HHsearch alignment for GI: 254780416 and conserved domain: PRK02651

>PRK02651 photosystem I subunit VII; Provisional.
Probab=98.84  E-value=7.9e-10  Score=72.53  Aligned_cols=55  Identities=33%  Similarity=0.771  Sum_probs=42.8

Q ss_pred             CCE--EECHHCCCCCCCCHHHHCCCCCCCCCC---CE-EEE----EHHHCCCCCHHHHHHHHHHCCC
Q ss_conf             967--747220897997526747774311467---44-799----4013025771587874200256
Q gi|254780416|r    1 MTY--VVTENCILCKHTDCVEVCPVDCFYEGE---NF-LAI----HPDECIDCGVCEPECPVDAIKP   57 (113)
Q Consensus         1 M~y--vv~~~C~~C~~~~Cv~~CP~~ai~~~~---~~-~~i----d~~~Ci~Cg~C~~~CP~~AI~~   57 (113)
T Consensus         1 ~~~~~~~~D~CIgC--~qCV~~CPt~VleMvp~~g~k~~q~~~~pR~edCIGCk~Ce~aCPtd~lsi   65 (81)
T PRK02651          1 MSHAVKIYDTCIGC--TQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPTDFLSI   65 (81)
T ss_pred             CCCCCEECCCCCCH--HHHHHHCCCCCEEECCCCCCCCCCCCCCCCHHHCCCHHHHHHCCCCCCEEE
T ss_conf             99740650313674--566865887603642467761350225884543335144663089985047