RPSBLAST alignment for GI: 254780414 and conserved domain: PRK07053

>gnl|CDD|180812 PRK07053, PRK07053, glutamine amidotransferase; Provisional. Length = 234
 Score = 51.1 bits (123), Expect = 6e-07
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 21/138 (15%)

Query: 54  IILSGSPASSLDIDS-PQIPKEI------LESNIPLLGICYGQQIMCQSLGGKTKNSQSR 106
           ++L G P    D +  P +  EI      L + +P LGIC G Q++ ++LG +      +
Sbjct: 52  VVL-GGPIGVYDDELYPFLAPEIALLRQRLAAGLPTLGICLGAQLIARALGARVYPGGQK 110

Query: 107 EFGRAFIEI--KKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTP---FA 161
           E G A + +      S L+ +   G+   V   HGD  + +PEG  ++AS+ +     FA
Sbjct: 111 EIGWAPLTLTDAGRASPLRHL---GAGTPVLHWHGDTFD-LPEGATLLASTPACRHQAFA 166

Query: 162 FIADEKRKYYAVQFHPEV 179
           +         A+QFHPE 
Sbjct: 167 W----GNHVLALQFHPEA 180