RPSBLAST alignment for GI: 254780414 and conserved domain: COG0512

>gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 191
 Score = 85.2 bits (211), Expect = 4e-17
 Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 15/196 (7%)

Query: 9   KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN---ALDYFKEQNPQAIILSGSPASSLD 65
            +L+ID    FT  + + +RE  +  EV   +N   +L+  +   P AI++S  P +  D
Sbjct: 3   MILLIDNYDSFTYNLVQYLRE--LGAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKD 60

Query: 66  ID-SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124
              S ++ +      IP+LG+C G Q + ++ GGK   ++    G+  I       L  G
Sbjct: 61  AGISLELIRR-FAGRIPILGVCLGHQAIAEAFGGKVVRAKEPMHGKTSIITHDGSGLFAG 119

Query: 125 MWEKGSKQQVWMSHGDQV--EHIPEGFEVIASS--DSTPFAFIADEKRKYYAVQFHPEVV 180
           +    +   V   H   V  E +PE  EV A S       A +  +K   Y VQFHPE +
Sbjct: 120 L---PNPFTVTRYHSLVVDPETLPEELEVTAESEDGGVIMA-VRHKKLPIYGVQFHPESI 175

Query: 181 HTVGGSQLIDNFVHHV 196
            T  G ++++NF+   
Sbjct: 176 LTEYGHRILENFLRLA 191