RPSBLAST alignment for GI: 254780414 and conserved domain: COG0518

>gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 198
 Score =  190 bits (485), Expect = 6e-49
 Identities = 77/199 (38%), Positives = 113/199 (56%), Gaps = 11/199 (5%)

Query: 9   KVLIIDFGSQFTQLIARRVRES-KVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67
           K+LI+DFG Q+  LIARR+RE   VY E++ +    +     +P  II+SG P S  D D
Sbjct: 3   KILILDFGGQYLGLIARRLRELGYVYSEIVPYTGDAEELPLDSPDGIIISGGPMSVYDED 62

Query: 68  --SPQIPKEILESNIP---LLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSL 121
              P+    I ++ +P   +LGIC G Q++ ++LGGK +    RE G   +E+ + +  L
Sbjct: 63  PWLPREKDLIKDAGVPGKPVLGICLGHQLLAKALGGKVERGPKREIGWTPVELTEGDDPL 122

Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181
             G+ +  +   V+MSHGD V  +PEG  V+ASS++ P       KR  Y VQFHPEV H
Sbjct: 123 FAGLPDLFT--TVFMSHGDTVVELPEGAVVLASSETCPNQAFRYGKR-AYGVQFHPEVTH 179

Query: 182 TVGGSQLIDNFVHHVAGIQ 200
              G  L++NF H + G +
Sbjct: 180 EY-GEALLENFAHEICGEE 197