RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780418|ref|YP_003064831.1| 50S ribosomal protein L25/general stress protein Ctc [Candidatus Liberibacter asiaticus str. psy62] (191 letters) >gnl|CDD|144833 pfam01386, Ribosomal_L25p, Ribosomal L25p family. Ribosomal protein L25 is an RNA binding protein, that binds 5S rRNA. This family includes Ctc from B. subtilis, which is induced by stress. Length = 87 Score = 103 bits (260), Expect = 3e-23 Identities = 33/88 (37%), Positives = 54/88 (61%), Gaps = 1/88 (1%) Query: 8 LSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTL 67 L A R++ GKG++R LR+ G++PA+IYG +P I++ K++ K L + T++ L Sbjct: 1 LKAEKREETGKGASRRLRREGKVPAVIYGKGKEPVSISVDEKELEK-LLREAGENTVIEL 59 Query: 68 DIGKELVHVIPKDYQLDPVSDILIHADF 95 I + +V+ KD Q PV D ++H DF Sbjct: 60 KIDGKKENVLIKDVQRHPVKDKILHVDF 87 >gnl|CDD|88604 cd00495, Ribosomal_L25_TL5_CTC, Ribosomal_L25_TL5_CTC: Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain. L25 is a single-domain protein, homologous to the N-terminal domain of TL5 and CTC, which each contain two domains. CTC is a known stress protein, and proteins of this family are believed to have two functions, acting as both ribosomal and stress proteins. In Escherichia coli, cells deleted for L25 were found to be viable; however, these cells grew slowly and had impaired protein synthesis capability. In Bacillus subtilis, CTC is induced under stress conditions and located in the ribosome; it has been proposed that CTC may be necessary for accurate translation under stress conditions. Ribosomal_L25_TL5_CTC is found only in bacteria and some plastids. Due to its limited taxonomic diversity and the viability of cells deleted for L25, this protein is not believed to be necessary for ribosomal assembly. Eukaryotes contain a protein called L25, which is not homologous to bacterial L25, but rather to bacterial L23.. Length = 91 Score = 95.6 bits (238), Expect = 7e-21 Identities = 34/91 (37%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Query: 7 KLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILT 66 L A R++ GKG++R LR+ G++PA+IYG +P I++ K++ K L + +T++ Sbjct: 2 TLKAEKREETGKGASRRLRRAGKVPAVIYGKGKEPISISVDEKELEKLLRKEGR-STLIE 60 Query: 67 LDIGKELVHVIPKDYQLDPVSDILIHADFLQ 97 L+I + +V+ KD Q PV D ++H DFL+ Sbjct: 61 LNIDGKKENVLIKDVQRHPVKDKILHVDFLR 91 >gnl|CDD|32010 COG1825, RplY, Ribosomal protein L25 (general stress protein Ctc) [Translation, ribosomal structure and biogenesis]. Length = 93 Score = 92.6 bits (230), Expect = 6e-20 Identities = 36/92 (39%), Positives = 59/92 (64%), Gaps = 1/92 (1%) Query: 7 KLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILT 66 +L A +R GKG++R LR+ G+IPA++YG +P IAL + +K L K +T++T Sbjct: 3 ELEAEVRTSQGKGASRRLRRAGKIPAVVYGGGKEPVNIALDHHEFAKALR-KLGYSTVIT 61 Query: 67 LDIGKELVHVIPKDYQLDPVSDILIHADFLQV 98 L++ + + V+ KD Q P++D + H DFL+V Sbjct: 62 LEVDGKEIKVLVKDVQRHPLTDEVQHIDFLRV 93 >gnl|CDD|32749 COG2925, SbcB, Exonuclease I [DNA replication, recombination, and repair]. Length = 475 Score = 28.4 bits (63), Expect = 1.2 Identities = 11/38 (28%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 40 DPKP-IALSAKDISKRLYSKNFMTTILTLDIGKELVHV 76 D P + L A + +RLY++ L + +LVH+ Sbjct: 267 DISPLLELDADTLRERLYTRKADLGEGELAVPVKLVHI 304 >gnl|CDD|107217 cd06461, M2_ACE, Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither have a cardiovascular system nor synthesize angiotensin. ACE is well-known as a key part of the renin-angiotensin system that regulates blood pressure and ACE inhibitors are important for the treatment of hypertension. Length = 477 Score = 27.2 bits (61), Expect = 3.2 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 7 KLSAVMRDKV-GKGSARLLRKNGQIPAIIYGNM 38 +L A +R K+ K ++ ++G IPA + GNM Sbjct: 117 QLHAYVRRKLRKKYGDDVVNRDGPIPAHLLGNM 149 >gnl|CDD|147630 pfam05555, DUF762, Coxiella burnetii protein of unknown function (DUF762). This family consists several of several uncharacterized proteins from the bacterium Coxiella burnetii. Coxiella burnetii is the causative agent of the Q fever disease. Length = 247 Score = 27.2 bits (60), Expect = 3.3 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Query: 112 FINENKSPGIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRL 167 FI E K I + G + C +V + P + + GD +++E I+L Sbjct: 162 FIGEVKVSLISKDGDIIHACKKVEIAVPGAKL------NSFKKHFGDQLNVETIKL 211 >gnl|CDD|31123 COG0780, COG0780, Enzyme related to GTP cyclohydrolase I [General function prediction only]. Length = 149 Score = 26.8 bits (59), Expect = 3.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 129 VVCHEVSLLCPANNIPDSITV 149 +V E LCP PD T+ Sbjct: 44 LVSPEFKSLCPITGQPDFATI 64 >gnl|CDD|39018 KOG3814, KOG3814, KOG3814, Signaling protein van gogh/strabismus [Signal transduction mechanisms]. Length = 531 Score = 26.5 bits (58), Expect = 4.3 Identities = 16/64 (25%), Positives = 24/64 (37%), Gaps = 9/64 (14%) Query: 90 LIHADFLQ--VSEGSTVTVHVPVRFI-------NENKSPGIKQGGKLNVVCHEVSLLCPA 140 L FL+ +S G T +E S G++ G + H+VSL+ Sbjct: 442 LSPRAFLERYLSAGPTPQYEKERWLESQWSLICDEAVSNGLQDGIVFVLKSHDVSLVVTV 501 Query: 141 NNIP 144 IP Sbjct: 502 KKIP 505 >gnl|CDD|176700 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping. Length = 125 Score = 25.7 bits (57), Expect = 8.7 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Query: 44 IALSAKDISKRLYSKNFMTTILTLDIGKELVHVIPKDYQLD 84 +A+ D K SK F IL + +E+ Y+LD Sbjct: 7 VAIICSDYEK---SKEFYVEILGFKVIREVYRPERGSYKLD 44 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0577 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,159,577 Number of extensions: 106927 Number of successful extensions: 245 Number of sequences better than 10.0: 1 Number of HSP's gapped: 242 Number of HSP's successfully gapped: 14 Length of query: 191 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 103 Effective length of database: 4,362,145 Effective search space: 449300935 Effective search space used: 449300935 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.3 bits)