>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase. Some species with this reductase lack NapC but accomplish electron transfer to NapAB in some other manner, likely to involve NapH, NapG, and/or some other protein. A few members of this protein are designated MauN and are found in methylamine utilization operons in species that appear to lack a periplasmic nitrate reductase.; GO: 0005506 iron ion binding, 0006118 electron transport.

Probab=96.90 E-value=0.00015 Score=44.09 Aligned_cols=42 Identities=24% Similarity=0.619 Sum_probs=31.7 Q ss_pred CCCHHHHCCCCCCCCC--CC---EE-EEEHHHCCCCCHHHHHHHHHHC Q ss_conf 9752674777431146--74---47-9940130257715878742002 Q gi|254780416|r 14 HTDCVEVCPVDCFYEG--EN---FL-AIHPDECIDCGVCEPECPVDAI 55 (113) Q Consensus 14 ~~~Cv~~CP~~ai~~~--~~---~~-~id~~~Ci~Cg~C~~~CP~~AI 55 (113) T Consensus 174 rgWCgHlCP~GA~Yg~iG~~s~~ki~~~~~~~C~~Cm~C~~vCpEp~V 221 (263) T TIGR02163 174 RGWCGHLCPLGALYGLIGRKSLIKIAASDREKCTNCMDCFNVCPEPQV 221 (263) T ss_pred CCCCCCCCHHHHHHHHHHHHHHHHEEECCHHCCCCCCCCCCCCCCHHH T ss_conf 764266004578999874014321243023226877577601585201

HHsearch alignment for GI: 254780416 and conserved domain: TIGR02163