RPSBLAST alignment for GI: 254780414 and conserved domain: KOG0370

>gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435
 Score = 47.2 bits (112), Expect = 1e-05
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 6   RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPAS-SL 64
           +S ++L ID G ++ Q+  R + +      V+ +   +     +    + LS  P    L
Sbjct: 171 KSLRILAIDCGLKYNQI--RCLVKRGAEVTVVPWDYPIAK---EEYDGLFLSNGPGDPEL 225

Query: 65  DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKT 100
                Q  +E+LESN+P+ GIC G Q++  + G KT
Sbjct: 226 CPLLVQNVRELLESNVPVFGICLGHQLLALAAGAKT 261