HHsearch alignment for GI: 254780416 and conserved domain: PRK12387

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional.
Probab=97.94  E-value=1.7e-06  Score=54.52  Aligned_cols=46  Identities=24%  Similarity=0.489  Sum_probs=27.8

Q ss_pred             EECHHCCCCCCCCHHHHCCCCCCCCCCCE-------------EEEEHHHCCCCCHHHHHHH
Q ss_conf             74722089799752674777431146744-------------7994013025771587874
Q gi|254780416|r    4 VVTENCILCKHTDCVEVCPVDCFYEGENF-------------LAIHPDECIDCGVCEPECP   51 (113)
Q Consensus         4 vv~~~C~~C~~~~Cv~~CP~~ai~~~~~~-------------~~id~~~Ci~Cg~C~~~CP   51 (113)
T Consensus        70 id~~rCifC--G~C~evCPt~AI~lt~efElA~~~k~dl~~~~~~~~~~C~~CG~~f~~~~  128 (178)
T PRK12387         70 FNLGRCIFC--GRCEEVCPTAAIKLSQEYELAVWKKEDLLQQSRFALCNCRVCGRPFAVQK  128 (178)
T ss_pred             ECCCCCCCC--CHHHHHCCCCCCCCCHHHHHHHCCHHHCEEEEEEEEEECCCCCCCCCCHH
T ss_conf             630406686--71566688242233618775412553445676870221563478055436