RPSBLAST alignment for GI: 254780414 and conserved domain: COG0171

>gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism]. Length = 268
 Score = 45.7 bits (108), Expect = 4e-05
 Identities = 40/218 (18%), Positives = 79/218 (36%), Gaps = 52/218 (23%)

Query: 207 SYHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIG-----INLTCVLVDHG 258
                +V  +++ +   G + V+  +SGG+DS +   L   A+G      N+  V + +G
Sbjct: 7   EEINRLVDFLRDYLKKAGFKGVVLGLSGGIDSALVLALAVRALGKGDSKENVLAVRLPYG 66

Query: 259 FMRKNEVENIISL--FKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ-----LFI 311
           +  + + E+   L    G     + +  A + F++KL  +        +        L +
Sbjct: 67  YTVQADEEDAQDLAEALGIDYKEINIKPAVDAFLKKLLKLFLGIYLEDLALGNIKARLRM 126

Query: 312 EVFEEEAKKIGGA---------QFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362
            +    A K+GG            LG  T Y D                    V      
Sbjct: 127 VILYAIANKLGGLVLGTGNKSELALGYFTKYGD------------------GAVD----- 163

Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG 400
                + P+ +L+K +V  L + L +P+  +++ P   
Sbjct: 164 -----INPIADLYKTQVYALARHLGIPEEILKKPPTAD 196