RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780414|ref|YP_003064827.1| GMP synthase [Candidatus Liberibacter asiaticus str. psy62] (520 letters) >gnl|CDD|36835 KOG1622, KOG1622, KOG1622, GMP synthase [Nucleotide transport and metabolism]. Length = 552 Score = 514 bits (1325), Expect = e-146 Identities = 232/537 (43%), Positives = 323/537 (60%), Gaps = 27/537 (5%) Query: 9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68 +LI+DFG+Q+ ++I RRVRE V E++ E P+ II+SG P S D+ Sbjct: 18 TILILDFGAQYGKVIDRRVRELNVQSEILPLTTPAKTITEYGPRGIIISGGPNSVYAEDA 77 Query: 69 PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128 P I E +P+LGICYG Q++ + GG RE G IE+ + L G+ K Sbjct: 78 PSFDPAIFELGVPVLGICYGMQLINKLNGGTVVKGMVREDGEDEIEVDDSVDLFSGL-HK 136 Query: 129 GSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQL 188 V ++HGD + +PEGF+V+A S + P A I +E +K Y +QFHPEV T G +L Sbjct: 137 TEFMTVLLTHGDSLSKVPEGFKVVAFSGNKPVAGILNELKKIYGLQFHPEVTLTPNGKEL 196 Query: 189 IDNFVHHVAGIQDNWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGI 248 + NF+ V G N+ M + +E ++ I++ VG+ +V+ AVSGGVDSTV A L+ A+G Sbjct: 197 LKNFLFDVCGCSGNFTMENREEECINEIRKWVGDYKVLVAVSGGVDSTVCAALLRRALGP 256 Query: 249 N-LTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIG 307 + + + VD+GFMRK E E + Y P+ VVDASE F+ KLK + DPE KRK+IG Sbjct: 257 DRVHAIHVDNGFMRKKEAEQVEKTLV-YLGIPITVVDASETFLSKLKGVTDPEEKRKIIG 315 Query: 308 QLFIEVFEEEAKKI-----GGAQFLGQGTLYPDVIESISFFGGP-SSIIKSHHNVGGLPE 361 + FI+VF+ A ++ FL QGTL PD+IES S +G + IK+HHN GL Sbjct: 316 RTFIKVFDPVASELNKKHGEKESFLAQGTLRPDLIESASVYGSGHAETIKTHHNDTGLIR 375 Query: 362 HMDM--KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIGEITE---ERI 416 + K++EPLK+ KDEVR LGK+L LP+S V RHP PGPGLAIR + +T ++ Sbjct: 376 DLRKLGKVIEPLKDFHKDEVRELGKDLGLPESLVPRHPFPGPGLAIRVLCAVTARDLPQL 435 Query: 417 NILRESDAIYREEIHK-AGIYRKIWQAFT---VLLPVQTVGVMGDERTYEYVCSL----- 467 I+R+ D I+ + I K G+Y +I QAF LLP++TVGV GD+R+Y YV +L Sbjct: 436 EIIRKVDRIFIKSIRKDHGLYERIIQAFQIPARLLPIRTVGVQGDKRSYSYVIALPPRPL 495 Query: 468 RAVTSIDGMTADFY----HHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEWE 520 RA T+ D MT D + FL ++ I N+V GI+RV+YD+TSKPP T EWE Sbjct: 496 RAFTTSDFMTGDPATPGNEFPVKFLLKMVTEICNKVPGISRVLYDLTSKPPGTTEWE 552 >gnl|CDD|30865 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]. Length = 315 Score = 512 bits (1321), Expect = e-146 Identities = 200/319 (62%), Positives = 246/319 (77%), Gaps = 4/319 (1%) Query: 202 NWVMSSYHKEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMR 261 W M ++ +E + I+EQVG+ +VI A+SGGVDS+VAA L + AIG LTCV VDHG +R Sbjct: 1 MWTMENFIEEAIEEIREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQLTCVFVDHGLLR 60 Query: 262 KNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKI 321 K E E ++ +F+ + L VVDA +RF+ LK + DPE KRK+IG+ FIEVFEEEAKK+ Sbjct: 61 KGEAEQVVEMFREHLGLNLIVVDAKDRFLSALKGVTDPEEKRKIIGREFIEVFEEEAKKL 120 Query: 322 GGAQFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRL 381 G A+FL QGT+YPDVIES G + IKSHHNVGGLPE M +KLVEPL+ELFKDEVR Sbjct: 121 G-AEFLAQGTIYPDVIESG---TGKAGTIKSHHNVGGLPEDMKLKLVEPLRELFKDEVRE 176 Query: 382 LGKELRLPDSFVERHPCPGPGLAIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQ 441 LG+EL LP+ V RHP PGPGLA+R +GE+T E++ ILRE+DAI EE+ KAG+Y KIWQ Sbjct: 177 LGRELGLPEEIVYRHPFPGPGLAVRILGEVTREKLEILREADAIVEEELRKAGLYDKIWQ 236 Query: 442 AFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKG 501 AF VLLPV++VGVMGD RTY YV +LRAV SIDGMTAD+ + L +++ RI NEV G Sbjct: 237 AFAVLLPVKSVGVMGDGRTYGYVVALRAVESIDGMTADWARLPYDVLEKISNRITNEVPG 296 Query: 502 INRVVYDITSKPPATIEWE 520 +NRVVYDITSKPPATIEWE Sbjct: 297 VNRVVYDITSKPPATIEWE 315 >gnl|CDD|30184 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.. Length = 295 Score = 483 bits (1246), Expect = e-137 Identities = 193/296 (65%), Positives = 233/296 (78%), Gaps = 1/296 (0%) Query: 224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV 283 +VI A+SGGVDSTVAA L+++AIG LTCV VD+G +RKNE E + LF L VV Sbjct: 1 KVILALSGGVDSTVAAVLLHKAIGDRLTCVFVDNGLLRKNEAERVEELFSKLLGINLIVV 60 Query: 284 DASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFF 343 DASERF+ LK + DPE KRK+IG+ FIEVFEEEAKK+G A++L QGTLYPDVIES S Sbjct: 61 DASERFLSALKGVTDPEEKRKIIGETFIEVFEEEAKKLGLAEYLAQGTLYPDVIESGSG- 119 Query: 344 GGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGL 403 G + IKSHHNVGGLPE M +KL+EPL++LFKDEVR LG+EL LP+ VERHP PGPGL Sbjct: 120 KGSADTIKSHHNVGGLPEDMKLKLIEPLRDLFKDEVRELGRELGLPEEIVERHPFPGPGL 179 Query: 404 AIRCIGEITEERINILRESDAIYREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEY 463 A+R +GE+TEE++ ILRE+DAI EE+ KAG+Y KIWQAF VLLP+++VGVMGD+RTY Y Sbjct: 180 AVRILGEVTEEKLEILREADAIVEEELEKAGLYDKIWQAFAVLLPIKSVGVMGDQRTYGY 239 Query: 464 VCSLRAVTSIDGMTADFYHHDMNFLSQVAIRIVNEVKGINRVVYDITSKPPATIEW 519 V +LRAV S D MTAD+ L +++ RI NEV G+NRVVYDITSKPPATIEW Sbjct: 240 VVALRAVESSDFMTADWARLPYEVLEKISNRITNEVPGVNRVVYDITSKPPATIEW 295 >gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. Glutamine amidotransferase (GATase) activity catalyse the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. GMP synthetase catalyses the amination of the nucleotide precursor xanthosine 5'-monophospahte to form GMP. GMP synthetase belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 181 Score = 258 bits (661), Expect = 4e-69 Identities = 94/184 (51%), Positives = 131/184 (71%), Gaps = 3/184 (1%) Query: 10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69 +LI+DFGSQ+T LIARRVRE VY E++ L+ K +NP+ IILSG P+S + D+P Sbjct: 1 ILILDFGSQYTHLIARRVRELGVYSEILPNTTPLEEIKLKNPKGIILSGGPSSVYEEDAP 60 Query: 70 QIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKG 129 ++ EI E +P+LGICYG Q++ ++LGGK + RE+G+A IEI + L +G+ Sbjct: 61 RVDPEIFELGVPVLGICYGMQLIAKALGGKVERGDKREYGKAEIEIDDSSPLFEGLP--- 117 Query: 130 SKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVHTVGGSQLI 189 +Q VWMSHGD+V +PEGF+VIASSD+ P A IA+E++K Y VQFHPEV HT G +++ Sbjct: 118 DEQTVWMSHGDEVVKLPEGFKVIASSDNCPVAAIANEEKKIYGVQFHPEVTHTEKGKEIL 177 Query: 190 DNFV 193 NF+ Sbjct: 178 KNFL 181 >gnl|CDD|144525 pfam00958, GMP_synt_C, GMP synthase C terminal domain. GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. This family is the C-terminal domain specific to the GMP synthases EC:6.3.5.2. In prokaryotes this domain mediates dimerization. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains. Length = 93 Score = 192 bits (490), Expect = 3e-49 Identities = 63/93 (67%), Positives = 73/93 (78%) Query: 427 REEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYHHDMN 486 EE+ KAG+Y KIWQAF VLLPV++VGVMGDERTY YV +LRAV S D MTAD+ Sbjct: 1 IEELRKAGLYDKIWQAFAVLLPVKSVGVMGDERTYGYVVALRAVESTDFMTADWARLPYE 60 Query: 487 FLSQVAIRIVNEVKGINRVVYDITSKPPATIEW 519 L +++ RI NEV G+NRVVYDITSKPPATIEW Sbjct: 61 VLERISNRITNEVPGVNRVVYDITSKPPATIEW 93 >gnl|CDD|30864 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 198 Score = 190 bits (485), Expect = 6e-49 Identities = 77/199 (38%), Positives = 113/199 (56%), Gaps = 11/199 (5%) Query: 9 KVLIIDFGSQFTQLIARRVRES-KVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67 K+LI+DFG Q+ LIARR+RE VY E++ + + +P II+SG P S D D Sbjct: 3 KILILDFGGQYLGLIARRLRELGYVYSEIVPYTGDAEELPLDSPDGIIISGGPMSVYDED 62 Query: 68 --SPQIPKEILESNIP---LLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEI-KKNCSL 121 P+ I ++ +P +LGIC G Q++ ++LGGK + RE G +E+ + + L Sbjct: 63 PWLPREKDLIKDAGVPGKPVLGICLGHQLLAKALGGKVERGPKREIGWTPVELTEGDDPL 122 Query: 122 LKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFHPEVVH 181 G+ + + V+MSHGD V +PEG V+ASS++ P KR Y VQFHPEV H Sbjct: 123 FAGLPDLFT--TVFMSHGDTVVELPEGAVVLASSETCPNQAFRYGKR-AYGVQFHPEVTH 179 Query: 182 TVGGSQLIDNFVHHVAGIQ 200 G L++NF H + G + Sbjct: 180 EY-GEALLENFAHEICGEE 197 >gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I. Length = 187 Score = 137 bits (347), Expect = 7e-33 Identities = 61/192 (31%), Positives = 89/192 (46%), Gaps = 11/192 (5%) Query: 11 LIIDFGSQFTQLIARRVRESKVYCEVIAF-KNALDYFKEQNPQAIILSGSPASSLDID-S 68 L+ID G FT +AR +RE V EV+ A + + NP II+S P S D + Sbjct: 1 LLIDNGDSFTYNLARALRELGVEVEVVPNDTPAEEILELLNPDGIIISPGPGSPGDAGGA 60 Query: 69 PQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEK 128 + KE+ E+ IP+LGIC G Q++ + GGK + + L G+ Sbjct: 61 IEAIKELRENKIPILGICLGHQLLALAFGGKVIK-AKEPHHGKNSPVGHDKGLFYGL--- 116 Query: 129 GSKQQVWMSHGDQV--EHIPEGFEVIASS--DSTPFAFIADEKRKYYAVQFHPEVVHTVG 184 + V H V + +P+G EV A+S A E + VQFHPE T G Sbjct: 117 PNVFIVRRYHSYAVDPDTLPDGLEVTAASDNGGEIMAIRHKEN-PIFGVQFHPESSLTPG 175 Query: 185 GSQLIDNFVHHV 196 G +L+ NF+ + Sbjct: 176 GPELLFNFLIKL 187 >gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 188 Score = 100 bits (250), Expect = 1e-21 Identities = 44/153 (28%), Positives = 73/153 (47%), Gaps = 23/153 (15%) Query: 52 QAIILSGSPASSLDIDSPQIPKEI------LESNIPLLGICYGQQIMCQSLGGK-TKNSQ 104 +++ G P S + D P + K L + P+LGIC G Q++ ++LGGK +N + Sbjct: 48 DGLVILGGPMSVDEDDYPWLKKLKELIRQALAAGKPVLGICLGHQLLARALGGKVGRNPK 107 Query: 105 SREFGRAFIEI---KKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSDSTPF- 160 E G + + K L G+ ++ HGD V +P G ++ASS++ P Sbjct: 108 GWEIGWFPVTLTEAGKADPLFAGLPDEFPVFH---WHGDTVVELPPGAVLLASSEACPNQ 164 Query: 161 AFIADEKRKYYAVQFHPEVVHTVGGSQLIDNFV 193 AF + + +QFHPE +L+ NF+ Sbjct: 165 AFRYGD--RALGLQFHPE-------ERLLRNFL 188 >gnl|CDD|30858 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 191 Score = 85.2 bits (211), Expect = 4e-17 Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 15/196 (7%) Query: 9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKN---ALDYFKEQNPQAIILSGSPASSLD 65 +L+ID FT + + +RE + EV +N +L+ + P AI++S P + D Sbjct: 3 MILLIDNYDSFTYNLVQYLRE--LGAEVTVVRNDDISLELIEALKPDAIVISPGPGTPKD 60 Query: 66 ID-SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKG 124 S ++ + IP+LG+C G Q + ++ GGK ++ G+ I L G Sbjct: 61 AGISLELIRR-FAGRIPILGVCLGHQAIAEAFGGKVVRAKEPMHGKTSIITHDGSGLFAG 119 Query: 125 MWEKGSKQQVWMSHGDQV--EHIPEGFEVIASS--DSTPFAFIADEKRKYYAVQFHPEVV 180 + + V H V E +PE EV A S A + +K Y VQFHPE + Sbjct: 120 L---PNPFTVTRYHSLVVDPETLPEELEVTAESEDGGVIMA-VRHKKLPIYGVQFHPESI 175 Query: 181 HTVGGSQLIDNFVHHV 196 T G ++++NF+ Sbjct: 176 LTEYGHRILENFLRLA 191 >gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase. Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase (ASase). This group contains proteins similar to para-aminobenzoate (PABA) synthase and ASase. These enzymes catalyze similar reactions and produce similar products, PABA and ortho-aminobenzoate (anthranilate). Each enzyme is composed of non-identical subunits: a glutamine amidotransferase subunit (component II) and a subunit that produces an aminobenzoate products (component I). ASase catalyses the synthesis of anthranilate from chorismate and glutamine and is a tetrameric protein comprising two copies each of components I and II. Component II of ASase belongs to the family of triad GTases which hydrolyze glutamine and transfer nascent ammonia between the active sites. In some bacteria, such as Escherichia coli, component II can be much larger than in other organisms, due to the presence of phosphoribosyl-anthranilate transferase (PRTase) activity. PRTase catalyses the second step in tryptophan biosynthesis and results in the addition of 5-phosphoribosyl-1-pyrophosphate to anthranilate to create N-5'-phosphoribosyl-anthranilate. In E.coli, the first step in the conversion of chorismate to PABA involves two proteins: PabA and PabB which co-operate to transfer the amide nitrogen of glutamine to chorismate forming 4-amino-4 deoxychorismate (ADC). PabA acts as a glutamine amidotransferase, supplying an amino group to PabB, which carries out the amination reaction. A third protein PabC then mediates elimination of pyruvate and aromatization to give PABA. Several organisms have bipartite proteins containing fused domains homologous to PabA and PabB commonly called PABA synthases. These hybrid PABA synthases may produce ADC and not PABA. Length = 184 Score = 80.3 bits (199), Expect = 1e-15 Identities = 53/201 (26%), Positives = 89/201 (44%), Gaps = 34/201 (16%) Query: 10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKN---ALDYFKEQNPQAIILS---GSPASS 63 +L+ID FT + + +RE + EV+ +N L+ + NP AI++S G P + Sbjct: 1 ILLIDNYDSFTYNLVQYLRE--LGAEVVVVRNDEITLEELELLNPDAIVISPGPGHPEDA 58 Query: 64 LDIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK 123 S +I + + +P+LG+C G Q + ++ GGK + G+ L K Sbjct: 59 GI--SLEIIRALAG-KVPILGVCLGHQAIAEAFGGKVVRAPEPMHGKTSEIHHDGSGLFK 115 Query: 124 GMWEKGSKQQVWMSHGDQV----------EHIPEGFEVIASSDS-TPFAFIADEKRKYYA 172 G+ Q V + +P+ EV AS++ A + Y Sbjct: 116 GL-----PQPF------TVGRYHSLVVDPDPLPDLLEVTASTEDGVIMA-LRHRDLPIYG 163 Query: 173 VQFHPEVVHTVGGSQLIDNFV 193 VQFHPE + T G +L++NF+ Sbjct: 164 VQFHPESILTEYGLRLLENFL 184 >gnl|CDD|164502 CHL00101, trpG, anthranilate synthase component 2. Length = 190 Score = 67.1 bits (164), Expect = 1e-11 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 21/195 (10%) Query: 10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKN---ALDYFKEQNPQAIILSGSPASSLDI 66 +LIID FT + + + E +V+ +N L K N + II+S P D Sbjct: 2 ILIIDNYDSFTYNLVQSLGELNS--DVLVCRNDEIDLSKIKNLNIRHIIISPGPGHPRDS 59 Query: 67 DSPQIPKEILES---NIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLK 123 I +++ S IP+LG+C G Q + GGK + G+ + L + Sbjct: 60 G---ISLDVISSYAPYIPILGVCLGHQSIGYLFGGKIIKAPKPMHGKTSKIYHNHDDLFQ 116 Query: 124 GMWEKGSKQQVWMS--HGDQVE--HIPEGFEVIA-SSDSTPFAFIADEKRKYYAVQFHPE 178 G+ + H ++ ++P E+ A + D A + + +QFHPE Sbjct: 117 GL-----PNPFTATRYHSLIIDPLNLPSPLEITAWTEDGLIMACRHKKYKMLRGIQFHPE 171 Query: 179 VVHTVGGSQLIDNFV 193 + T G Q++ NF+ Sbjct: 172 SLLTTHGQQILRNFL 186 >gnl|CDD|38389 KOG3179, KOG3179, KOG3179, Predicted glutamine synthetase [Nucleotide transport and metabolism]. Length = 245 Score = 64.6 bits (157), Expect = 6e-11 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 10/138 (7%) Query: 49 QNPQAIILSGSPASSLDIDSPQIPK------EILESNIPLLGICYGQQIMCQSLGGKT-K 101 + ++SGS + D+ I K ++ +LGIC+G QI+ ++ GGK + Sbjct: 58 EKYDGFVISGSKHDAFS-DADWIKKLCSFVKKLDFMKKKVLGICFGHQIIARAKGGKVGR 116 Query: 102 NSQSREFGRAFIEIKKNCSLLKGMWEKGSKQ-QVWMSHGDQVEHIPEGFEVIASSDSTPF 160 + + G I I K+ + + + K + H D+V +PEG E++ASS+ Sbjct: 117 APKGPDLGLGSITIVKDAEKPEKYFGEIPKSLNIIKCHQDEVLELPEGAELLASSEKCEV 176 Query: 161 AFIADEKRKYYAVQFHPE 178 + + Q HPE Sbjct: 177 E-MFSIEDHLLCFQGHPE 193 >gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. This group of sequences represents the small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II. CPSase II catalyzes the production of carbomyl phosphate (CP) from bicarbonate, glutamine and two molecules of MgATP. The reaction is believed to proceed by a series of four biochemical reactions involving a minimum of three discrete highly reactive intermediates. The synthesis of CP is critical for the initiation of two separate biosynthetic pathways. In one CP is coupled to aspartate, its carbon and nitrogen nuclei ultimately incorporated into the aromatic moieties of pyrimidine nucleotides. In the second pathway CP is condensed with ornithine at the start of the urea cycle and is utilized for the detoxification of ammonia and biosynthesis of arginine. CPSases may be encoded by one or by several genes, depending on the species. The E.coli enzyme is a heterodimer consisting of two polypeptide chains referred to as the small and large subunit. Ammonia an intermediate during the biosynthesis of carbomyl phosphate produced by the hydrolysis of glutamine in the small subunit of the enzyme is delivered via a molecular tunnel between the remotely located carboxyphosphate active site in the large subunit. CPSase IIs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. This group also contains the sequence from the mammalian urea cycle form which has lost the active site Cys, resulting in an ammonia-dependent form, CPSase I. Length = 178 Score = 61.0 bits (149), Expect = 7e-10 Identities = 53/189 (28%), Positives = 79/189 (41%), Gaps = 47/189 (24%) Query: 10 VLIIDFGSQFTQLIARRVRE-SKVYCEVIAFKNALDY--FKEQNPQAIILSGSPASSLDI 66 V++IDFG + L RE K CEV D + +P I LS P + Sbjct: 1 VVVIDFGVKHNIL-----RELLKRGCEVTVVPYNTDAEEILKLDPDGIFLSNGPGDPALL 55 Query: 67 DSPQIP--KEILESNIPLLGICYGQQIMCQSLGGKT---KNSQSREFG-RAF----IEIK 116 D I +++L IP+ GIC G Q++ +LG KT K FG R ++ Sbjct: 56 D-EAIKTVRKLLGKKIPIFGICLGHQLLALALGAKTYKMK------FGHRGSNHPVKDLI 108 Query: 117 KNCSLLKGMWEKGSKQQVWMS---HGDQVEH--IPEGFEV--IASSDSTPFAFIADEKRK 169 +V+++ HG V+ +P G EV + +D T I + Sbjct: 109 TG--------------RVYITSQNHGYAVDPDSLPGGLEVTHVNLNDGTV-EGIRHKDLP 153 Query: 170 YYAVQFHPE 178 ++VQFHPE Sbjct: 154 VFSVQFHPE 162 >gnl|CDD|30851 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]. Length = 368 Score = 59.8 bits (145), Expect = 2e-09 Identities = 50/177 (28%), Positives = 76/177 (42%), Gaps = 21/177 (11%) Query: 9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDS 68 V++IDFG + I R + + V+ + + NP I LS P +D Sbjct: 181 HVVVIDFGVKRN--ILRELVKRGCRVTVVPADTSAEEILALNPDGIFLSNGPGDPAPLD- 237 Query: 69 PQIP--KEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFG-RAFIEIKKNCSLLKGM 125 I KE+L + IP+ GIC G Q++ +LG KT +FG R K+ L G Sbjct: 238 YAIETIKELLGTKIPIFGICLGHQLLALALGAKTYK---MKFGHRGANHPVKD--LDTGR 292 Query: 126 WEKGSKQQVWMSHGDQV--EHIPEGFEVIASS--DSTPFAFIADEKRKYYAVQFHPE 178 S +HG V + + E +V + D T I + ++VQ+HPE Sbjct: 293 VYITS-----QNHGYAVDEDSLVETLKVTHVNLNDGTV-EGIRHKDLPAFSVQYHPE 343 >gnl|CDD|164573 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional. Length = 382 Score = 57.1 bits (138), Expect = 1e-08 Identities = 48/183 (26%), Positives = 77/183 (42%), Gaps = 34/183 (18%) Query: 9 KVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDI-D 67 K+++IDFG ++ I RR++ V+ + P I+LS P I Sbjct: 194 KIIVIDFGVKYN--ILRRLKSFGCSITVVPATSPYQDILSYQPDGILLSNGPGDPSAIHY 251 Query: 68 SPQIPKEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWE 127 + K++L+ NIP+ GIC G QI+ +L KT +FG + Sbjct: 252 GIKTVKKLLKYNIPIFGICMGHQILSLALEAKTF---KLKFGHRGLN-----------HP 297 Query: 128 KGSKQQVWMS---HGDQVEHIPEGFEVIASS---------DSTPFAFIADEKRKYYAVQF 175 G QQV ++ HG V E +A + + A I+ + Y++VQ+ Sbjct: 298 SGLNQQVEITSQNHGFAVN-----LESLAKNKFYITHFNLNDGTVAGISHSPKPYFSVQY 352 Query: 176 HPE 178 HPE Sbjct: 353 HPE 355 >gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning]. Length = 298 Score = 55.2 bits (132), Expect = 4e-08 Identities = 41/193 (21%), Positives = 72/193 (37%), Gaps = 16/193 (8%) Query: 205 MSSYHKEIVSRIKEQ-VGNERVICAVSGGVDSTVAAFLIYEAIG-INLTCVLVDHGFM-- 260 +++ I+E + +++ AVSGG DS L+ E I + V VDHG Sbjct: 3 REKLERKVKRAIREFNLIEYKILVAVSGGKDSLALLHLLKELGRRIEVEAVHVDHGLRGY 62 Query: 261 RKNEVENIISLFKGYPNFPLRVVDASERFIRKLKNIVDPETK-RKVIGQLFIEVFEEEAK 319 E E + L + PL V ++ R+ + R++ L ++ +E Sbjct: 63 SDQEAELVEKLCEKL-GIPLIVERVTDDLGRETLDGKSICAACRRLRRGLLYKIAKEL-- 119 Query: 320 KIGGAQFLGQGTLYPDVIESIS---FFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFK 376 GA + G D E+ G ++ + ++ PL + + Sbjct: 120 ---GADKIATGHHLDDQAETFLMNLLRGSGLRGLRGMPPKRPFEG--GLLIIRPLLYVRE 174 Query: 377 DEVRLLGKELRLP 389 E+ L KE LP Sbjct: 175 KEIELYAKEKGLP 187 >gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS). IGPS incorporates ammonia derived from glutamine into N1-[(5'-phosphoribulosyl)-formimino]-5-aminoimidazole-4- carboxamide ribonucleotide (PRFAR) to form 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR) and imidazole glycerol phosphate (IGP). The glutamine amidotransferase domain generates the ammonia nucleophile which is channeled from the glutaminase active site to the PRFAR active site. IGPS belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 198 Score = 54.4 bits (132), Expect = 8e-08 Identities = 37/149 (24%), Positives = 54/149 (36%), Gaps = 43/149 (28%) Query: 73 KEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFG------------RAF-------- 112 KE + S P LGIC G Q++ +S S E G F Sbjct: 65 KEAIASGKPFLGICLGMQLLFES---------SEEGGGTKGLGLIPGKVVRFPASEGLKV 115 Query: 113 -------IEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSD-STPFAFIA 164 +EI K L KG+ + + H + ++A++D F A Sbjct: 116 PHMGWNQLEITKESPLFKGIPDGSY---FYFVHSYYAP-PDDPDYILATTDYGGKFP-AA 170 Query: 165 DEKRKYYAVQFHPEVVHTVGGSQLIDNFV 193 EK + QFHPE G +L+ NF+ Sbjct: 171 VEKDNIFGTQFHPEKSGKA-GLKLLKNFL 198 >gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism]. Length = 204 Score = 51.3 bits (123), Expect = 5e-07 Identities = 36/144 (25%), Positives = 56/144 (38%), Gaps = 26/144 (18%) Query: 73 KEILESNIPLLGICYGQQIMCQS------------LGGKTKNSQSREF-----GRAFIEI 115 KE +ES P LGIC G Q++ + + GK + + G +E Sbjct: 68 KEAVESGKPFLGICLGMQLLFERSEEGGGVKGLGLIPGKVVRFPAEDLKVPHMGWNQVEF 127 Query: 116 KKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIASSD-STPF-AFIADEKRKYYAV 173 + L KG+ + H V V+A++D PF A + K + Sbjct: 128 VRGHPLFKGI---PDGAYFYFVHSYYVPPGNPE-TVVATTDYGEPFPAAV--AKDNVFGT 181 Query: 174 QFHPEVVHTVGGSQLIDNFVHHVA 197 QFHPE G +L+ NF+ + Sbjct: 182 QFHPEKSGKA-GLKLLKNFLEWIP 204 >gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily. Adenine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.. Length = 202 Score = 49.8 bits (119), Expect = 2e-06 Identities = 51/208 (24%), Positives = 80/208 (38%), Gaps = 28/208 (13%) Query: 225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVVD 284 V A SGGVDST+ +A+G + V + E+E L K V++ Sbjct: 1 VAVAFSGGVDSTLLLKAAVDALGDRVLAVTATSPLFPRRELEEAKRLAKEI-GIRHEVIE 59 Query: 285 ASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIESISFFG 344 E + +P + + + E +E A+++G L GT D+ + Sbjct: 60 TDELDDPEFAK--NPPDRCYLCKKALYEALKEIAEELGLDVVL-DGTNADDLGD------ 110 Query: 345 GPSSIIKSHHNVGGLPEHMDMKLVEPLKE--LFKDEVRLLGKELRLPDSFVERHPCPGPG 402 + G ++ + PL E L K E+R L +EL LP C Sbjct: 111 ---------YRPGLKALR-ELGVRSPLAEAGLGKAEIRELARELGLPTWDKPAMAC---- 156 Query: 403 LAIRCI--GEITEERINILRESDAIYRE 428 LA R EITEER+ + ++ R Sbjct: 157 LASRIPYGTEITEERLKKVEAAEEFLRS 184 >gnl|CDD|35249 KOG0026, KOG0026, KOG0026, Anthranilate synthase, beta chain [Amino acid transport and metabolism]. Length = 223 Score = 49.3 bits (117), Expect = 3e-06 Identities = 40/175 (22%), Positives = 69/175 (39%), Gaps = 12/175 (6%) Query: 34 CEVIAFKN---ALDYFKEQNPQAIILSGSPASSLDIDSPQIPKEILESNIPLLGICYGQQ 90 C ++N ++ K +NP+ +++S P + D L +PL G+C G Q Sbjct: 44 CHFEVYRNDELTVEELKRKNPRGLLISPGPGTPQDSGISLQTVLELGPLVPLFGVCMGLQ 103 Query: 91 IMCQSLGGKTKNSQSR----EFGRAFIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIP 146 + ++ GGK S + + K L G+ + ++ Sbjct: 104 CIGEAFGGKIVRSPFGVMHGKSSMVHYDEKGEEGLFSGLSNPFIVGRYHSLVIEKDSFPS 163 Query: 147 EGFEVIASSDSTPFAFIADEKRKYY---AVQFHPEVVHTVGGSQLIDNFVHHVAG 198 + EV A ++ +A RKY VQFHPE + T G ++ NF+ V Sbjct: 164 DELEVTAWTEDG--LVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEK 216 >gnl|CDD|30183 cd01996, Alpha_ANH_like_III, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domain has a strongly conserved motif SGGKD at the N terminus.. Length = 154 Score = 48.3 bits (115), Expect = 4e-06 Identities = 22/50 (44%), Positives = 30/50 (60%) Query: 225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKG 274 I VSGG DS+ A +L+ E G+N V VD+GF + V+NI +L K Sbjct: 4 CIIGVSGGKDSSYALYLLKEKYGLNPLAVTVDNGFNSEEAVKNIKNLIKK 53 >gnl|CDD|32254 COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only]. Length = 243 Score = 47.2 bits (112), Expect = 1e-05 Identities = 31/128 (24%), Positives = 46/128 (35%), Gaps = 16/128 (12%) Query: 65 DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGG-------------KTKNSQSREFGRA 111 D + + LE IP+LGIC G Q++ +LGG + Sbjct: 93 DAFELALIRAALERGIPILGICRGLQLLNVALGGTLYQDISEQPGHIDHRQPNPVHIESH 152 Query: 112 FIEIKKNCSLLKGMWEKGSKQQVWMSHGDQVEHIPEGFEVIA-SSDSTPFAFIADEKRKY 170 + I+ L K + E V H ++ + G V A + D T A Sbjct: 153 EVHIEPGSKLAKILGESEF--MVNSFHHQAIKKLAPGLVVEARAPDGTVEAVEVKNDAFV 210 Query: 171 YAVQFHPE 178 VQ+HPE Sbjct: 211 LGVQWHPE 218 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 47.2 bits (112), Expect = 1e-05 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 6/96 (6%) Query: 6 RSSKVLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPAS-SL 64 +S ++L ID G ++ Q+ R + + V+ + + + + LS P L Sbjct: 171 KSLRILAIDCGLKYNQI--RCLVKRGAEVTVVPWDYPIAK---EEYDGLFLSNGPGDPEL 225 Query: 65 DIDSPQIPKEILESNIPLLGICYGQQIMCQSLGGKT 100 Q +E+LESN+P+ GIC G Q++ + G KT Sbjct: 226 CPLLVQNVRELLESNVPVFGICLGHQLLALAAGAKT 261 >gnl|CDD|36438 KOG1224, KOG1224, KOG1224, Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis]. Length = 767 Score = 47.0 bits (111), Expect = 1e-05 Identities = 36/150 (24%), Positives = 59/150 (39%), Gaps = 13/150 (8%) Query: 53 AIILSGSPASSLDIDSPQIPKEILESN--IPLLGICYGQQIMCQSLGGKTKNSQSREFGR 110 AI++ P S + I +L IP+LGIC G Q + G ++ GR Sbjct: 67 AIVVGPGPGSPMCAADIGICLRLLLECRDIPILGICLGFQALGLVHGAHVVHANEPVHGR 126 Query: 111 AF-IEIKKN---CSLLKGMWEKGSKQQVWMSHGDQVEHIP-EGFEVIASSDSTPFAF--- 162 IE N + G + S +V H + +P + ++ + Sbjct: 127 VSGIEHDGNILFSGIPSG---RNSDFKVVRYHSLIINSLPIDLLPILWTIYDDNGHILMS 183 Query: 163 IADEKRKYYAVQFHPEVVHTVGGSQLIDNF 192 I ++ +Q+HPE + + GSQL NF Sbjct: 184 IMHSSFPHFGLQYHPESIASTYGSQLFKNF 213 >gnl|CDD|30166 cd00553, NAD_synthase, NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD+ occurs via an NAD-adenylate intermediate and requires ATP and Mg2+. The intemediate is subsequently cleaved into NAD+ and AMP. In many prokaryotes, such as E. coli , NAD synthetase consists of a single domain and is strictly ammonia dependent. In contrast, eukaryotes and other prokaryotes have an additional N-terminal amidohydrolase domain that prefer glutamine, Interestingly, NAD+ synthases in these prokaryotes, can also utilize ammonia as an amide source .. Length = 248 Score = 46.4 bits (110), Expect = 2e-05 Identities = 38/229 (16%), Positives = 71/229 (31%), Gaps = 81/229 (35%) Query: 208 YHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE 264 +V +++ + G + V+ +SGG+DS + A L A+G Sbjct: 6 IINALVLFLRDYLRKSGFKGVVLGLSGGIDSALVAALAVRALGR---------------- 49 Query: 265 VENIISLFKGYPNFPLRVVDASERFIRKLKNI---VDPETKRKVIGQLFIEVFEEEAKKI 321 EN+++LF + ++ L +D + + L E E + + Sbjct: 50 -ENVLALFMPSRYSSEETREDAKELAEALGIEHVNIDIDPAVEAFLALLGESGGSELEDL 108 Query: 322 --GGAQ----------------------------FLGQGTLYPDVIESISFFGGPSSIIK 351 G Q LG T Y D Sbjct: 109 ALGNIQARLRMVILYALANKLGGLVLGTGNKSELLLGYFTKYGD---------------- 152 Query: 352 SHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG 400 + P+ +L+K +VR L + L +P+S +++ P Sbjct: 153 ------------GAADINPIGDLYKTQVRELARYLGVPESIIDKPPSAE 189 >gnl|CDD|30520 COG0171, NadE, NAD synthase [Coenzyme metabolism]. Length = 268 Score = 45.7 bits (108), Expect = 4e-05 Identities = 40/218 (18%), Positives = 79/218 (36%), Gaps = 52/218 (23%) Query: 207 SYHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIG-----INLTCVLVDHG 258 +V +++ + G + V+ +SGG+DS + L A+G N+ V + +G Sbjct: 7 EEINRLVDFLRDYLKKAGFKGVVLGLSGGIDSALVLALAVRALGKGDSKENVLAVRLPYG 66 Query: 259 FMRKNEVENIISL--FKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ-----LFI 311 + + + E+ L G + + A + F++KL + + L + Sbjct: 67 YTVQADEEDAQDLAEALGIDYKEINIKPAVDAFLKKLLKLFLGIYLEDLALGNIKARLRM 126 Query: 312 EVFEEEAKKIGGA---------QFLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEH 362 + A K+GG LG T Y D V Sbjct: 127 VILYAIANKLGGLVLGTGNKSELALGYFTKYGD------------------GAVD----- 163 Query: 363 MDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPG 400 + P+ +L+K +V L + L +P+ +++ P Sbjct: 164 -----INPIADLYKTQVYALARHLGIPEEILKKPPTAD 196 >gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]. Length = 269 Score = 44.1 bits (104), Expect = 9e-05 Identities = 58/224 (25%), Positives = 95/224 (42%), Gaps = 34/224 (15%) Query: 210 KEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENII 269 + + IKE+ ++V+ A SGGVDS++ A L EA+G N+ V VD ++ + E+E Sbjct: 8 ERLKKAIKEK---KKVVVAFSGGVDSSLLAKLAKEALGDNVVAVTVDSPYIPRREIEEAK 64 Query: 270 SLFKGYPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQ 329 ++ K + + +N PE + + + EEA+K G Sbjct: 65 NIAKEI-GIRHEFIKMNRMDPEFKEN---PENRCYLCKRAVYSTLVEEAEKRG------- 113 Query: 330 GTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKE--LFKDEVRLLGKELR 387 Y V + + S + + GL ++ + PL E + K E+R + K L Sbjct: 114 ---YDVVADGTNA-----SDLFDYRP--GLRALKELGIRSPLAEFGITKKEIREIAKSLG 163 Query: 388 LPDSFVERHPCPGPGLAIRCIG---EITEERINILRESDAIYRE 428 LP C LA R I EIT E + + E++ RE Sbjct: 164 LPTWDKPSMAC----LASR-IPYGEEITVEDLKKVEEAEEFLRE 202 >gnl|CDD|30167 cd01712, ThiI, ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway. It belongs to the Adenosine Nucleotide Hydrolysis suoerfamily and predicted to bind to Adenosine nucleotide.. Length = 177 Score = 43.7 bits (103), Expect = 1e-04 Identities = 34/192 (17%), Positives = 78/192 (40%), Gaps = 23/192 (11%) Query: 224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFM----RKNEVENIISLFKGY-PNF 278 + + +SGG+DS VAA+L+ + GI + + + G + +VE++ Y P Sbjct: 1 KALALLSGGIDSPVAAWLLMKR-GIEVDALHFNSGPFTSEKAREKVEDLARKLARYSPGH 59 Query: 279 PLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQFLGQGTLYPDVIE 338 L V+ + +++ + + + ++ + E+ A+++ GA + G E Sbjct: 60 KLVVIIFTFFVQKEIYGYGKEKYRCILCKRMMYRIAEKLAEEL-GADAIVTG-------E 111 Query: 339 SISFFGG--PSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERH 396 S+ G S +++ + D+ ++ PL K+E+ + + + D + Sbjct: 112 SL----GQVASQTLENLLVIS---SGTDLPILRPLIGFDKEEIIGIARRIGTYDISIRPR 164 Query: 397 PCPGPGLAIRCI 408 C Sbjct: 165 ECCCLFAPKNPA 176 >gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 115 Score = 42.6 bits (100), Expect = 3e-04 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 9/92 (9%) Query: 10 VLIIDFGSQFT---QLIARRVRESKVYCEVIAFKNALDYFKEQ--NPQAIILSGSPASSL 64 V ++ F +RE+ +V++ + +IL G P + Sbjct: 1 VAVLLFPGFEELELASPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPD 60 Query: 65 DIDSPQIP----KEILESNIPLLGICYGQQIM 92 D+ + +E + P+LGIC G Q++ Sbjct: 61 DLARDEALLALLREAAAAGKPILGICLGAQLL 92 >gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain. Type 1 glutamine amidotransferase (GATase1)-like domain. This group contains proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA, the A4 beta-galactosidase middle domain and peptidase E. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase (CPSase), cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. Peptidase E is believed to be a serine peptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad of typical GATase1 domains, by having a Ser in place of the reactive Cys at the nucleophile elbow. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Peptidase E has a circular permutation in the common core of a typical GTAse1 domain. Length = 92 Score = 42.2 bits (99), Expect = 3e-04 Identities = 19/92 (20%), Positives = 36/92 (39%), Gaps = 9/92 (9%) Query: 10 VLIIDFGSQFT---QLIARRVRESKVYCEVIAFKNALDYFKEQ--NPQAIILSGSPASSL 64 V ++ FG +RE+ +V++ + +IL G P + Sbjct: 1 VAVLLFGGSEELELASPLDALREAGAEVDVVSPDGGPVESDVDLDDYDGLILPGGPGTPD 60 Query: 65 DIDSP----QIPKEILESNIPLLGICYGQQIM 92 D+ + +E + P+LGIC G Q++ Sbjct: 61 DLAWDEALLALLREAAAAGKPVLGICLGAQLL 92 >gnl|CDD|145938 pfam03054, tRNA_Me_trans, tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. Length = 354 Score = 41.5 bits (98), Expect = 6e-04 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 14/48 (29%) Query: 223 ERVICAVSGGVDSTVAAFLI----YEAIGINLTCVLVDHGFMRKNEVE 266 +V+ A+SGGVDS+VAA+L+ YE IG+ FM+ + E Sbjct: 1 MKVVVAMSGGVDSSVAAYLLKEQGYEVIGV----------FMKNWDEE 38 >gnl|CDD|153216 cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase. Length = 189 Score = 40.6 bits (96), Expect = 0.001 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 29/107 (27%) Query: 73 KEILESNIPLLGICYGQQIMCQSLGGKTKNSQSREFGRAFIEIKKNCSLLKGMWEKGSKQ 132 + LE P+LGIC G Q++ +LGG + +I+ N SL Sbjct: 94 RAALERGKPILGICRGMQLLNVALGGTL-----------YQDIRVN-SL----------- 130 Query: 133 QVWMSHGDQVEHIPEGFEVIASS-DSTPFAFIADEKRKYYAVQFHPE 178 H ++ + +G V A + D A + ++ VQ+HPE Sbjct: 131 -----HHQAIKRLADGLRVEARAPDGVIEAIESPDRPFVLGVQWHPE 172 >gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]. Length = 356 Score = 40.6 bits (95), Expect = 0.001 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 9/90 (10%) Query: 221 GNERVICAVSGGVDSTVAAFLI----YEAIGINLTCVLVDHGFMRKNEVENIISLFKGYP 276 ++V+ +SGGVDS+VAA+L+ YE IG+ + D G E + + Sbjct: 2 KKKKVLVGMSGGVDSSVAAYLLKEQGYEVIGLFMKNWDEDGG--GGCCSEEDLRDAERVA 59 Query: 277 NF---PLRVVDASERFIRKLKNIVDPETKR 303 + PL VVD + F K+ E K Sbjct: 60 DQLGIPLYVVDFEKEFWNKVFEYFLAEYKA 89 >gnl|CDD|30185 cd01998, tRNA_Me_trans, tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.. Length = 349 Score = 40.1 bits (94), Expect = 0.001 Identities = 16/31 (51%), Positives = 23/31 (74%), Gaps = 4/31 (12%) Query: 224 RVICAVSGGVDSTVAAFLI----YEAIGINL 250 +V+ A+SGGVDS+VAA L+ YE IG+ + Sbjct: 1 KVVVAMSGGVDSSVAAALLKEQGYEVIGVFM 31 >gnl|CDD|30180 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus.. Length = 185 Score = 40.2 bits (94), Expect = 0.001 Identities = 38/194 (19%), Positives = 66/194 (34%), Gaps = 32/194 (16%) Query: 224 RVICAVSGGVDSTVAAFLIYE-----AIGINLTCVLVDHGF-MRKNEVENIISLFKGYPN 277 R++ A+SGG DS V ++ + G L + VD G ++E ++ Sbjct: 1 RILVALSGGKDSLVLLHVLKKLQRRYPYGFELEALTVDEGIPGYRDESLEVVERLAEELG 60 Query: 278 FPLRVVDASERFIRKLKNIVDPETKRKVI---------GQLFIEVFEEEAKKIGGAQFLG 328 L +V E + +I + K G L E A K+ L Sbjct: 61 IELEIVSFKEEY---TDDIEVKKRGGKSPCSLCGVLRRGLLNKIAKELGADKLATGHNLD 117 Query: 329 QGTLYPDVIESI---SFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKE 385 D E++ GG +++ + D+ + PL + + E+ L + Sbjct: 118 ------DEAETLLMNLLRGGILRLMRPGPILYLDEG--DVTRIRPLVYVREKEIVLYAEL 169 Query: 386 LRLPDSFVERHPCP 399 LP CP Sbjct: 170 NGLP---FVEEECP 180 >gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This domain has a strongly conserved motif SGGXD at the N terminus.. Length = 185 Score = 39.4 bits (92), Expect = 0.002 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Query: 224 RVICAVSGGVDSTVAAFLIYEAI---GINLTCVLVDHGF 259 +++ AVSGG DS L+ E G+ L V VDHG Sbjct: 1 KILVAVSGGPDSMALLHLLSELKPRLGLRLVAVHVDHGL 39 >gnl|CDD|145596 pfam02540, NAD_synthase, NAD synthase. NAD synthase (EC:6.3.5.1) is involved in the de novo synthesis of NAD and is induced by stress factors such as heat shock and glucose limitation. Length = 243 Score = 39.3 bits (92), Expect = 0.002 Identities = 39/205 (19%), Positives = 76/205 (37%), Gaps = 43/205 (20%) Query: 208 YHKEIVSRIKEQV---GNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNE 264 + +V +++ V G + V+ +SGG+DS V A+L +A+G Sbjct: 1 VIERLVDFLRDYVQKSGAKGVVLGLSGGIDSAVVAYLAVKALG----------------- 43 Query: 265 VENIISLFKGYPNFPLRVVDASERFIRKL--KNIVDPETKRKVIGQLFIEVFEEEAKKIG 322 EN+++L N V + L K I + F ++F+ + Sbjct: 44 KENVLALIMPSINSSEEDVQDALALAENLGINYKTID---IKPIVRAFSQLFQPAKDDLA 100 Query: 323 GAQF---LGQGTLYPDVIESISFFGGPSSII------KSHHNVGGLPEHMDMKL-VEPLK 372 + LY + + KS +G ++ D + P+ Sbjct: 101 KGNLKARIRMIILY--------AHANKFNRLVLGTGNKSELALGYFTKYGDGACDIAPIG 152 Query: 373 ELFKDEVRLLGKELRLPDSFVERHP 397 +L+K +V L K L +P+ +++ P Sbjct: 153 DLYKTQVYELAKRLNVPERIIKKPP 177 >gnl|CDD|144677 pfam01171, ATP_bind_3, PP-loop family. This family of proteins belongs to the PP-loop superfamily. Length = 182 Score = 36.8 bits (86), Expect = 0.014 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Query: 224 RVICAVSGGVDSTVAAFLIYEA---IGINLTCVLVDHGFMRKN 263 +++ AVSGG DS +L+ + GI+LT VDHG +R+ Sbjct: 1 KILVAVSGGPDSMALLYLLKKLKPKFGIDLTAAHVDHG-LREE 42 >gnl|CDD|38016 KOG2805, KOG2805, KOG2805, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis]. Length = 377 Score = 36.5 bits (84), Expect = 0.017 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 6/38 (15%) Query: 224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMR 261 RV+ A+SGGVDS+VAA L+ G N+T V FM+ Sbjct: 7 RVVVAMSGGVDSSVAARLLAAR-GYNVTGV-----FMK 38 >gnl|CDD|30524 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]. Length = 261 Score = 36.2 bits (83), Expect = 0.020 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 3/87 (3%) Query: 210 KEIVSRIKEQVGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENII 269 EI+ E+ N V+ + SGG DSTV L +A + + +D G+ E Sbjct: 28 IEILRWAAEEFSNPVVV-SFSGGKDSTVLLHLAAKAFP-DFPVIFLDTGYHFPETYEFRD 85 Query: 270 SLFKGYPNFPLRVVDASERFIRKLKNI 296 L + Y L+V + K Sbjct: 86 RLAEEY-GLDLKVYRPDDEVAEGEKYG 111 >gnl|CDD|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase. Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase (FGAR-AT). FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, Pi, and glutamate in the fourth step of the purine biosynthetic pathway. FGAR-AT is a glutamine amidotransferase. Glutamine amidotransferase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. FGAR-AT belongs to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 238 Score = 35.7 bits (83), Expect = 0.033 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 12/78 (15%) Query: 73 KEILESNIPLLGICYGQQIMCQS-------LGGKTKNSQSREFGRAFIEIK---KNCSLL 122 KE E +LGIC G QI+ + + K R R F+ ++ + Sbjct: 76 KEFAERGGLVLGICNGFQILVELGLLPGALIRNKGLKFICRWQNR-FVTLRVENNDSPFT 134 Query: 123 KGMWEKGSKQQVWMSHGD 140 KG +G ++ ++HG+ Sbjct: 135 KGY-MEGEVLRIPVAHGE 151 >gnl|CDD|145613 pfam02568, ThiI, Thiamine biosynthesis protein (ThiI). ThiI is required for thiazole synthesis, required for thiamine biosynthesis. Length = 197 Score = 34.7 bits (80), Expect = 0.064 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 9/84 (10%) Query: 223 ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVE-------NIISLFKGY 275 +V+ +SGG+DS VAA+L+ G + + + E +++ + Sbjct: 4 GKVLALLSGGIDSPVAAYLMMRR-GCRVVALHFINEPGTSEEAIEKVRKLAELLAEYGTS 62 Query: 276 PNFPLRVVDASERFIRKLKNIVDP 299 L VVD + +++ Sbjct: 63 CEGKLVVVDF-TKVQKEIIEKAPE 85 >gnl|CDD|30396 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]. Length = 231 Score = 34.4 bits (79), Expect = 0.074 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 4/72 (5%) Query: 73 KEILESNIPLLGICYGQQIMCQS--LGGKTKNSQSREF--GRAFIEIKKNCSLLKGMWEK 128 +E E P+LGIC G QI+ ++ L G ++S F ++ ++ N + +E Sbjct: 75 REFAEKGKPVLGICNGFQILSEAGLLPGALTRNESLRFECRWVYLRVENNNTPFTSGYEG 134 Query: 129 GSKQQVWMSHGD 140 G + ++HG+ Sbjct: 135 GEVIPIPVAHGE 146 >gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ). CobQ plays a role in cobalamin biosythesis. CobQ catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin. CobQ belongs to the triad family of amidotransferases. Two of the three residues of the catalytic triad that are involved in glutamine binding, hydrolysis and transfer of the resulting ammonia to the acceptor substrate in other triad aminodotransferases are conserved in CobQ. Length = 194 Score = 33.0 bits (76), Expect = 0.21 Identities = 23/95 (24%), Positives = 37/95 (38%), Gaps = 14/95 (14%) Query: 10 VLIIDFG--SQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDID 67 + +I + S FT L RE V + L + IIL GS + D+ Sbjct: 1 IAVIRYPDISNFTDL-DPLAREPGVDVRYVEVPEGLG-----DADLIILPGSKDTIQDLA 54 Query: 68 SPQIP------KEILESNIPLLGICYGQQIMCQSL 96 + K + P+LGIC G Q++ + + Sbjct: 55 WLRKRGLAEAIKNYARAGGPVLGICGGYQMLGKYI 89 >gnl|CDD|73292 cd01986, Alpha_ANH_like, Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases. The domain forms a apha/beta/apha fold which binds to Adenosine group... Length = 103 Score = 32.8 bits (74), Expect = 0.24 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Query: 225 VICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHG-FMRKNEVENII 269 V+ A SGG DS+VAA L+ + G + V VDHG R + + I Sbjct: 1 VLVAFSGGKDSSVAAALLKKL-GYQVIAVTVDHGISPRLEDAKEIA 45 >gnl|CDD|30649 COG0301, ThiI, Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]. Length = 383 Score = 32.2 bits (73), Expect = 0.37 Identities = 18/107 (16%), Positives = 44/107 (41%), Gaps = 6/107 (5%) Query: 222 NERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIIS--LFKGYPNFP 279 +V+ +SGG+DS VAA+L+ + G+ + V + + + ++ Sbjct: 175 QGKVLLLLSGGIDSPVAAWLMMKR-GVEVIPVHFGNPPYTSEKAREKVVALALLRLTSYG 233 Query: 280 LRVVDASERF---IRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGG 323 +V F ++ V + ++ ++ + E+ A++ G Sbjct: 234 GKVRLYVVPFTEVQEEILEKVPESYRCVLLKRMMYRIAEKLAEEFGA 280 >gnl|CDD|144363 pfam00733, Asn_synthase, Asparagine synthase. This family is always found associated with pfam00310. Members of this family catalyse the conversion of aspartate to asparagine. Length = 195 Score = 31.1 bits (71), Expect = 0.83 Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 220 VGNERVICAVSGGVDSTVAAFL 241 + V +SGG+DS++ A L Sbjct: 15 RADVPVGVLLSGGLDSSLIAAL 36 >gnl|CDD|30850 COG0504, PyrG, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 533 Score = 30.8 bits (70), Expect = 0.89 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 5/36 (13%) Query: 77 ESNIPLLGICYGQQIM----CQSLGGKTKNSQSREF 108 E+NIP LGIC G Q+ +++ G + + S EF Sbjct: 370 ENNIPFLGICLGMQLAVIEFARNVLGL-EGANSTEF 404 >gnl|CDD|153217 cd01746, GATase1_CTP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase. Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase (CTP). CTP is involved in pyrimidine ribonucleotide/ribonucleoside metabolism. CTPs produce CTP from UTP and glutamine and regulate intracellular CTP levels through interactions with four ribonucleotide triphosphates. The enzyme exists as a dimer of identical chains that aggregates as a tetramer. CTP is derived form UTP in three separate steps involving two active sites. In one active site, the UTP O4 oxygen is activated by Mg-ATP-dependent phosphorylation, followed by displacement of the resulting 4-phosphate moiety by ammonia. At a separate site, ammonia is generated via rate limiting glutamine hydrolysis (glutaminase) activity. A gated channel that spans between the glutamine hydrolysis and amidoligase active sites provides a path for ammonia diffusion. CTPs belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 235 Score = 31.0 bits (71), Expect = 0.91 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 5/36 (13%) Query: 77 ESNIPLLGICYGQQIM----CQSLGGKTKNSQSREF 108 E+NIP LGIC G Q+ +++ G ++ S EF Sbjct: 82 ENNIPFLGICLGMQLAVIEFARNVLGL-PDANSTEF 116 >gnl|CDD|37598 KOG2387, KOG2387, KOG2387, CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]. Length = 585 Score = 30.2 bits (68), Expect = 1.4 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 5/36 (13%) Query: 77 ESNIPLLGICYGQQI----MCQSLGGKTKNSQSREF 108 E+ IP LGIC G Q+ +++ G K++ S EF Sbjct: 390 ENKIPFLGICLGMQLAVIEFARNVLG-LKDANSTEF 424 >gnl|CDD|38051 KOG2840, KOG2840, KOG2840, Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only]. Length = 347 Score = 30.3 bits (68), Expect = 1.4 Identities = 56/230 (24%), Positives = 84/230 (36%), Gaps = 30/230 (13%) Query: 222 NERVICAVSGGVDSTVAAFL-----IYEAIGINLTCVLVDHG--FMRKNEVENIISLFKG 274 ERV SGG DSTV A++ G+ L + +D G R + +E + Sbjct: 51 GERVAIGASGGKDSTVLAYVLDALNERHDYGLRLFLLSIDEGIRGYRDDSLEAVKRNGVQ 110 Query: 275 YPNFPLRVVDASERFIRKLKNIVDPETKRKVIGQ------LFIEVFEEEAKKIG----GA 324 Y PL +V + L + IGQ F VF +A G GA Sbjct: 111 Y-GLPLCIVS-----YKDLYGEWTMDEIVSEIGQEIRNNCTFCGVFRRQALDRGADVLGA 164 Query: 325 QFLGQGTLYPDVIESI--SFFGGPSSIIKSHHNVG-GLPEHMDMKLVEPLKELFKDEVRL 381 L G D E++ + G S+ ++ + E + ++PLK + E+ L Sbjct: 165 AELVTGHNADDWAETVLMNLLRGDSARLERLTEITTPSLEMGIIPRLKPLKYASEKEIVL 224 Query: 382 LGKELRLPDSFVERHPCPGP--GLAIRCIGEITEERINILRESDAIYREE 429 +L E PG G A + ++ ER IL D E Sbjct: 225 YASLSKLRYFSTECVKAPGASRGDARILLKDLERERPRILM--DYCRSGE 272 >gnl|CDD|73293 cd01995, ExsB, ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown. Length = 169 Score = 30.2 bits (68), Expect = 1.6 Identities = 38/180 (21%), Positives = 67/180 (37%), Gaps = 39/180 (21%) Query: 224 RVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRVV 283 + + +SGG+DST + G + + D+G +++ E Sbjct: 1 KAVVLLSGGLDSTTCLA-WAKKEGYEVHALSFDYG--QRHAKE----------------E 41 Query: 284 DASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIG-GAQFLG----QGTLYPDVIE 338 +A++ KL P T +F+ + A+ +G A +G + YPD Sbjct: 42 EAAKLIAEKLG----PSTYVPARNLIFLSIAAAYAEALGAEAIIIGVNAEDYSGYPDC-- 95 Query: 339 SISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELFKDEVRLLGKELRLPDSFVERHPC 398 F I++ + L +K+ PL +L K E+ LG EL +P C Sbjct: 96 RPEF-------IEAMNKALNLGTENGIKIHAPLIDLSKAEIVRLGGELGVP--LELTWSC 146 >gnl|CDD|32874 COG3060, MetJ, Transcriptional regulator of met regulon [Transcription / Amino acid transport and metabolism]. Length = 105 Score = 29.3 bits (65), Expect = 2.6 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482 Y E K+ +KI TV +P++ + ++ DERT V +LR T+ + + F H Sbjct: 12 YAEHGKKSEQVKKI----TVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLH 64 >gnl|CDD|31681 COG1492, CobQ, Cobyric acid synthase [Coenzyme metabolism]. Length = 486 Score = 29.0 bits (65), Expect = 3.0 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 12/93 (12%) Query: 10 VLIIDFGSQFTQLIARRVRESKVYCEVIAFKNALDYFKEQNPQAIILSGSPASSLDIDSP 69 V+ + S FT R E V + + L + +IL GS + D+ Sbjct: 256 VIRLPRISNFTDFDPLR-AEPDVRVRFVKPGSDLR-----DADLVILPGSKNTIADLKIL 309 Query: 70 Q---IPKEILES---NIPLLGICYGQQIMCQSL 96 + + ++ILE ++GIC G Q++ + L Sbjct: 310 REGGMDEKILEYARKGGDVIGICGGYQMLGRRL 342 >gnl|CDD|30178 cd01991, Asn_Synthase_B_C, The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .. Length = 269 Score = 28.9 bits (64), Expect = 3.5 Identities = 12/47 (25%), Positives = 21/47 (44%) Query: 220 VGNERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVE 266 + V +SGG+DS++ A L + + + GF +E E Sbjct: 13 RSDVPVGVLLSGGLDSSLVAALAARLLPEPVKTFSIGFGFEGSDERE 59 >gnl|CDD|119402 cd00490, Met_repressor_MetJ, Met Repressor, MetJ. MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine. MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence. MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.. Length = 103 Score = 28.7 bits (64), Expect = 3.6 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482 Y E K+ +KI TV +P++ + ++ DERT V +LR T+ + + F H Sbjct: 11 YAEHGKKSEQVKKI----TVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLH 63 >gnl|CDD|110348 pfam01340, MetJ, Met Apo-repressor, MetJ. Length = 104 Score = 28.5 bits (63), Expect = 4.4 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Query: 426 YREEIHKAGIYRKIWQAFTVLLPVQTVGVMGDERTYEYVCSLRAVTSIDGMTADFYH 482 Y E K+ +KI TV +P++ + ++ DERT V +LR T+ + + F H Sbjct: 11 YAEHGKKSEQVKKI----TVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLH 63 >gnl|CDD|38657 KOG3447, KOG3447, KOG3447, Mitochondrial/chloroplast ribosomal S17-like protein [Translation, ribosomal structure and biogenesis]. Length = 150 Score = 28.4 bits (63), Expect = 4.7 Identities = 17/81 (20%), Positives = 28/81 (34%), Gaps = 11/81 (13%) Query: 269 ISLFKGYPNFPLRVVD-ASERFIRKLKNIVDPETKRKVIGQLFIE--------VFE--EE 317 L + P + V + K+ I+DP T +K G ++E + Sbjct: 63 TVLIRALPVRRTKHVKHEVAEVVFKVGKIIDPVTGKKCAGDTYLESPLSKETTQLSKNLK 122 Query: 318 AKKIGGAQFLGQGTLYPDVIE 338 I AQF + L +E Sbjct: 123 ELNIESAQFRERRALQIRRLE 143 >gnl|CDD|30716 COG0367, AsnB, Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]. Length = 542 Score = 28.5 bits (63), Expect = 4.8 Identities = 30/193 (15%), Positives = 58/193 (30%), Gaps = 28/193 (14%) Query: 212 IVSRIKEQVGNERVICA-VSGGVDST-VAAFLIYEAIGINLTCVLVDHGFMRKNEVENII 269 + +K ++ + + +SGG+DS+ +AA E T V + + Sbjct: 219 LEDAVKRRLVADVPVGVFLSGGLDSSLIAAIAAEELGKEGKTTFTVGFEDSDSPDAKYAR 278 Query: 270 SLFK--GYPN--FPLRVVDASERFIRKLKNIVDPETKRKVIGQLFIEVFEEEAKKIGGAQ 325 ++ K G P+ L + +K + P I + + + Sbjct: 279 AVAKFLGTPHHEIILTNEELLNALPEVVKALDTPGGMAASIPLYL--LSRKARAEGEKVV 336 Query: 326 FLGQGTLYPDVIESISFFGGPSSIIKSHHNVGGLPEHMDMKLVEPLKELF--------KD 377 G+G + FGG + PE + + + L Sbjct: 337 LSGEG--------ADELFGGYPPYSRFA----PGPEELLNEALRRALALIDYNRLARDDR 384 Query: 378 EVRLLGKELRLPD 390 G E R+P Sbjct: 385 VAAAFGVEARVPF 397 >gnl|CDD|30948 COG0603, COG0603, Predicted PP-loop superfamily ATPase [General function prediction only]. Length = 222 Score = 28.3 bits (63), Expect = 5.4 Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Query: 223 ERVICAVSGGVDSTVAAFLIYEAIGINLTCVLVDHGFMRKNEVENIISLFKGYPNFPLRV 282 ++ + +SGG+DST + G + + D+G + E+E L K P + Sbjct: 3 KKAVVLLSGGLDSTTCLAWAKKE-GYEVHALTFDYGQRHRKELEAAKELAKKL-GVPHHI 60 Query: 283 VDAS 286 +D Sbjct: 61 IDVD 64 >gnl|CDD|147331 pfam05099, TerB, Tellurite resistance protein TerB. This family contains the TerB tellurite resistance proteins from a a number of bacteria. Length = 140 Score = 28.3 bits (64), Expect = 5.7 Identities = 6/24 (25%), Positives = 12/24 (50%) Query: 287 ERFIRKLKNIVDPETKRKVIGQLF 310 F R +K+ D E + ++ L+ Sbjct: 81 YEFTRAIKDHFDYEQRLALLEALW 104 >gnl|CDD|38907 KOG3703, KOG3703, KOG3703, Heparan sulfate N-deacetylase/N-sulfotransferase [Posttranslational modification, protein turnover, chaperones]. Length = 873 Score = 28.0 bits (62), Expect = 6.0 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 11/63 (17%) Query: 137 SHGDQVEHIPEGFEVIASSDSTPFAFIADEKR----KYYAVQ-------FHPEVVHTVGG 185 +H D V +EVI++S S P A A + R +YA F + + + G Sbjct: 710 AHEDPVALNYSFYEVISASSSAPSALKALQNRCLVPGWYATHLERWLTYFPAQQLLIIDG 769 Query: 186 SQL 188 QL Sbjct: 770 QQL 772 >gnl|CDD|107285 cd06290, PBP1_LacI_like_9, Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor. Length = 265 Score = 28.1 bits (63), Expect = 6.3 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 20/90 (22%) Query: 10 VLIIDFGSQFT----QLIARRVRESKVYCEVIA--------FKNALDYFKEQNPQAIILS 57 VL DF S F + + R + S Y +IA AL+ K + A+IL Sbjct: 4 VLTQDFASPFYGRILKGMERGLNGSG-YSPIIATGHWNQSRELEALELLKSRRVDALILL 62 Query: 58 GSPASSLDIDSPQIPKEILESNIPLLGICY 87 G D+ +I L IP+L + Sbjct: 63 GG-----DLPEEEI--LALAEEIPVLAVGR 85 >gnl|CDD|35248 KOG0025, KOG0025, KOG0025, Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription, Energy production and conversion]. Length = 354 Score = 28.0 bits (62), Expect = 6.4 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 366 KLVEPLKELFKDEVRLLGKELRLPDSFVERHPCPGPGLAIRCIG 409 +L + LK L EV + +ELR + P P LA+ C+G Sbjct: 200 ELKKQLKSLGATEV-ITEEELRDRKMKKFKGDNPRPRLALNCVG 242 >gnl|CDD|66449 pfam02764, Diphtheria_T, Diphtheria toxin, T domain. Central domain of diphtheria toxin is the translocation (T) domain. pH induced conformational change in this domain triggers insertion into the endosomal membrane and facilitates the transfer of the catalytic domain into the cytoplasm. Length = 180 Score = 28.2 bits (62), Expect = 6.5 Identities = 40/154 (25%), Positives = 68/154 (44%), Gaps = 21/154 (13%) Query: 141 QVEHIPEGFEVIASSDSTPFAFIADEKRKYYAVQFH------PEV--VHTVGGSQLI--- 189 ++E + E + +P +++EK K Y +FH PE+ + TV G+ + Sbjct: 17 KIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAG 76 Query: 190 DNFVH---HVAGIQDNWVMSSYHKEIVS-RIKEQVGNERVIC--AVSGGVDSTVAAFLIY 243 N+ +VA + D+ + K + I +G+ I AV + VA + Sbjct: 77 ANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIAL 136 Query: 244 EAI----GINLTCVLVDHGFMRKNEVENIISLFK 273 ++ I L LVD GF N VE+II+LF+ Sbjct: 137 SSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQ 170 >gnl|CDD|30168 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase activity (sulphate adenylate transferase) .. Length = 173 Score = 28.1 bits (62), Expect = 6.6 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 224 RVICAVSGGVDSTVAAFLIYEAI--GINLTCVLVDHGF 259 V+ + SGG DSTV L +A+ + + +D G+ Sbjct: 1 NVVVSFSGGKDSTVLLHLALKALPELKPVPVIFLDTGY 38 >gnl|CDD|173972 cd08207, RLP_NonPhot, Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria. Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV, which differ in their taxonomic distribution and subunit composition. Form I-III have Rubisco activity, while Form IV, also called Rubisco-like proteins (RLP), are missing critical active site residues and therefore do not catalyze CO2 fixation. They are believed to utilize a related enzymatic mechanism, but have divergent functions. The specific function of this subgroup is unknown. Length = 406 Score = 27.7 bits (62), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Query: 379 VRLLGKELRLPDSFVERHPCPGPGLA 404 +RL+ +L LPD F P P G+A Sbjct: 109 LRLV--DLGLPDEFAAAFPGPAFGIA 132 >gnl|CDD|112830 pfam04031, Las1, Las1-like. Las1 is an essential nuclear protein involved in cell morphogenesis and cell surface growth. Length = 149 Score = 27.6 bits (62), Expect = 7.8 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 367 LVEPLKE-LFKDEVRLLGKELRLPDSFVE-RHPC 398 L++P ++ + +R L KE+ LP+ FVE RH Sbjct: 86 LLDPTQQGQYAIPMRKLAKEIGLPEWFVELRHEA 119 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.408 Gapped Lambda K H 0.267 0.0788 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 6,528,166 Number of extensions: 361929 Number of successful extensions: 1085 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1047 Number of HSP's successfully gapped: 89 Length of query: 520 Length of database: 6,263,737 Length adjustment: 98 Effective length of query: 422 Effective length of database: 4,146,055 Effective search space: 1749635210 Effective search space used: 1749635210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 60 (26.8 bits)