HHsearch alignment for GI: 254780416 and conserved domain: COG1941

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion].
Probab=96.01  E-value=0.0022  Score=37.75  Aligned_cols=44  Identities=27%  Similarity=0.649  Sum_probs=37.4

Q ss_pred             HCCCCCCCCHHHHCCCCCCCCCCCEEEEEHHHCCCCCHHHHHHHHHHC
Q ss_conf             208979975267477743114674479940130257715878742002
Q gi|254780416|r    8 NCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAI   55 (113)
Q Consensus         8 ~C~~C~~~~Cv~~CP~~ai~~~~~~~~id~~~Ci~Cg~C~~~CP~~AI   55 (113)
T Consensus       191 ~C~G~--~TC~A~CP~~ai~c~G--c~g~~~~~~~~Ga~~v~~~rs~~  234 (247)
T COG1941         191 PCMGC--GTCAASCPSRAIPCRG--CRGNIPRCIKCGACFVSCPRSKG  234 (247)
T ss_pred             CCCCC--HHHHCCCCCCCCCCCC--CCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             43472--4543539735776437--76773200144589998757765