RPSBLAST alignment for GI: 254780414 and conserved domain: PRK12838

>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed. Length = 354
 Score = 48.3 bits (116), Expect = 4e-06
 Identities = 52/191 (27%), Positives = 83/191 (43%), Gaps = 49/191 (25%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68
            V +IDFG  + + I R + +      V+ +  +L+  K  NP  I+LS  P    ++  
Sbjct: 169 HVALIDFG--YKKSILRSLSKRGCKVTVLPYDTSLEEIKNLNPDGIVLSNGPGDPKEL-Q 225

Query: 69  PQIPK-EILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG--- 124
           P +P+ + L S+ P+LGIC G Q++  +LG  T+      FG             +G   
Sbjct: 226 PYLPEIKKLISSYPILGICLGHQLIALALGADTEKLP---FGH------------RGANH 270

Query: 125 -MWEKGSKQQVWMS---HGDQVEHIPEGFEVIASS-DSTPF--AF--IADE--------K 167
            + +  +  +VWM+   H         G+ V   S D TP    F  + D         K
Sbjct: 271 PVIDL-TTGRVWMTSQNH---------GYVVDEDSLDGTPLSVRFFNVNDGSIEGLRHKK 320

Query: 168 RKYYAVQFHPE 178
           +   +VQFHPE
Sbjct: 321 KPVLSVQFHPE 331