BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD family protein [Candidatus Liberibacter asiaticus str. psy62] (188 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 188 Score = 389 bits (998), Expect = e-110, Method: Compositional matrix adjust. Identities = 188/188 (100%), Positives = 188/188 (100%) Query: 1 MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60 MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP Sbjct: 1 MTFQQKRDAMRQGFRTGEHIVYPAHGVGTITEIKEQEVAGMKLEFFVIAFDKDKMCLKVP 60 Query: 61 VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120 VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR Sbjct: 61 VGKAIDIGMRKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVR 120 Query: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST Sbjct: 121 DLHRTDSQPEKSYSERQLYESALNRMVREIAAVNSISEPEAINLIEVNLSSKSSKTEKST 180 Query: 181 SENQDKAA 188 SENQDKAA Sbjct: 181 SENQDKAA 188 >gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] Length = 178 Score = 23.9 bits (50), Expect = 1.7, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 70 RKLSEAHFVERALKLVRGKARVKRTMWSRRAQEYDAKINSGDLIAIAEVVRDLHRTDS 127 R+ S + E LK G+ V R+ ++ E + I+SG ++ I+ +R + TD+ Sbjct: 74 RQSSNVYICEPVLK---GQLPVVRSKRKSKSMEKNNTISSGIVLPISRCLRLMELTDN 128 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 21.9 bits (45), Expect = 6.4, Method: Compositional matrix adjust. Identities = 9/24 (37%), Positives = 13/24 (54%) Query: 17 GEHIVYPAHGVGTITEIKEQEVAG 40 G IV+ HG+G + EV+G Sbjct: 506 GAIIVHAEHGIGRFVRLYSIEVSG 529 >gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Score = 21.9 bits (45), Expect = 7.7, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 58 KVPVGKAIDIGMRKLSEAHFVERA 81 K VGKA+ IG+R + + V+R+ Sbjct: 124 KFVVGKALKIGLRPIVVVNKVDRS 147 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.315 0.129 0.348 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,425 Number of Sequences: 1233 Number of extensions: 3596 Number of successful extensions: 7 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 188 length of database: 328,796 effective HSP length: 69 effective length of query: 119 effective length of database: 243,719 effective search space: 29002561 effective search space used: 29002561 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 36 (18.5 bits)