>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA. ACS forms a heterotetramer with carbon monoxide dehydrogenase (CODH) consisting of two ACS and two CODH subunits. CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP). ACS has three structural domains, an N-terminal rossman fold domain with a helical region at its N-terminus which interacts with CODH, and two alpha + beta fold domains. A Ni-Fe-S center referred to as the A-cluster is located in the C-terminal domain. A large cavity exists between the three domains which may bind CoA.

Probab=97.12 E-value=6.6e-05 Score=45.98 Aligned_cols=49 Identities=35% Similarity=0.805 Sum_probs=34.5 Q ss_pred CHHCCCCCCCCHHHHCCCC-----CCCCC--CCE--EEEEHHHCCCCCHHHHHHHHHHCC Q ss_conf 7220897997526747774-----31146--744--799401302577158787420025 Q gi|254780416|r 6 TENCILCKHTDCVEVCPVD-----CFYEG--ENF--LAIHPDECIDCGVCEPECPVDAIK 56 (113) Q Consensus 6 ~~~C~~C~~~~Cv~~CP~~-----ai~~~--~~~--~~id~~~Ci~Cg~C~~~CP~~AI~ 56 (113) T Consensus 364 a~~Ct~C--~~C~~~CPn~l~I~eam~~a~~gdls~l~~l~d~CvgCgrCE~~C~k~ipI 421 (731) T cd01916 364 AAKCTDC--GWCTRACPNSLRIKEAMEAAKEGDFSGLADLFDQCVGCGRCEQECPKEIPI 421 (731) T ss_pred HHHCCCC--CHHHHHCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCH T ss_conf 9865323--226654988686388999876078078899988620020187754468855

HHsearch alignment for GI: 254780416 and conserved domain: cd01916