGLPHAMLFRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 429

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 430 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 489

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL +V+ RI+NE+ GI+RVVYDI+ KPPATIEWE
Sbjct: 490 PYEFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE 526


>gi|330445254|ref|ZP_08308906.1| guaA GMP synthetase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489445|dbj|GAA03403.1| guaA GMP synthetase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 527

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/517 (51%), Positives = 366/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARR+RE  VYCE+ ++       +E  P  IILSG P S  +  S
Sbjct: 11  RILILDFGSQYTQLIARRIREIGVYCELWSWDVDEADIREFAPNGIILSGGPESVTEAGS 70

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMW-- 126
           P+ P+ + E+ +P+ G+CYG Q M + LGGK   S  REFG A ++I +    L+G+   
Sbjct: 71  PRAPQYVFEAGVPVFGVCYGMQTMAEQLGGKVAGSSEREFGYAQVKIVEPTHFLEGIQDA 130

Query: 127 --EKGSK-QQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
             E G+    VWMSHGD+V  IP  F  +A +++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 131 VAEDGTALMDVWMSHGDKVVEIPSDFVKVAETETCPFAAMANEEKRFYGVQFHPEVTHTR 190

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G +LI+NFV ++ G +  W  ++  ++ V+RIKEQVG++ VI  +SGGVDS+V A LI+
Sbjct: 191 QGMKLIENFVMNICGCEKLWTSANIIEDAVARIKEQVGDDEVILGLSGGVDSSVVAMLIH 250

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F       +  V A ERF+  L  I DPE KR
Sbjct: 251 RAIGDKLTCVFVDNGLLRLNEGQQVMDMFGDKFGLNIVHVQAEERFLSALAGIDDPEAKR 310

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG +F++VF+EE+KK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 311 KKIGHVFVDVFDEESKKLSNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLPDDM 370

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           +M LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 371 EMGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 430

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 431 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 490

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 491 PYDFLGKVSNRIINEVDGISRVVYDISGKPPATIEWE 527


>gi|222529421|ref|YP_002573303.1| GMP synthase [Caldicellulosiruptor bescii DSM 6725]
 gi|259647755|sp|B9MS76|GUAA_ANATD RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|222456268|gb|ACM60530.1| GMP synthase, large subunit [Caldicellulosiruptor bescii DSM 6725]
          Length = 511

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 366/512 (71%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARRVRE  VYCE+  +   L+    +NP+ II +G P+S  + ++P
Sbjct: 6   VIVLDFGGQYNQLIARRVRECGVYCEIWPYDTPLEKIISKNPKGIIFTGGPSSVYEPNAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            I KE+ E  IP+LGICYG Q++   +GGK   +  RE+G+  I+   +  L  G+ E  
Sbjct: 66  MIDKELFEKGIPILGICYGNQLIAHIMGGKVSRALFREYGKTHIKYDISSPLFSGIPEHS 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
                WMSH D VE +PEGF+ +AS+++   A   D+ RK Y VQFHPEVVHT  G ++I
Sbjct: 126 V---CWMSHTDFVEKLPEGFKALASTENCSIAAFGDDTRKIYGVQFHPEVVHTEYGQKII 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF+ ++     +W  SS+ +E V+ IK+ VGN++V+CA+SGGVDS+VAA L+++AIG N
Sbjct: 183 ENFLFNICNCHGDWKTSSFIEEKVNEIKDIVGNQKVVCALSGGVDSSVAAVLVHKAIGKN 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L C+ VDHG +RK E E ++S+FK   +  +  VDA +RF+  LK + DPE KRK+IG+ 
Sbjct: 243 LYCIFVDHGLLRKGEAEEVVSVFKDKFDMNVIKVDAKDRFLEALKGVTDPEEKRKIIGRE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFEEEA+K+G  +FL QGT+YPDV+ES     G ++ IKSHHNVGGLPE +  K ++
Sbjct: 303 FIRVFEEEAEKLGDIKFLVQGTIYPDVVESGV---GKAATIKSHHNVGGLPEKIKFKQII 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL++LFKDEVR +G EL +P+  V+R P PGPGLAIR IGE+TEE+++ILRE D I+R+
Sbjct: 360 EPLRDLFKDEVRRVGIELGIPEKIVKRQPFPGPGLAIRIIGEVTEEKLDILREVDWIFRK 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI ++G+  +IWQ F VL  +++VGVMGDERTY+Y  +LRAVTSIDGMTAD+       L
Sbjct: 420 EIEQSGLDNEIWQYFAVLTNMKSVGVMGDERTYDYTVALRAVTSIDGMTADWAKIPYEIL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+  IVN VK +NRVVYDITSKPPATIEWE
Sbjct: 480 ERVSNEIVNSVKKVNRVVYDITSKPPATIEWE 511


>gi|332140458|ref|YP_004426196.1| GMP synthase [Alteromonas macleodii str. 'Deep ecotype']
 gi|226738378|sp|B4RV80|GUAA_ALTMD RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|327550480|gb|AEA97198.1| GMP synthase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 525

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 270/517 (52%), Positives = 360/517 (69%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQLIARRVRE  VYCE+ A+    +  +E NPQ IILSG P S  +  S
Sbjct: 9   RILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGPESVTEEGS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK----G 124
           P+ P  + E+ +P+LG+CYG Q M   LGG    S  REFG A +E+ K   LL      
Sbjct: 69  PRAPDYVFEAGVPVLGVCYGMQTMAHQLGGGVLGSDKREFGYAQVEVIKPSPLLDKIEDA 128

Query: 125 MWEKGSKQ-QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
           + + G+    VWMSHGD+V  IPEGFE IA + S P A + +E++++Y VQFHPEV HT 
Sbjct: 129 IGDNGAALLDVWMSHGDKVAAIPEGFETIAQTASCPHAAMYNEEKQFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G +L+  FV  +   +  W   +  ++ + RIKE+VG+ERVI  +SGGVDS+V A L++
Sbjct: 189 QGMRLLTQFVMDICKCEKLWTAGAIIEDAIERIKEKVGDERVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  VDA  RF+ +LK I DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEADQVMEMFGDHFGLNIIRVDAEGRFLDRLKGIEDPELKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG  F+ VF+EEA K+  A++L QGT+YPDVIES     G + +IKSHHNVGGLPE M
Sbjct: 309 KAIGNEFVRVFDEEASKLENAKWLAQGTIYPDVIESAGSATGKAHVIKSHHNVGGLPEDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           ++ LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GEI +E  ++LR +D
Sbjct: 369 ELGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE++ A +Y+K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELYAADLYQKVSQAFTVFLPVRSVGVMGDARKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NE+ GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGKVSNRIINEIDGISRVVYDISGKPPATIEWE 525


>gi|315645200|ref|ZP_07898326.1| GMP synthase, large subunit [Paenibacillus vortex V453]
 gi|315279621|gb|EFU42926.1| GMP synthase, large subunit [Paenibacillus vortex V453]
          Length = 512

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 364/511 (71%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q+ QLIARR+R+  VY E++ +   ++  K  +P+ I+ SG P+S    ++P
Sbjct: 8   IVVLDFGGQYNQLIARRIRDLGVYSELLPYNTPVEKIKALSPRGIVFSGGPSSVYAENAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   I +  +P+ GICYG Q+M Q L GK + +  RE+G+A +E   N +L+KG+ +K 
Sbjct: 68  HVDPAIYDLELPIFGICYGMQLMAQQLDGKVERASKREYGKAELEFAPNSTLVKGIEQK- 126

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
             Q VWMSHGD V  +P GF++ A ++S P A +++E++K YAVQFHPEV H+V G+++I
Sbjct: 127 --QTVWMSHGDHVVSLPSGFKLDAGTESAPIAAMSNEEKKLYAVQFHPEVRHSVHGNEMI 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V G + NW M ++ ++ +  I+E VG ++V+CA+SGGVDS+V A LI+ AIG  
Sbjct: 185 KNFLYEVCGCEGNWSMETFIEDQLREIREVVGEQKVLCALSGGVDSSVVAMLIHRAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK E E+++  F G  +  +  +DA ERF+ KLK + DPE KRK+IG  
Sbjct: 245 LTCMFIDHGLLRKGEAESVMETFVGKFDMKVVKIDAQERFMSKLKGVDDPEKKRKIIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VF+EE+ K     FL QGTLY D++ES +     +  IKSHHNVGGLPE M   L+E
Sbjct: 305 FIYVFDEESSKFDDFAFLAQGTLYTDIVESGT---ETAHTIKSHHNVGGLPEDMKFTLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVR +G+EL LP++ V R P PGPGLAIR +GE+TE+++ I+R+SD I REE
Sbjct: 362 PLKALFKDEVRKVGEELGLPEAIVHRQPFPGPGLAIRVLGEVTEDKLQIVRDSDYILREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 422 IAKAGLDREIWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDILE 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV+ +NR+VYD+TSKPPATIEWE
Sbjct: 482 KISVRIVNEVENVNRIVYDVTSKPPATIEWE 512


>gi|227825121|ref|ZP_03989953.1| bifunctional GMP synthase/glutamine amidotransferase
           [Acidaminococcus sp. D21]
 gi|226905620|gb|EEH91538.1| bifunctional GMP synthase/glutamine amidotransferase
           [Acidaminococcus sp. D21]
          Length = 515

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/512 (52%), Positives = 361/512 (70%), Gaps = 6/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           VL++DFG+Q+ QLIARRVRE  VYCE+I +   ++  K +NP+A+I SG P S    ++P
Sbjct: 9   VLVVDFGAQYAQLIARRVRECGVYCEIIPYSYTINQIKAKNPKALIFSGGPNSVYAENTP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSR-EFGRAFIEIKKNCSLLKGMWEK 128
            I   +    IP+LG+CYG Q+M + LGG   ++ S  E+G+  + +     L  G+ EK
Sbjct: 69  SIDDGVFSLGIPILGLCYGHQLMAKKLGGVVAHAGSAGEYGKTAVSLDNETRLFSGI-EK 127

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
            +    WMSH D VE +PEGF V   ++  P A + +E++++Y VQFHPEV+HT  G ++
Sbjct: 128 NNI--CWMSHQDYVETVPEGFVVAGHTEECPVAAMMNEEKRFYGVQFHPEVMHTPFGKKM 185

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
             NF+  + G+  +W MSS+ +  +  I+E+VG++ V+CA+SGGVDS+VAA L+++A+G 
Sbjct: 186 FSNFLFDICGLSGDWSMSSFAQTQIEAIREKVGDKNVLCAMSGGVDSSVAAVLVHKAVGK 245

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            LTCV VDHG +RKNE + +  +FK   +  L  VDA ERF+ KLK + DPE KRK+IG+
Sbjct: 246 QLTCVFVDHGLLRKNEGDQVEQVFKRDFDMNLIRVDAKERFLSKLKGVSDPEKKRKIIGE 305

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
            FI VFEEE+KKIG   +L QGT+YPDV+ES     G S+ IKSHHNVGGLPE MD+ L+
Sbjct: 306 EFIRVFEEESKKIGHVDYLVQGTIYPDVVESGG--TGTSATIKSHHNVGGLPEDMDLDLI 363

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ LFKDEVR +G+EL +P   V R P PGPGLAIR +GE+TEE++ I+RE+DAI+RE
Sbjct: 364 EPLRALFKDEVRAVGEELGIPSELVWRQPFPGPGLAIRVLGEVTEEKLAIVREADAIFRE 423

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+ R IWQ F  L  +++VGVMGD RTY    +LRAV S DGMT+D+ H   + L
Sbjct: 424 EIAKAGLDRSIWQYFACLPNIRSVGVMGDFRTYTNTIALRAVNSTDGMTSDWSHIPYHVL 483

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             V+ RIVNEV G+NRVVYDITSKPPATIEWE
Sbjct: 484 DIVSRRIVNEVPGVNRVVYDITSKPPATIEWE 515


>gi|206579796|ref|YP_002237144.1| GMP synthase (glutamine-hydrolyzing) [Klebsiella pneumoniae 342]
 gi|288934103|ref|YP_003438162.1| GMP synthase, small subunit [Klebsiella variicola At-22]
 gi|290508301|ref|ZP_06547672.1| GMP synthase [Klebsiella sp. 1_1_55]
 gi|226739635|sp|B5XNM4|GUAA_KLEP3 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|206568854|gb|ACI10630.1| GMP synthase (glutamine-hydrolyzing) [Klebsiella pneumoniae 342]
 gi|288888832|gb|ADC57150.1| GMP synthase, small subunit [Klebsiella variicola At-22]
 gi|289777695|gb|EFD85692.1| GMP synthase [Klebsiella sp. 1_1_55]
          Length = 525

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 260/517 (50%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E+  + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVVNDSALVRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS+D+ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTDNCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI++QVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVERIRQQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  V+  +RF+  LK   DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVEGEQRFLDALKGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLDDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|167628194|ref|YP_001678693.1| gmp synthase (glutamine-hydrolyzing) [Heliobacterium modesticaldum
           Ice1]
 gi|226739629|sp|B0TI09|GUAA_HELMI RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|167590934|gb|ABZ82682.1| gmp synthase (glutamine-hydrolyzing) [Heliobacterium modesticaldum
           Ice1]
          Length = 513

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/512 (53%), Positives = 352/512 (68%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+ QLIARRVRE  VYCE+  +  ++D  +E NP+ II +G PAS  +  +P
Sbjct: 8   ILVLDFGGQYNQLIARRVRELHVYCEMHPYTISVDAIREMNPKGIIFTGGPASVYEEKAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            +   I +  IP+LGICYG Q+M   LGGK   ++SRE+G+A + I  +     GM    
Sbjct: 68  AVDPAIYDLGIPILGICYGMQLMVNQLGGKVGRAESREYGKASLTITASEGPFAGM---E 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
              Q WMSHGD+VE +P GF     +D  PFA +AD  R++Y VQFHPEV HT  G  ++
Sbjct: 125 GDVQCWMSHGDKVEVLPHGFVGSGKTDHAPFAAMADPVRRFYGVQFHPEVRHTPQGMDMM 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF+  V G    W M ++ +E V+ I+ +VG+ +V+CA+SGGVDS+VAA L++ A+G  
Sbjct: 185 RNFLFGVCGCTGEWTMENFIEEQVAAIRARVGSGKVLCALSGGVDSSVAALLVHRAVGEQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHGFMR NE E II  F+      L  V+ASERF+ K+  + DPETKRK IG  
Sbjct: 245 LTCVYVDHGFMRLNESERIIKTFRDELGMNLIAVEASERFMAKVAGVSDPETKRKSIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEEA K+G   FL QGTLYPDV+ES +     +  IK+HHNVGGLPE M  +L+E
Sbjct: 305 FIRVFEEEAAKLGQVDFLVQGTLYPDVVESGT---STAETIKTHHNVGGLPEDMKFELIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ LFKDEVR +G+ L LP+  V R P PGPGLAIR +GEIT+E ++ILR +D I  +E
Sbjct: 362 PLRTLFKDEVREVGQRLGLPEDIVWRQPFPGPGLAIRVLGEITKESLDILRHADDIVFQE 421

Query: 430 IHKAGIYRKIWQAFTVL-LPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           I KAG+YR+IWQ+F VL   V++VGVMGD RTYEY   LRAVTS D MTAD+       L
Sbjct: 422 IKKAGLYRQIWQSFVVLPTTVRSVGVMGDGRTYEYPAILRAVTSDDAMTADWARLPYELL 481

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 482 EKISNRIVNEVKGVNRVVYDITSKPPGTIEWE 513


>gi|301024735|ref|ZP_07188376.1| GMP synthase protein [Escherichia coli MS 69-1]
 gi|300396428|gb|EFJ79966.1| GMP synthase protein [Escherichia coli MS 69-1]
          Length = 525

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/517 (50%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       ++ NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E+  + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNDSALVRGIEDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS++S PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V+RI+EQVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE E ++ +F  +    +  V A +RF+  L    DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+ KAG+Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELRKAGLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|256005388|ref|ZP_05430352.1| GMP synthase, large subunit [Clostridium thermocellum DSM 2360]
 gi|281417096|ref|ZP_06248116.1| GMP synthase, large subunit [Clostridium thermocellum JW20]
 gi|255990614|gb|EEU00732.1| GMP synthase, large subunit [Clostridium thermocellum DSM 2360]
 gi|281408498|gb|EFB38756.1| GMP synthase, large subunit [Clostridium thermocellum JW20]
 gi|316940865|gb|ADU74899.1| GMP synthase, large subunit [Clostridium thermocellum DSM 1313]
          Length = 511

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/512 (51%), Positives = 372/512 (72%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFG Q+ QLIARRVRE+ VYCEV+ + +++D  K +NP+ II +G PAS LD  +P
Sbjct: 6   ILVLDFGGQYNQLIARRVREANVYCEVLPYNSSIDKIKSKNPKGIIFTGGPASVLDPKAP 65

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
              +E+ E  IP+LGICYG Q+M   LGG  + ++ RE+G+  I    +  L +G+ ++ 
Sbjct: 66  ICDREVFELGIPILGICYGMQLMSHMLGGTVEKAEQREYGKVNITFDTSSMLFEGIEKES 125

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           +    WMSH   V ++PEGF   A + + P A I + ++K Y VQFHPEVVHT  G  ++
Sbjct: 126 T---CWMSHTYYVNNLPEGFVKCADTPNCPVAAIENREKKLYGVQFHPEVVHTPKGRDIL 182

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF++ + G   +W M+S+ +  ++ I+E+VG+++V+CA+SGGVDS+VAA L+++A+G  
Sbjct: 183 NNFLYKICGCSGDWKMASFIEHSINSIREKVGDKKVLCALSGGVDSSVAAVLVHKAVGKQ 242

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ VDHG +RK E + +  +FK   +  L  V+A +RF+ KLK + DPE KRK+IG+ 
Sbjct: 243 LTCIFVDHGLLRKYEGDQVEEVFKKQFDISLIRVNAEDRFLEKLKGVTDPERKRKIIGEE 302

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK-LV 368
           FI VFEEEAKKIG   FL QGT+YPDVIES     G +++IKSHHNVGGLP+++D K ++
Sbjct: 303 FIRVFEEEAKKIGTVDFLVQGTIYPDVIESGV---GDAAVIKSHHNVGGLPDYIDFKEII 359

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ LFKDEVR +G EL +P+  V R P PGPGLA+R IGE+T+E+++ILR++D I+RE
Sbjct: 360 EPLRSLFKDEVRKVGIELGIPEDIVMRQPFPGPGLAVRVIGEVTKEKLDILRDADYIFRE 419

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI  AG+ R+I Q F VL  +++VGVMGDERTY+Y  +LRAVT+ID MTAD+     + L
Sbjct: 420 EIKNAGLDREINQYFAVLTGMRSVGVMGDERTYDYTLALRAVTTIDFMTADWAKIPYDVL 479

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +V+ RIVNEVK INR+VYDIT+KPPATIEWE
Sbjct: 480 EKVSNRIVNEVKHINRIVYDITTKPPATIEWE 511


>gi|238788161|ref|ZP_04631956.1| GMP synthase [glutamine-hydrolyzing] [Yersinia frederiksenii ATCC
           33641]
 gi|238723748|gb|EEQ15393.1| GMP synthase [glutamine-hydrolyzing] [Yersinia frederiksenii ATCC
           33641]
          Length = 528

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/525 (50%), Positives = 367/525 (69%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQLIARRVRE  VYCE+ A+       +E NP  IILSGSP
Sbjct: 4   MTKNIHKHRILILDFGSQYTQLIARRVREIGVYCELWAWDVTEAQIREFNPSGIILSGSP 63

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S+ + DSP+ P  +  + +P+LG+CYG Q M   LGGK + S  REFG A +EIK +C+
Sbjct: 64  ESTTEHDSPRAPDYVFTAGVPVLGVCYGMQTMAIQLGGKVEGSNHREFGYAQVEIKTDCA 123

Query: 121 LLKGMWEKGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQF 175
           L++ + +  +        VWMSHGD+V  IP  F  +AS+D+ PFA +A+E++++Y VQF
Sbjct: 124 LIRDIKDAINPAGEAVLDVWMSHGDKVTAIPSDFVTVASTDTCPFAIMANEEKRFYGVQF 183

Query: 176 HPEVVHTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDS 235
           HPEV HT  G +L++ FV  +   +  W  ++  ++ + R++EQ+G++ VI  +SGGVDS
Sbjct: 184 HPEVTHTKQGQRLLERFVLDICACEALWTPATIIEDAIVRLREQIGDDHVILGLSGGVDS 243

Query: 236 TVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKN 295
           +V A L++ AIG  LTCV VD+G +R NE + ++ +F       +  V A +RF+  L  
Sbjct: 244 SVTAMLLHRAIGKRLTCVFVDNGLLRLNEADQVLEMFGDKFGLNIVHVAAEDRFLAALAG 303

Query: 296 IVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHN 355
           + +PE KRK+IG++F+E+F+EEA K    ++L QGT+YPDVIES +   G + +IKSHHN
Sbjct: 304 VDEPEAKRKIIGRVFVELFDEEACKQEQVKWLAQGTIYPDVIESAASATGKAHVIKSHHN 363

Query: 356 VGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEER 415
           VGGLP+ M + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E 
Sbjct: 364 VGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY 423

Query: 416 INILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDG 475
            ++LR +DAI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID 
Sbjct: 424 CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF 483

Query: 476 MTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           MTA + H   +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 484 MTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 528


>gi|172038179|ref|YP_001804680.1| GMP synthase [Cyanothece sp. ATCC 51142]
 gi|254800094|sp|B1WY30|GUAA_CYAA5 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|171699633|gb|ACB52614.1| GMP synthetase [Cyanothece sp. ATCC 51142]
          Length = 542

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 260/517 (50%), Positives = 365/517 (70%), Gaps = 9/517 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFGSQ+++LIARR+RE++VY EV++++      ++ NP+ IILSG P S  D  +P
Sbjct: 29  IVILDFGSQYSELIARRIRETQVYSEVLSYRTTAQKLRQLNPKGIILSGGPNSVYDDRAP 88

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q   +I +  IP+LG+CYG Q+M + LGG+ + +   E+G+A + I     LL  + E G
Sbjct: 89  QCDPDIWQLGIPVLGVCYGMQLMVKQLGGQVEKALRGEYGKASLRIDDPTDLLTNV-EDG 147

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S   +WMSHGD    +PEGF ++A +++T  A IAD  +K + VQFHPEVVH+V G  LI
Sbjct: 148 ST--MWMSHGDSCTRLPEGFSILAHTENTLCAAIADHDKKLFGVQFHPEVVHSVDGIALI 205

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NFV+H+   +  W   ++  E +  I+ +V ++RV+ A+SGGVDS+  AFL+++AIG N
Sbjct: 206 RNFVYHICECEPTWTTEAFVDETIREIRAKVRDKRVLLALSGGVDSSTLAFLLHQAIGDN 265

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +D GFMRK E E ++ +F    + P+  V+A +RF+++L+ + DPE KR++IG  
Sbjct: 266 LTCMFIDQGFMRKGEPERLMDIFDKQFHIPVEYVNARDRFLKQLEGVTDPEKKRRLIGHE 325

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHHNVGGLPEHM 363
           FI+VFEEE+K++G   +L QGTLYPDVIES      P +       IKSHHNVGGLP+ +
Sbjct: 326 FIQVFEEESKRLGPFDYLAQGTLYPDVIESADTNIDPKTGERVAVKIKSHHNVGGLPKDL 385

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
             KLVEPL++LFKDEVR +G+ + LP+  V RHP PGPGLAIR IGE+T ER+NILR++D
Sbjct: 386 RFKLVEPLRKLFKDEVRKVGRSIGLPEEIVRRHPFPGPGLAIRIIGEVTSERLNILRDAD 445

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
            + R+EI K G+Y   WQAF VLLP+++VGVMGD+RTY +   LR ++S DGMTAD+   
Sbjct: 446 FVVRDEIGKQGMYHDFWQAFAVLLPIRSVGVMGDQRTYAHPIVLRLISSEDGMTADWSRV 505

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             + L  ++ RIVNEVKG+NRVVYDITSKPP TIEWE
Sbjct: 506 PYDLLETISNRIVNEVKGVNRVVYDITSKPPGTIEWE 542


>gi|30248125|ref|NP_840195.1| bifunctional GMP synthase/glutamine amidotransferase protein
           [Nitrosomonas europaea ATCC 19718]
 gi|44887949|sp|Q82XZ6|GUAA_NITEU RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|30180010|emb|CAD84005.1| guaA; GMP synthetase [Nitrosomonas europaea ATCC 19718]
          Length = 519

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/518 (50%), Positives = 360/518 (69%), Gaps = 6/518 (1%)

Query: 8   SKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           S +LI+DFGSQ+T+LIARR+RE+ VYCE+  F  +  + +E  P  IILSG PAS+   D
Sbjct: 3   SAILILDFGSQYTRLIARRIRETNVYCELHPFDVSPQFIREFAPIGIILSGGPASTFTED 62

Query: 68  SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127
           +P++P+ + E  +P+LGICYG Q M   LGG+ +++Q+REFG A + +   C L  G+ +
Sbjct: 63  APRVPQIVFELGVPVLGICYGMQAMAAQLGGEVEDAQTREFGYAEL-LTAPCKLFHGIQD 121

Query: 128 KGSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHT 182
           + +        VWMSHGD+V  +P GF  IAS+ +TPFA +ADE R +Y VQFHPEV HT
Sbjct: 122 RINSDGKPALDVWMSHGDRVNKLPPGFTAIASNAATPFAAMADETRNFYGVQFHPEVTHT 181

Query: 183 VGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLI 242
             G  ++D+FVH +     +W M  Y +E + RI+ +VGN++V+  +SGGVDS+VAA LI
Sbjct: 182 RQGKAILDHFVHDICSAGYDWNMPDYVEEAIGRIRARVGNDKVVLGLSGGVDSSVAAALI 241

Query: 243 YEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK 302
           + AIG  L CV VD+G +R NE + I+  F       +  +DA  +F+ +LK I DPE K
Sbjct: 242 HRAIGDQLVCVFVDNGLLRLNEAKQIMETFSRNLAVNVIYIDAGRQFLEQLKGITDPEQK 301

Query: 303 RKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
           R+ IG+ F+E+F++EA+KI  A++L QGT+YPDVIES       + +IKSHHNVGGLPE 
Sbjct: 302 RRTIGREFVEIFQQEAEKIENAKWLAQGTIYPDVIESAGSHTKKAGVIKSHHNVGGLPET 361

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRES 422
           + +KL+EPL+ELFKDEVR LG  L LP   V RHP PGPGL +R +GE+  E   +LR++
Sbjct: 362 LHLKLLEPLRELFKDEVRELGLALGLPHDLVFRHPFPGPGLGVRILGEVKYEYTELLRQA 421

Query: 423 DAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482
           DAI+ EE+  AG Y K  QAF V LP+++VGVMGD R+YEYV +LRAV + D MTA +  
Sbjct: 422 DAIFIEELRNAGWYEKTSQAFAVFLPIKSVGVMGDNRSYEYVVALRAVQTEDFMTAHWAE 481

Query: 483 HDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
                LS+++ RI+NE++GINRVVYDI+ KPPATIEWE
Sbjct: 482 LPYTLLSRISNRIINEIRGINRVVYDISGKPPATIEWE 519


>gi|308067527|ref|YP_003869132.1| GMP synthase (glutamin-hydrolyzing) [Paenibacillus polymyxa E681]
 gi|305856806|gb|ADM68594.1| GMP synthase (glutamin-hydrolyzing) [Paenibacillus polymyxa E681]
          Length = 512

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 359/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           V+++DFG Q+ QLIARR+R+  VY E++ +    +  +E  P+ I+ SG P+S    ++P
Sbjct: 8   VVVLDFGGQYNQLIARRIRDLGVYSELLPYNTPAEKLRELAPKGIVFSGGPSSVYTDNAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           Q+ + I +  IP+ GICYG Q+M   L GK + +  RE+G+A ++  ++  L KG+    
Sbjct: 68  QVDRAIYDLGIPIFGICYGMQLMAHQLDGKVERAGKREYGKADVQFNQDARLAKGL---D 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           S+Q VWMSHGD V  +P GF + A ++S P A +++ +R  YAVQFHPEV H+V G+++I
Sbjct: 125 SRQTVWMSHGDHVTDLPTGFTLDAGTESAPIAAMSNLERNLYAVQFHPEVRHSVQGNEMI 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ V G + NW M S+ ++ +  I++QVG+++V+CA+SGGVDS+V A LI++AIG  
Sbjct: 185 SNFLYEVCGCEGNWTMESFIEDQIREIRQQVGDKKVLCALSGGVDSSVVAMLIHKAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK E E+++  F G  +  +  +DA ERF+ KL  + DPE KRK+IG  
Sbjct: 245 LTCMFIDHGLLRKGEAESVMETFVGKFDMKVVKIDARERFLSKLAGVDDPEQKRKIIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VFEEE+ +     FL QGTLY D++ES +     +  IKSHHNVGGLPE+M  KL+E
Sbjct: 305 FIYVFEEESSQFDDFTFLAQGTLYTDIVESGT---ATAQTIKSHHNVGGLPENMKFKLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL  LFKDEVR +G+E  LP   V R P PGPGLAIR +GE+TE+++ I+RESD I REE
Sbjct: 362 PLNALFKDEVRKVGEECGLPAEIVWRQPFPGPGLAIRVLGEVTEDKLTIVRESDYILREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 422 IAKAGLDREIWQYFTALPNMKSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLE 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV  +NR+VYDITSKPPATIEWE
Sbjct: 482 KISVRIVNEVDNVNRIVYDITSKPPATIEWE 512


>gi|260773378|ref|ZP_05882294.1| GMP synthase [glutamine-hydrolyzing] [Vibrio metschnikovii CIP
           69.14]
 gi|260612517|gb|EEX37720.1| GMP synthase [glutamine-hydrolyzing] [Vibrio metschnikovii CIP
           69.14]
          Length = 517

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/520 (50%), Positives = 362/520 (69%), Gaps = 3/520 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M K     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ ++       +E NP  IILSG P
Sbjct: 1   MTKNIHDQRILILDFGSQYTQLVARRVREIGVYCELWSWDVEEADIREFNPDGIILSGGP 60

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  +++SP+ P+ + +S +P+ G+CYG Q M + LGG+   S  REFG A + +    +
Sbjct: 61  ESVTELNSPRAPQYVFDSGVPVFGVCYGMQTMAEQLGGRVATSTEREFGYAQVTVSGQSA 120

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           L   +    + Q VWMSHGD+V  IP  F  I  +++ P+A +A+E++KYY VQFHPEV 
Sbjct: 121 LFNDL---EAIQDVWMSHGDKVVEIPADFVKIGETETCPYAAMANEEKKYYGVQFHPEVT 177

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           HT  G ++++NFV  + G +  W   S  ++ ++RIKEQVG++ VI  +SGGVDS+V A 
Sbjct: 178 HTKHGLKMLENFVLDICGCERLWTSESIIEDAIARIKEQVGDDEVILGLSGGVDSSVVAM 237

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTCV VD+G +R NE + ++ +F       +  VDA ERF+  L+   DPE
Sbjct: 238 LVHRAIGERLTCVFVDNGLLRLNEGQQVMDMFGNKFGLNIIKVDAEERFLAALEGKADPE 297

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLP 360
            KRK IG +F++VF+E+AKK+  A++L QGT+YPDVIES +   G + +IKSHHNVGGLP
Sbjct: 298 EKRKTIGHVFVDVFDEQAKKLKNAKWLAQGTIYPDVIESAASKTGKAHVIKSHHNVGGLP 357

Query: 361 EHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILR 420
           + M+M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR
Sbjct: 358 DDMEMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLR 417

Query: 421 ESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADF 480
            +DAI+ EE+H A +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA +
Sbjct: 418 RADAIFIEELHNADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHW 477

Query: 481 YHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            H    FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 478 AHLPYEFLGKVSNRIINEVSGISRVVYDISGKPPATIEWE 517


>gi|293394889|ref|ZP_06639179.1| GMP synthase [Serratia odorifera DSM 4582]
 gi|291422640|gb|EFE95879.1| GMP synthase [Serratia odorifera DSM 4582]
          Length = 525

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 364/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+    +  +E NP  IILSG P S+ +++S
Sbjct: 9   RILILDFGSQYTQLVARRVREIGVYCELWAWDVTEEQIREFNPSGIILSGGPESTTELNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ +  + +P+LG+CYG Q M   LGG  + S  REFG A +E+    +L++ + + 
Sbjct: 69  PRAPEYVFTAGVPVLGVCYGMQTMAMQLGGHVQGSSEREFGYAQVEVTTQSALIRDIEDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+D+ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSASGKPLLDVWMSHGDKVTAIPADFVTVASTDTCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  + G +  W  ++  ++ V+RI+EQVG + VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVLDICGCEALWTPATIIEDAVARIREQVGEDHVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE + ++ +F  +    +  V A ERF+  L  + +PE KR
Sbjct: 249 RAIGKRLTCVFVDNGLLRLNEADQVLEMFGDHFGLNIVHVPAEERFLSALAGVDEPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K    ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEACKQSEVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KLGLVEPLKELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYEFLGRVSNRIINEVDGISRVVYDISGKPPATIEWE 525


>gi|329121915|ref|ZP_08250529.1| GMP synthase [Dialister micraerophilus DSM 19965]
 gi|327467712|gb|EGF13208.1| GMP synthase [Dialister micraerophilus DSM 19965]
          Length = 512

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/512 (51%), Positives = 354/512 (69%), Gaps = 7/512 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++I+DFG Q+ QLIARRVRE  VYCE++ +    +   E  P+ IILSG P+S    ++P
Sbjct: 7   IVIVDFGGQYAQLIARRVRECGVYCEILPYTKTAEEILESAPKGIILSGGPSSVNQENAP 66

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +I ++I  S IP+ GICYG Q+M Q+LGGK K  + RE+G        +C L +G+    
Sbjct: 67  KIDEKIFHSGIPVFGICYGMQLMAQTLGGKVKKPEKREYGHTDFYRDGSCPLFEGV---S 123

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K  VWMSHGD V  +P GF +   +D TP A ++DE R+ Y VQFHPEVVHT  G +++
Sbjct: 124 KKTAVWMSHGDSVSEMPAGFGLSGHTDLTPTAAMSDEARRLYGVQFHPEVVHTPEGMKML 183

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           + F+ H+   +  W M +Y    V  I+E+VG  +VICA+SGGVDS+VAA L++ AIG  
Sbjct: 184 EQFLFHICECKGGWSMGNYIDIAVKEIREKVGKNKVICALSGGVDSSVAAVLVHRAIGEQ 243

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTCV VDHGFMR  E + ++  FK   N  L  +DAS+ F+  L+ + +PE KRK+IG  
Sbjct: 244 LTCVFVDHGFMRLGEAKQVVETFKNKFNMKLVHIDASKHFMELLEGVTEPEKKRKIIGAE 303

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI  F+ EA KI   +FL QGTLYPDV+ES +     ++ IKSHHNVGGLP+ M  KL+E
Sbjct: 304 FINTFQREADKIKDVKFLVQGTLYPDVVESGT---ATAATIKSHHNVGGLPKDMKFKLIE 360

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PL+ELFKDEVR LG++L +P+  V R P PGPGLAIR +G+ITEER+ ILR++D I R+ 
Sbjct: 361 PLRELFKDEVRELGRQLGMPEEIVNRQPFPGPGLAIRIVGDITEERLEILRKADYIVRDI 420

Query: 430 IHKAGIYRKIWQAFTVL-LPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           I K G+ ++IWQ+F VL   +++VGV GDERTY+Y   +RAVTS DGMTAD+Y    + L
Sbjct: 421 IKKRGLEKEIWQSFAVLPAAIRSVGVQGDERTYDYTVGIRAVTSSDGMTADYYRFSWDVL 480

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            +++ RI NEVKG+NR+VYDITSKPP+TIEWE
Sbjct: 481 DEMSRRICNEVKGVNRIVYDITSKPPSTIEWE 512


>gi|218439824|ref|YP_002378153.1| GMP synthase [Cyanothece sp. PCC 7424]
 gi|226738434|sp|B7K8T7|GUAA_CYAP7 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|218172552|gb|ACK71285.1| GMP synthase, large subunit [Cyanothece sp. PCC 7424]
          Length = 542

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 369/526 (70%), Gaps = 9/526 (1%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           + +R     ++I+DFGSQ+++LIARR+RE+ VY EV++++ + +  ++  P+ IILSG P
Sbjct: 20  LKERINRQMIVILDFGSQYSELIARRIRETNVYSEVLSYRTSAEQLRQLAPKGIILSGGP 79

Query: 61  ASSLDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS 120
            S  D ++PQ  +EI +  IP+LG+CYG Q+M Q LGGK + ++  E+G+A + I     
Sbjct: 80  NSVYDKNAPQCTQEIWDLGIPILGVCYGMQLMVQQLGGKVERAKRAEYGKASLHIDDPTD 139

Query: 121 LLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVV 180
           LL  + +       WMSHGD    +P+GF+++A +D+TP A IA+ ++K + VQFHPEVV
Sbjct: 140 LLTNVEDNSI---AWMSHGDSCIELPDGFKILAHTDNTPCAAIANHEQKLFGVQFHPEVV 196

Query: 181 HTVGGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAF 240
           H+VGG  LI NFV+H+   +  W   ++ +E +  I+ ++G++RV+ A+SGGVDS+  AF
Sbjct: 197 HSVGGIALIRNFVYHICECEPTWTTEAFVEEAIREIRAKIGDKRVLLALSGGVDSSTLAF 256

Query: 241 LIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPE 300
           L++ AIG  LTC+ +D GFMRK E E ++ +F    + P+  V++ E+F+ +LK + DPE
Sbjct: 257 LLHRAIGDQLTCMFIDQGFMRKGEPERLMEIFDHQFHIPVVYVNSREQFLEQLKGVTDPE 316

Query: 301 TKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSS------IIKSHH 354
            KR++IG  FI+VFEEE+ ++G   +L QGTLYPDVIES      P +       IKSHH
Sbjct: 317 EKRRLIGHEFIKVFEEESNRLGPFDYLAQGTLYPDVIESADSNVDPQTGERVAVKIKSHH 376

Query: 355 NVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEE 414
           NVGGLP+++  KLVEPL++LFKDEVR + + + LP+  V RHP PGPGLAIR IGE+T E
Sbjct: 377 NVGGLPKNLRFKLVEPLRKLFKDEVRKVARSIGLPEEIVRRHPFPGPGLAIRIIGEVTSE 436

Query: 415 RINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSID 474
           R+ ILR++D + R+EI K G+Y   WQAF VLLPV++VGVMGD+RTY +   LR +TS D
Sbjct: 437 RLKILRDADFVVRDEISKQGMYHDFWQAFAVLLPVRSVGVMGDQRTYAHPVVLRLITSED 496

Query: 475 GMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           GMTAD+     + L  ++ RIVNEV+G+NRVVYDITSKPP TIEWE
Sbjct: 497 GMTADWAKVPYDLLEIISNRIVNEVRGVNRVVYDITSKPPGTIEWE 542


>gi|209518734|ref|ZP_03267550.1| GMP synthase, large subunit [Burkholderia sp. H160]
 gi|209500848|gb|EEA00888.1| GMP synthase, large subunit [Burkholderia sp. H160]
          Length = 527

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 267/524 (50%), Positives = 362/524 (69%), Gaps = 12/524 (2%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           K+LI+DFGSQ TQLIARRVRE+ VY E+  +     + ++  P+ +ILSG P+S  + D+
Sbjct: 4   KILILDFGSQVTQLIARRVREANVYSEIHPYDVDASFIRDFAPKGVILSGGPSSVTEEDT 63

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P++P+ + E  +P+LGICYG Q M Q LGGK      REFG A +  + + SLL+G+ + 
Sbjct: 64  PRVPQAVFELGVPVLGICYGMQAMAQQLGGKVDIGHLREFGYAEVRARNHTSLLEGISDF 123

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            + +     +VWMSHGD+V  +P GF ++AS++S P A +ADE+R++Y +Q+HPEV HTV
Sbjct: 124 TTPEGHGMLKVWMSHGDKVLEMPPGFALMASTESCPIAAMADEQRRFYGLQWHPEVTHTV 183

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G  +++ FV  + G + +W M  Y  E V++I+EQVGNE VI  +SGGVDS+VAA L++
Sbjct: 184 QGRAMLERFVLQICGAKADWEMGHYIDEAVAKIREQVGNEHVILGLSGGVDSSVAAALLH 243

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VDHG +R NE E +++LF  +    +  VDASE F+ KL  + DPE KR
Sbjct: 244 RAIGDQLTCVFVDHGLLRLNEAEQVMALFADHLGVKVIHVDASEAFLGKLAGVTDPEAKR 303

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG  F+EVF+ EA K+  A++L QGT+YPDVIES       +  IKSHHNVGGLPE +
Sbjct: 304 KIIGAEFVEVFQAEAGKLTDAKWLAQGTIYPDVIESAGKGKKAAQTIKSHHNVGGLPETL 363

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
           ++KL+EPL+ELFKDEVR LG +L LP S V RHP PGPGL +R +GE+  +  ++LR +D
Sbjct: 364 NLKLLEPLRELFKDEVRELGVKLGLPHSMVYRHPFPGPGLGVRILGEVKRDFADLLRRAD 423

Query: 424 AIYREEIHKA-------GIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGM 476
           AI+ E +            Y    QAF V LPV++VGVMGD RTYEYV +LRAV ++D M
Sbjct: 424 AIFIETLRNTIDKETGKSWYDLTSQAFAVFLPVKSVGVMGDGRTYEYVVALRAVQTLDFM 483

Query: 477 TADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           TA + H   + L  V+ RI+NEV+GINRVVYDI+ KPPATIEWE
Sbjct: 484 TAHWAHLPHDLLGHVSNRIINEVRGINRVVYDISGKPPATIEWE 527


>gi|271501561|ref|YP_003334587.1| GMP synthase large subunit [Dickeya dadantii Ech586]
 gi|270345116|gb|ACZ77881.1| GMP synthase, large subunit [Dickeya dadantii Ech586]
          Length = 525

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/517 (50%), Positives = 362/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPNGIILSGGPESTTEFNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + ++ +P+LG+CYG Q M   LGGK + S  REFG A +E+K N +L++ + + 
Sbjct: 69  PRAPEYVFQAGVPVLGVCYGMQTMAMQLGGKVEGSSEREFGYAQVEVKSNSALVRDIQDA 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            S        VWMSHGD+V  IP  F  +AS+D+ P+A +A+E++++Y VQFHPEV HT 
Sbjct: 129 VSDSGAPLLDVWMSHGDKVTAIPADFVTVASTDTCPYAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI++QVG ++VI  +SGGVDS+V A L++
Sbjct: 189 QGQRMLERFVRDICQCEALWTPAKIIDDAVERIRQQVGGDKVILGLSGGVDSSVTALLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG  LTCV VD+G +R NE E ++ +F       +  V A  RF+  L  I DPE KR
Sbjct: 249 RAIGDRLTCVFVDNGLLRLNEAEQVMEMFGDEFGLNIVHVQAENRFLSALAGIDDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K IG++F++VF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KTIGRVFVDVFDEEAGKLTDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPDDM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            + LVEPLKELFKDEVR +G EL LP + + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 ALGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKAELYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
              FL +V+ RI+NEV GI+RVVYD++ KPPATIEWE
Sbjct: 489 PYEFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE 525


>gi|296104181|ref|YP_003614327.1| GMP synthase (glutamine-hydrolyzing) [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058640|gb|ADF63378.1| GMP synthase (glutamine-hydrolyzing) [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 525

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/517 (50%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEENS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E+  + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVVNDSALVRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS++S PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G ++++ FV  +   +  W  +    + V RI++QVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLERFVRDICQCEALWTPAKIIDDAVERIRQQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE + ++ +F  +    +  V+  +RF+  L  + DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVEGEQRFLDALAGVNDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+EEA K+   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|253577510|ref|ZP_04854824.1| GMP synthase [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843129|gb|EES71163.1| GMP synthase [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 512

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/511 (50%), Positives = 359/511 (70%), Gaps = 6/511 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG Q+ QLIARR+R+  VY E++ +   ++  +E  P+ I+ SG P+S    D+P
Sbjct: 8   IVVLDFGGQYNQLIARRIRDLGVYSELLPYNTPVERLREIAPKGIVFSGGPSSVYAEDAP 67

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
            I   + +  +P+ GICYG Q+M   LGGK + +  RE+G+A ++  ++ +L +G+    
Sbjct: 68  HIDPAVYDIGVPIFGICYGMQLMAHQLGGKVERAAKREYGKADVDFAEHSALTRGL---D 124

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
           SKQ VWMSHGD V  +P+GF V AS++  P A  A+  RK Y VQFHPEV H+V G+++I
Sbjct: 125 SKQTVWMSHGDHVTQLPDGFVVDASTEHAPIAGFANPDRKMYGVQFHPEVRHSVHGNEMI 184

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
            NF++ + G + NW M ++ ++ V  I+ QVG+ +V+CA+SGGVDS+V A LI++AIG  
Sbjct: 185 RNFLYDICGCEGNWSMETFIEDAVRDIRTQVGDGKVLCALSGGVDSSVVAMLIHKAIGDQ 244

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           LTC+ +DHG +RK E E+++  F G  +  +  +DA ERF+ KL  + DPE KRK+IG  
Sbjct: 245 LTCMFIDHGLLRKGEAESVMETFVGKFDMKVVKIDARERFLSKLAGVDDPEQKRKIIGNE 304

Query: 310 FIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVE 369
           FI VF+EE+ K     +L QGTLY D++ES +     +  IKSHHNVGGLPE M  KL+E
Sbjct: 305 FIYVFDEESAKFDDFTYLAQGTLYTDIVESGT---ATAQTIKSHHNVGGLPEDMKFKLIE 361

Query: 370 PLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREE 429
           PLK LFKDEVR +G+EL LP   V R P PGPGLAIR +GE+TEE++ I+R+SD I REE
Sbjct: 362 PLKTLFKDEVRKVGEELGLPREIVWRQPFPGPGLAIRVLGEVTEEKLQIVRDSDYILREE 421

Query: 430 IHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLS 489
           I KAG+ R+IWQ FT L  +++VGVMGD RTY Y   +RAVTSIDGMTAD+     + L 
Sbjct: 422 IAKAGLDREIWQYFTALPNMRSVGVMGDARTYSYTVGIRAVTSIDGMTADWARIPWDVLE 481

Query: 490 QVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           ++++RIVNEV+ +NRVVYDITSKPPATIEWE
Sbjct: 482 KISVRIVNEVENVNRVVYDITSKPPATIEWE 512


>gi|325104659|ref|YP_004274313.1| GMP synthase, large subunit [Pedobacter saltans DSM 12145]
 gi|324973507|gb|ADY52491.1| GMP synthase, large subunit [Pedobacter saltans DSM 12145]
          Length = 510

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/515 (51%), Positives = 364/515 (70%), Gaps = 11/515 (2%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN--ALDYFKEQNPQAIILSGSPASSLDI 66
           K+LI+DFGSQ+TQLIARRVRE  VYCE+  F    A+D +     + +ILSGSP+S    
Sbjct: 4   KILILDFGSQYTQLIARRVRELNVYCEIHPFNKIPAIDEYT----KGVILSGSPSSVRQE 59

Query: 67  DSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIE-IKKNCSLLKGM 125
            +PQ+        +PLLG+CYG Q + Q  GG    S+ RE+GRA ++ I  N  L+K +
Sbjct: 60  GAPQVDFNQFHGKLPLLGVCYGAQYIAQHSGGSVLPSEIREYGRANLDYIHSNNPLMKDL 119

Query: 126 WEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGG 185
               +K QVWMSHGD ++ +P  FE+IAS+D+   A    +  + Y +QFHPEV H++ G
Sbjct: 120 ---PAKSQVWMSHGDTIKEVPANFEIIASTDTVKVAAYHVKDSQTYGIQFHPEVTHSLDG 176

Query: 186 SQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEA 245
             L+ NF+  + G   +W   ++  E ++ +KEQ+GN++V+ A+SGGVDS+VAA L+++A
Sbjct: 177 KTLLQNFIIDICGCSQDWTPFAFADETIASLKEQLGNDKVVLALSGGVDSSVAALLLHKA 236

Query: 246 IGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKV 305
           IG NL CV VD+G +RKNE E+++  +K      ++ VDA ++F   LK + DPE KRK 
Sbjct: 237 IGNNLYCVFVDNGLLRKNEFESVLESYKTL-GLNVKGVDAKDQFYAALKGLTDPEKKRKA 295

Query: 306 IGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDM 365
           IG  FI++F+ EA  I   ++L QGT+YPDVIES+S  GGPS+ IKSHHNVGGLP+ M +
Sbjct: 296 IGGKFIDIFDAEAHLIQDVKWLAQGTIYPDVIESVSVNGGPSATIKSHHNVGGLPDFMKL 355

Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAI 425
           K+VEPL+ LFKDEVR +G+ L LP++ + RHP PGPGL IR +GE+T E++ IL+E+D I
Sbjct: 356 KVVEPLRSLFKDEVRRVGRALGLPENILGRHPFPGPGLGIRILGEVTPEKVAILQEADYI 415

Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDM 485
           Y E + KAG+Y K+WQA T+ LP+Q+VGVMGDERTYE V SLRAV S+DGMTAD+ H   
Sbjct: 416 YIENLRKAGLYDKVWQAGTIFLPIQSVGVMGDERTYENVVSLRAVESVDGMTADWCHLPY 475

Query: 486 NFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             L++++  I+N VKGINRVVYDI+SKPPATIEWE
Sbjct: 476 ELLAKISNEIINNVKGINRVVYDISSKPPATIEWE 510


>gi|325970674|ref|YP_004246865.1| GMP synthase (glutamine-hydrolyzing) [Spirochaeta sp. Buddy]
 gi|324025912|gb|ADY12671.1| GMP synthase (glutamine-hydrolyzing) [Spirochaeta sp. Buddy]
          Length = 517

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/512 (50%), Positives = 352/512 (68%), Gaps = 4/512 (0%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           ++++DFG+Q++QLIARRVRE  VY +++ +  + +  K   P+ II SG PAS     SP
Sbjct: 9   IVVLDFGAQYSQLIARRVREMHVYSQIVPYTTSAEALKAMQPKGIIFSGGPASVRAEGSP 68

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCS-LLKGMWEK 128
           +  + +    IP+LGICYG Q+M    GG  +    RE+G A + +    S LLKG+   
Sbjct: 69  RPDQGVYSLGIPILGICYGLQVMSIQNGGSVERPDKREYGFADLNVLNPASALLKGI--- 125

Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188
           G   ++WMSHGD V  +P GFE   S+++  +  I ++++++Y VQFHPEVVHT  G   
Sbjct: 126 GQNSRLWMSHGDSVSALPAGFEHTGSTENCSYTVIENKEKQFYGVQFHPEVVHTTEGKTF 185

Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248
           ++NFV  +   Q NW M S+    +  I+ +VG+++V+C +SGGVDS VAA LI++AIG 
Sbjct: 186 LENFVLGICKAQPNWDMGSFIANAIEEIRTKVGDKQVLCGLSGGVDSAVAAVLIHKAIGD 245

Query: 249 NLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ 308
            L CV V++G +RK E E ++ LF+      L+  +A E F+  L  + +PE KRK+IG+
Sbjct: 246 QLVCVFVNNGLLRKGEAEMVLKLFRDNYKIRLQYANAEEAFLSALAGVSEPEAKRKIIGK 305

Query: 309 LFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLV 368
           +FI+ F  EA+K G   FL QGTLYPDVIES S  GGPS+ IKSHHNVGGLPE +   L+
Sbjct: 306 VFIDTFYSEARKAGEISFLAQGTLYPDVIESKSPSGGPSATIKSHHNVGGLPEDLKWDLL 365

Query: 369 EPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYRE 428
           EPL+ELFKDEVR LG+EL LP+  V RHP PGPGL +RC+GE+T+ER++ LR+ DAI+ +
Sbjct: 366 EPLRELFKDEVRALGRELGLPEVLVTRHPFPGPGLGVRCVGEVTKERLDTLRDVDAIFID 425

Query: 429 EIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFL 488
           EI KAG+Y  IWQA   LLPV++VGV GDERTYE VCSLRAVTS D MTAD++    + L
Sbjct: 426 EIRKAGLYHDIWQALACLLPVKSVGVQGDERTYEEVCSLRAVTSEDAMTADWFRFPADVL 485

Query: 489 SQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
            + A RI NEV G+NRV+YDITSKPP TIEWE
Sbjct: 486 QRAASRICNEVSGVNRVLYDITSKPPGTIEWE 517


>gi|317014429|gb|ADU81865.1| GMP synthase [Helicobacter pylori Gambia94/24]
          Length = 508

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 271/514 (52%), Positives = 362/514 (70%), Gaps = 10/514 (1%)

Query: 10  VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69
           +L++DFGSQ+TQLIARR+RES +Y E++ F  +++  +++ P+ +ILSG PAS    D+ 
Sbjct: 2   ILVLDFGSQYTQLIARRLRESGIYAEIVPFFESVENIQKKAPKGLILSGGPASVYAKDAY 61

Query: 70  QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129
           +  ++I + N+P+LGICYG Q +    GG    +  +EFG+A +EI +N  + +G+    
Sbjct: 62  KPNEKIFDLNLPILGICYGMQYLVDFFGGVVAYANEQEFGKAILEIAQNSVIFEGV---K 118

Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189
            K  VWMSH D+V  +P+GF  +A S ++P   I  E  K + +QFHPEV+ +  G +++
Sbjct: 119 IKSLVWMSHMDKVIELPKGFTTLAKSPNSPHCAI--ENGKIFGLQFHPEVIQSEEGGKIL 176

Query: 190 DNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGIN 249
           +NF   V G +  W M  + +  ++R+KEQ+ N +V+CAVSGGVDSTV A L++ AI  N
Sbjct: 177 ENFAFLVCGCEKTWGMQHFAQREIARLKEQIANAKVLCAVSGGVDSTVVATLLHRAIKDN 236

Query: 250 LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQL 309
           L  V VDHG +RKNE E + ++FK     PL  +DA E F+ KLK + +PE KRK+IG+ 
Sbjct: 237 LIAVFVDHGLLRKNEKEKVQAMFKDL-QIPLNTIDAKEVFLSKLKGVSEPELKRKIIGET 295

Query: 310 FIEVFEEEAKK---IGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMK 366
           FIEVFE+EAKK    G  +FL QGTLYPDVIES+S   GPS +IK+HHNVGGLPE MD K
Sbjct: 296 FIEVFEKEAKKHHLKGKIEFLAQGTLYPDVIESVSV-KGPSKVIKTHHNVGGLPEWMDFK 354

Query: 367 LVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIY 426
           L+EPL+ELFKDE RLLGKEL +   F+ RHP PGPGLAIR +GEI+E +I  L+E+DAI+
Sbjct: 355 LIEPLRELFKDEARLLGKELGVSQDFLMRHPFPGPGLAIRILGEISESKIKRLQEADAIF 414

Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486
            EE+ KA +Y K+WQAF VLL V +VGVMGD RTYE    LRAV + DGMTA F   + +
Sbjct: 415 IEELKKANLYDKVWQAFCVLLNVNSVGVMGDNRTYENAICLRAVNASDGMTASFSFLEHS 474

Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
           FL +V+ RI NEV GINRVVYDITSKPP TIEWE
Sbjct: 475 FLEKVSNRITNEVNGINRVVYDITSKPPGTIEWE 508


>gi|146312639|ref|YP_001177713.1| GMP synthase [Enterobacter sp. 638]
 gi|226738453|sp|A4WD82|GUAA_ENT38 RecName: Full=GMP synthase [glutamine-hydrolyzing]; AltName:
           Full=GMP synthetase; AltName: Full=Glutamine
           amidotransferase
 gi|145319515|gb|ABP61662.1| GMP synthase (glutamine-hydrolyzing) [Enterobacter sp. 638]
          Length = 525

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 258/517 (49%), Positives = 365/517 (70%), Gaps = 5/517 (0%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
           ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +E NP  IILSG P S+ + +S
Sbjct: 9   RILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGPESTTEDNS 68

Query: 69  PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128
           P+ P+ + E+ +P+ G+CYG Q M   LGG  + S  REFG A +E+  + +L++G+ + 
Sbjct: 69  PRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVLTDSALVRGIEDS 128

Query: 129 GSKQ-----QVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTV 183
            +        VWMSHGD+V  IP  F  +AS+++ PFA +A+E++++Y VQFHPEV HT 
Sbjct: 129 LTADGKPLLDVWMSHGDKVTAIPSDFVTVASTETCPFAIMANEEKRFYGVQFHPEVTHTR 188

Query: 184 GGSQLIDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIY 243
            G +++D FV  +   +  W  +    + ++RI++QVG+++VI  +SGGVDS+V A L++
Sbjct: 189 QGMRMLDRFVRDICQCEALWTPAKIIDDAIARIRQQVGDDKVILGLSGGVDSSVTAMLLH 248

Query: 244 EAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKR 303
            AIG NLTCV VD+G +R NE E ++ +F  +    +  V+  ERF+  L    DPE KR
Sbjct: 249 RAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHFGLNIVHVEGEERFLTALAGENDPEAKR 308

Query: 304 KVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHM 363
           K+IG++F+EVF+E+A ++   ++L QGT+YPDVIES +   G + +IKSHHNVGGLP+ M
Sbjct: 309 KIIGRVFVEVFDEQALRLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEM 368

Query: 364 DMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESD 423
            M LVEPL+ELFKDEVR +G EL LP   + RHP PGPGL +R +GE+ +E  ++LR +D
Sbjct: 369 KMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEYCDLLRRAD 428

Query: 424 AIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHH 483
           AI+ EE+HKA +Y K+ QAFTV LPV++VGVMGD R Y++V SLRAV +ID MTA + H 
Sbjct: 429 AIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHL 488

Query: 484 DMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520
             +FL +V+ RI+NEV GI+RVVYDI+ KPPATIEWE
Sbjct: 489 PYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE 525


>gi|227112674|ref|ZP_03826330.1| GMP synthase [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 525

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/525 (49%), Positives = 367/525 (69%), Gaps = 5/525 (0%)

Query: 1   MHKRERSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSP 60
           M +     ++LI+DFGSQ+TQL+ARRVRE  VYCE+ A+       +  NP  IILSG P
Sbjct: 1   MTQNIHQHRILILDFGSQYTQLVARRVRE