>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase. This subunit contains four 4Fe-4S clusters and is involved in transmitting electrons from the alpha subunit (IPR006443 from INTERPRO) at the periplasmic space to the gamma subunit which spans the cytoplasmic membrane . In addition to the gamma proteobacteria, a sequence from Aquifex aolicus falls within this group. This appears to be the case for the alpha, gamma and epsilon (accessory protein IPR006452 from INTERPRO) chains as well. ; GO: 0008863 formate dehydrogenase activity, 0045333 cellular respiration, 0016021 integral to membrane.

Probab=98.69 E-value=4.7e-09 Score=68.35 Aligned_cols=56 Identities=25% Similarity=0.789 Sum_probs=44.7 Q ss_pred EEECHHCCCCCCCCHHHHCCC-CCCCCCCCEEE-EEHHHCCCCCHHHHHHHHHHCCCC Q ss_conf 774722089799752674777-43114674479-940130257715878742002566 Q gi|254780416|r 3 YVVTENCILCKHTDCVEVCPV-DCFYEGENFLA-IHPDECIDCGVCEPECPVDAIKPD 58 (113) Q Consensus 3 yvv~~~C~~C~~~~Cv~~CP~-~ai~~~~~~~~-id~~~Ci~Cg~C~~~CP~~AI~~d 58 (113) T Consensus 97 lIrKdgCMHC~ePGCL~ACPaPGAiiQY~NGiVDF~h~kCIGCgyCi~GCPFnIPR~~ 154 (293) T TIGR01582 97 LIRKDGCMHCREPGCLKACPAPGAIIQYQNGIVDFDHEKCIGCGYCIVGCPFNIPRID 154 (293) T ss_pred EEEECCCCCCCCCCCCCCCCCCCCEEEECCCEEECCCCCEECCCCCCCCCCCCCCCCC T ss_conf 7862473213877853225867845750486374115860006730258788888887

HHsearch alignment for GI: 254780416 and conserved domain: TIGR01582