BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] (113 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Score = 233 bits (595), Expect = 5e-64, Method: Compositional matrix adjust. Identities = 113/113 (100%), Positives = 113/113 (100%) Query: 1 MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE 60 MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE Sbjct: 1 MTYVVTENCILCKHTDCVEVCPVDCFYEGENFLAIHPDECIDCGVCEPECPVDAIKPDTE 60 Query: 61 PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT 113 PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT Sbjct: 61 PGLELWLKINSEYATQWPNITTKKESLPSAAKMDGVKQKYEKYFSPNPGGKNT 113 >gi|254780861|ref|YP_003065274.1| NADH dehydrogenase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 163 Score = 29.6 bits (65), Expect = 0.017, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 13/60 (21%) Query: 7 ENCILCKHTDCVEVCPVDCF--------YEGENFLA---IHPDECIDCGVCEPECPVDAI 55 E CI CK C +CP ++G I +CI CG+C+ CPVDAI Sbjct: 61 ERCIACKL--CEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAI 118 Score = 29.6 bits (65), Expect = 0.017, Method: Compositional matrix adjust. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Query: 27 YEGENFLAIHPD---ECIDCGVCEPECPVDAIKPDTEP 61 + GE+ L +P+ CI C +CE CP AI ++ P Sbjct: 47 FRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGP 84 Score = 24.6 bits (52), Expect = 0.52, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Query: 9 CILCKHTDCVEVCPVDCFYEGENF 32 CI C C E CPVD EG NF Sbjct: 103 CIYCGL--CQEACPVDAIVEGPNF 124 >gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] Length = 143 Score = 24.6 bits (52), Expect = 0.43, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 39 ECID-CGVCEPECPVDAIKPDTEPGL-ELWLKINSEYATQ 76 EC+D C VC CPV + P L + L ++S + Q Sbjct: 83 ECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122 >gi|254781024|ref|YP_003065437.1| electron transfer flavoprotein-ubiquinone oxidoreductase [Candidatus Liberibacter asiaticus str. psy62] Length = 554 Score = 22.3 bits (46), Expect = 2.7, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 8/17 (47%) Query: 30 ENFLAIHPDECIDCGVC 46 EN IH CI C C Sbjct: 513 ENNYIIHAQNCIHCKAC 529 >gi|254780808|ref|YP_003065221.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 21.6 bits (44), Expect = 4.6, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Query: 16 DCVEVCPVDCFYEGENFLAIHPDECIDCGVCEP 48 DC+ CF ++++ + D+ GV EP Sbjct: 397 DCI------CFSRTDSYIGVMIDDLTSKGVLEP 423 >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 21.2 bits (43), Expect = 4.8, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 30 ENFLAIHPDECIDCGVCE 47 EN+L IH D +D G Sbjct: 85 ENYLVIHDDLDLDFGTLR 102 >gi|254781072|ref|YP_003065485.1| hypothetical protein CLIBASIA_04870 [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 20.8 bits (42), Expect = 7.2, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 30 ENFLAIHPDECIDCGVCEPECPV 52 E F+ + D+C +C +C + V Sbjct: 142 EEFIELGFDQCDECDLCSEKADV 164 >gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 20.8 bits (42), Expect = 7.7, Method: Composition-based stats. Identities = 7/17 (41%), Positives = 9/17 (52%) Query: 11 LCKHTDCVEVCPVDCFY 27 L + DC+ V V C Y Sbjct: 266 LLERNDCIVVSSVSCIY 282 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.136 0.453 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,935 Number of Sequences: 1233 Number of extensions: 2693 Number of successful extensions: 12 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 113 length of database: 328,796 effective HSP length: 63 effective length of query: 50 effective length of database: 251,117 effective search space: 12555850 effective search space used: 12555850 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 33 (17.3 bits)