RPSBLAST alignment for GI: 254780414 and conserved domain: PRK13170

>gnl|CDD|183877 PRK13170, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional. Length = 196
 Score = 45.2 bits (108), Expect = 4e-05
 Identities = 37/132 (28%), Positives = 52/132 (39%), Gaps = 28/132 (21%)

Query: 81  PLLGICYGQQIM---------CQSLG---GKTKNSQSREF-----GRAFIEIKKNCSLLK 123
           P+LGIC G Q++            LG   G  K            G   +  +    L +
Sbjct: 72  PVLGICLGMQLLGERSEESGGVDCLGIIDGPVKKMTDFGLPLPHMGWNQVTPQAGHPLFQ 131

Query: 124 GMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSD-STPF-AFIADEKRKYYAVQFHPEVVH 181
           G+ E GS    +  H   +   P     IA  +   PF A I   K  ++ VQFHPE   
Sbjct: 132 GI-EDGS--YFYFVHSYAM---PVNEYTIAQCNYGEPFSAAIQ--KDNFFGVQFHPERSG 183

Query: 182 TVGGSQLIDNFV 193
              G+QL+ NF+
Sbjct: 184 AA-GAQLLKNFL 194